NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F048064

Metagenome Family F048064

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048064
Family Type Metagenome
Number of Sequences 148
Average Sequence Length 54 residues
Representative Sequence MEDTIAEGFRGHRQLPYAHWITFLIHRAVTVGPPEMLAEYSGATTEFPAYNMT
Number of Associated Samples 69
Number of Associated Scaffolds 148

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.80 %
% of genes near scaffold ends (potentially truncated) 70.95 %
% of genes from short scaffolds (< 2000 bps) 96.62 %
Associated GOLD sequencing projects 69
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (89.189 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere
(95.946 % of family members)
Environment Ontology (ENVO) Unclassified
(95.946 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(95.946 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.74%    β-sheet: 0.00%    Coil/Unstructured: 59.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.19 %
UnclassifiedrootN/A10.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005459|Ga0068867_102154362All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar529Open in IMG/M
3300009148|Ga0105243_12917420All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar518Open in IMG/M
3300013296|Ga0157374_12398782Not Available555Open in IMG/M
3300013297|Ga0157378_12797308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar540Open in IMG/M
3300013297|Ga0157378_13018213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar522Open in IMG/M
3300015267|Ga0182122_1009189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar878Open in IMG/M
3300015267|Ga0182122_1022090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae697Open in IMG/M
3300015268|Ga0182154_1011506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar828Open in IMG/M
3300015269|Ga0182113_1061449All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar580Open in IMG/M
3300015269|Ga0182113_1080915All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar533Open in IMG/M
3300015269|Ga0182113_1096850All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar503Open in IMG/M
3300015274|Ga0182188_1051621All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar529Open in IMG/M
3300015274|Ga0182188_1060384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae507Open in IMG/M
3300015275|Ga0182172_1011447All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae847Open in IMG/M
3300015275|Ga0182172_1014892Not Available791Open in IMG/M
3300015276|Ga0182170_1050422All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae571Open in IMG/M
3300015277|Ga0182128_1013328All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar826Open in IMG/M
3300015277|Ga0182128_1024698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae701Open in IMG/M
3300015279|Ga0182174_1039079All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae635Open in IMG/M
3300015279|Ga0182174_1051408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar587Open in IMG/M
3300015279|Ga0182174_1080772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar512Open in IMG/M
3300015281|Ga0182160_1008490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar948Open in IMG/M
3300015281|Ga0182160_1016938All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar786Open in IMG/M
3300015281|Ga0182160_1031590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar664Open in IMG/M
3300015281|Ga0182160_1073784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae523Open in IMG/M
3300015282|Ga0182124_1039209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar623Open in IMG/M
3300015282|Ga0182124_1065988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar537Open in IMG/M
3300015283|Ga0182156_1053739Not Available583Open in IMG/M
3300015283|Ga0182156_1065235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar550Open in IMG/M
3300015285|Ga0182186_1062666All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar547Open in IMG/M
3300015286|Ga0182176_1024421All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar744Open in IMG/M
3300015286|Ga0182176_1027522All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar717Open in IMG/M
3300015287|Ga0182171_1045911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar611Open in IMG/M
3300015289|Ga0182138_1025742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar718Open in IMG/M
3300015289|Ga0182138_1048928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar601Open in IMG/M
3300015289|Ga0182138_1055797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar578Open in IMG/M
3300015289|Ga0182138_1069547Not Available542Open in IMG/M
3300015291|Ga0182125_1040955All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae644Open in IMG/M
3300015292|Ga0182141_1021625Not Available767Open in IMG/M
3300015292|Ga0182141_1050850All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae604Open in IMG/M
3300015292|Ga0182141_1057696All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar582Open in IMG/M
3300015294|Ga0182126_1036529All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar669Open in IMG/M
3300015295|Ga0182175_1062835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae577Open in IMG/M
3300015295|Ga0182175_1083110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar530Open in IMG/M
3300015295|Ga0182175_1093303All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar511Open in IMG/M
3300015295|Ga0182175_1095215All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae507Open in IMG/M
3300015296|Ga0182157_1033519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar702Open in IMG/M
3300015296|Ga0182157_1052518All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar617Open in IMG/M
3300015298|Ga0182106_1048968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae631Open in IMG/M
3300015298|Ga0182106_1074003All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar557Open in IMG/M
3300015299|Ga0182107_1102805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae505Open in IMG/M
3300015300|Ga0182108_1084770All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar541Open in IMG/M
3300015302|Ga0182143_1049689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar630Open in IMG/M
3300015303|Ga0182123_1048093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae620Open in IMG/M
3300015303|Ga0182123_1080363All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae535Open in IMG/M
3300015303|Ga0182123_1089889All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar517Open in IMG/M
3300015304|Ga0182112_1106147All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar502Open in IMG/M
3300015305|Ga0182158_1038649All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae676Open in IMG/M
3300015305|Ga0182158_1042743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar657Open in IMG/M
3300015305|Ga0182158_1094964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae518Open in IMG/M
3300015307|Ga0182144_1054973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae619Open in IMG/M
3300015307|Ga0182144_1056520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar614Open in IMG/M
3300015314|Ga0182140_1013031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae950Open in IMG/M
3300015314|Ga0182140_1075705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar575Open in IMG/M
3300015321|Ga0182127_1108258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae526Open in IMG/M
3300015322|Ga0182110_1012760All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar986Open in IMG/M
3300015322|Ga0182110_1057276All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar641Open in IMG/M
3300015322|Ga0182110_1099479All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar540Open in IMG/M
3300015322|Ga0182110_1105837All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae529Open in IMG/M
3300015323|Ga0182129_1027736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar768Open in IMG/M
3300015323|Ga0182129_1073001All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar580Open in IMG/M
3300015323|Ga0182129_1110814Not Available510Open in IMG/M
3300015341|Ga0182187_1110574All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar624Open in IMG/M
3300015341|Ga0182187_1159994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar546Open in IMG/M
3300015342|Ga0182109_1185853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar539Open in IMG/M
3300015342|Ga0182109_1217730All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar507Open in IMG/M
3300015343|Ga0182155_1041531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar913Open in IMG/M
3300015343|Ga0182155_1064330All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar787Open in IMG/M
3300015343|Ga0182155_1140717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar599Open in IMG/M
3300015343|Ga0182155_1185301All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar541Open in IMG/M
3300015344|Ga0182189_1178134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar554Open in IMG/M
3300015344|Ga0182189_1214398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar515Open in IMG/M
3300015344|Ga0182189_1229141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar501Open in IMG/M
3300015345|Ga0182111_1219072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar525Open in IMG/M
3300015346|Ga0182139_1135141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar634Open in IMG/M
3300015346|Ga0182139_1149223All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar610Open in IMG/M
3300015346|Ga0182139_1206922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar538Open in IMG/M
3300015347|Ga0182177_1129937All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar645Open in IMG/M
3300015351|Ga0182161_1174167All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar597Open in IMG/M
3300015355|Ga0182159_1129764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar771Open in IMG/M
3300015361|Ga0182145_1051471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar782Open in IMG/M
3300015361|Ga0182145_1156760All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar541Open in IMG/M
3300015361|Ga0182145_1160083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar537Open in IMG/M
3300017404|Ga0182203_1055056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar715Open in IMG/M
3300017404|Ga0182203_1095430All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar601Open in IMG/M
3300017404|Ga0182203_1104663All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar583Open in IMG/M
3300017404|Ga0182203_1119580Not Available558Open in IMG/M
3300017404|Ga0182203_1127274All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar547Open in IMG/M
3300017407|Ga0182220_1073834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar562Open in IMG/M
3300017409|Ga0182204_1026284Not Available789Open in IMG/M
3300017409|Ga0182204_1080407All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae569Open in IMG/M
3300017410|Ga0182207_1053772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar745Open in IMG/M
3300017410|Ga0182207_1170174All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae508Open in IMG/M
3300017411|Ga0182208_1077914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar590Open in IMG/M
3300017411|Ga0182208_1098614All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar548Open in IMG/M
3300017411|Ga0182208_1120663Not Available514Open in IMG/M
3300017413|Ga0182222_1066678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae571Open in IMG/M
3300017413|Ga0182222_1070668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae563Open in IMG/M
3300017413|Ga0182222_1075929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar552Open in IMG/M
3300017413|Ga0182222_1079549All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar545Open in IMG/M
3300017415|Ga0182202_1023388Not Available873Open in IMG/M
3300017424|Ga0182219_1098336All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae563Open in IMG/M
3300017425|Ga0182224_1104160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae585Open in IMG/M
3300017425|Ga0182224_1105482All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar583Open in IMG/M
3300017425|Ga0182224_1120348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar558Open in IMG/M
3300017427|Ga0182190_1092573All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar614Open in IMG/M
3300017427|Ga0182190_1100378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar597Open in IMG/M
3300017430|Ga0182192_1036448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae855Open in IMG/M
3300017430|Ga0182192_1132042All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae553Open in IMG/M
3300017430|Ga0182192_1163973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar512Open in IMG/M
3300017433|Ga0182206_1090544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar603Open in IMG/M
3300017433|Ga0182206_1121329All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae549Open in IMG/M
3300017433|Ga0182206_1144943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae518Open in IMG/M
3300017436|Ga0182209_1064511Not Available691Open in IMG/M
3300017436|Ga0182209_1138710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar542Open in IMG/M
3300017436|Ga0182209_1157539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar519Open in IMG/M
3300017438|Ga0182191_1027499All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae931Open in IMG/M
3300017442|Ga0182221_1144348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae530Open in IMG/M
3300017443|Ga0182193_1175807All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar523Open in IMG/M
3300017682|Ga0182229_1046343All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar737Open in IMG/M
3300017683|Ga0182218_1065243All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae655Open in IMG/M
3300017684|Ga0182225_1034693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar783Open in IMG/M
3300017684|Ga0182225_1081027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar602Open in IMG/M
3300017684|Ga0182225_1102968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar559Open in IMG/M
3300017684|Ga0182225_1121390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae531Open in IMG/M
3300017686|Ga0182205_1069245All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae681Open in IMG/M
3300017686|Ga0182205_1103096All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae598Open in IMG/M
3300017686|Ga0182205_1138843All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar540Open in IMG/M
3300017686|Ga0182205_1141623All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar536Open in IMG/M
3300017689|Ga0182231_1066328All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar682Open in IMG/M
3300017690|Ga0182223_1085325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar559Open in IMG/M
3300017690|Ga0182223_1120379All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae507Open in IMG/M
3300026023|Ga0207677_11737158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar579Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Miscanthus PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere95.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.35%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015267Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015268Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015269Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015274Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015275Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015276Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015277Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015279Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015281Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015282Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015283Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015285Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015286Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015287Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015289Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015291Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015292Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015294Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015295Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015296Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015298Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015299Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015300Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015302Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015303Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015304Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015305Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015307Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015314Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015321Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015322Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015323Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015341Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015342Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015343Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015344Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015345Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015346Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015347Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015351Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015355Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015361Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017404Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017407Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017409Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017410Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017411Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017413Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017415Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017424Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017425Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017427Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017430Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017433Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017436Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017438Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017442Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017443Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017682Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017683Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017684Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017686Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017689Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017690Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068867_10215436213300005459Miscanthus RhizosphereMEDTIAEGFKGRRQLPYAHWITFLILKAVQVRTPEMVAEYRGATTEFPAYNMAQRI
Ga0105243_1291742023300009148Miscanthus RhizosphereMEDTIAKGFRGHRQLPYAHWITWIIHRAVTVRPPEMLAEYSGATTEFPAYNMTQMIRH
Ga0157374_1239878213300013296Miscanthus RhizosphereKGRRQLPYAHWITFLMLKAMQVRTPEMVVEYRGATIEFPAYNMAQRIRYSTP*
Ga0157378_1279730813300013297Miscanthus RhizosphereIWDLLLSEMEDTIAEGFKGRRQLPYAHWITFLIRRVVLDKPPGMMDEYTGATTEFPAYNPS*
Ga0157378_1301821313300013297Miscanthus RhizosphereMEDTIAEGFKGHRQLPYAHWITFLIRRIVLDKPPGMMDEYTGATTEFP
Ga0182122_100918913300015267Miscanthus PhyllosphereMEDTIAKGFKGHRQLPYAHWITFLMLKAVQVRTPEMVAEYKGATIEFPAYNMAQR
Ga0182122_102209023300015267Miscanthus PhyllosphereMEDTLAEGFRGHRQLPYAHWITFLILRAVIVRPPEMLAEYSGATAEFPAYNLT*
Ga0182154_101150613300015268Miscanthus PhyllosphereEDTLAEGFRGHRQLPYAHWIIFLIHMAVTMRPLEMLAEYSGATTEFPAYNLTQMLCHSRPSAPS*
Ga0182113_106144923300015269Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWVTFLIHRAISVKSPEMIAEYSGVTTEFPAYSLSQMIRHNTPQAPSQPR
Ga0182113_108091513300015269Miscanthus PhyllosphereLSEMEDTIAKGFKGRRQLPYAHWITFLMLKAVHIRTPEMVAEYKGATTEFPAYNMA*
Ga0182113_109685013300015269Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWITFLIHMAVTVRIPKMLAEYSGATIEFPTYNMT*
Ga0182188_105162113300015274Miscanthus PhyllosphereMEDTLAEGFRGHMQLSYAHWITFLIHREVIVRPPEMLAEYSGATTEFETMQK*
Ga0182188_106038413300015274Miscanthus PhyllosphereEMENTIAEGFRGHRQLPYAHWVTFLIHRAISVKSPEMIAKYSGAMTEFPAYNMSQMIHHSTP*
Ga0182172_101144713300015275Miscanthus PhyllosphereMEDTIAEGFKGHRQLPYAHLITFLIRRAVTVRPPDMIAEYSGATTKFP
Ga0182172_101489213300015275Miscanthus PhyllosphereTLAEGFRGLCQLPYAHWITFLIRKAVIVKSPETMAEYTGATT*
Ga0182170_105042213300015276Miscanthus PhyllosphereEDTIAEGFRGHRQLPYAHWVTFLIHRAITVRSPKMIAEYSGATTEFPAYNLSQMIQHSTP
Ga0182128_101332813300015277Miscanthus PhyllosphereMEDTIAEGFRGHGQLPYAHWITFLIHRVVIVRPPEMLAEYSGATTEFLAYNMTQMI*
Ga0182128_102469813300015277Miscanthus PhyllosphereMEDTIIEGFRGHRQLSYDHWITFLIHMAVTVRPPKMLAEYS
Ga0182174_103907913300015279Miscanthus PhyllosphereMEDTLAEGFRGHCQLPYAHWITFLIRKAVTVKSPETMAEYTRA
Ga0182174_105140813300015279Miscanthus PhyllosphereTIAEGFRGHRQLPYAHWITWLIHRAVIVRPPEMLAEYSGATTEFPAYNMT*
Ga0182174_108077213300015279Miscanthus PhyllosphereLLSEMEDTIAEGFRGHRQLPYAHWITFLIHRVVTVRPPEMLAEYSGATTEFPAYNMTQMIRHSTP*
Ga0182160_100849013300015281Miscanthus PhyllosphereMEDTIAEGFRGRRQLPYAHWITFLIHRTVTVRPPEMLAEYSGATMEFPSYNMTQMIRH
Ga0182160_101693813300015281Miscanthus PhyllosphereMEDTLAEGFRGHYQLPYAHWITFLIHRAVTVRTPEMLAEYSGATTKFPAYNLT*
Ga0182160_103159023300015281Miscanthus PhyllosphereMEDTIIEGFRGHRQLPYAHWIIFLIHRAVIVRPPEMLVEYSSATIEFPAYNMT
Ga0182160_107378413300015281Miscanthus PhyllosphereMEDTIAEDFRGRRQLPYAHWITFLIHWVVTVRPSEMLAEYSGATMKF
Ga0182124_103920923300015282Miscanthus PhyllosphereMEDTIAKGFKGRRQLPYAHWITFLMLKAVQVRTPEMVAEYKGATTEFPAYNMAQRIRHSTP*
Ga0182124_106598813300015282Miscanthus PhyllosphereMEDTLAKGFRGHRQLPYAHWITFLILRAVIVRPPEMLAEYSGATAEFPAYNLT*
Ga0182156_105373923300015283Miscanthus PhyllosphereGRRQLPYAHWITFLILKAVQVRTPEMVAEYKGATIEFPAYNMAQRIRYSTP*
Ga0182156_106523513300015283Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWITFLVHKVVTVRPPEMLAEYSGATTEFPTYNLT*
Ga0182186_106266623300015285Miscanthus PhyllosphereMEDTLAEGFRGHRQLPYAHWITFFIRKAITVKAPETMAEYTGATIEFP
Ga0182176_102442113300015286Miscanthus PhyllosphereAKGFRGHRQLPYAHWITFLIHRTVIVRPPEMLAEYSGATTEFLAYNMT*
Ga0182176_102752213300015286Miscanthus PhyllosphereMEDTIIEGFRGHRQLPYAHWITFLIHRVVIVRPPEMLAEYSGATTE
Ga0182171_104591113300015287Miscanthus PhyllosphereMEDTIAEGFKGHRQLPYAHWITFIILKAVIVRSPEMVAEYRGATTEFPAYNMA*
Ga0182138_102574233300015289Miscanthus PhyllosphereLLSEMEDTIAEGFRGHRQLPYAHWITFLIHKAVTARPPEMLAKYSGATTEFPTYNLA*
Ga0182138_104892813300015289Miscanthus PhyllosphereMEDNIAEGFKGHRQLPYAHWITFLIHGAVTMRPPEMLVEYSGATTEFPTY
Ga0182138_105579713300015289Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWITFLIHRAVTVGPPEMLAEYSGATTEFPAYNMT*
Ga0182138_106954713300015289Miscanthus PhyllosphereEGFRGHRQLLYAHGIIFLIHRAVIVRSAEIIAEYSGATTEFPAYNLTQMIRHSTPQAPS*
Ga0182125_104095513300015291Miscanthus PhyllosphereMGDTIAEGFKGHRQLPYAHWITFLMLKAVQVRTPEMVAEYKGATTKFPAYNMA*
Ga0182141_102162513300015292Miscanthus PhyllosphereQLPYAHWITFLILKAVQVRTPEMVAEYRGATIEFPTYNMAQRIRHSTPHAST*
Ga0182141_105085013300015292Miscanthus PhyllosphereMEDTIAEGFRGHHQLPYAHRITFLIHRAVTMRPPEMLAEYSGATTEFPTYNLTQMI
Ga0182141_105769613300015292Miscanthus PhyllosphereLLLSEMEDTIAEGFRGHRQLPYAHWITFLIHRVVTVRPPEMLAEYSGATI*
Ga0182126_103652923300015294Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWVTFLIHRAVLVKSPEMIAEYSGATIEFIAYNLSQMI*
Ga0182175_106283523300015295Miscanthus PhyllosphereEDTIAEGFKGCRQLPYAHWITFLMLKAMQVRTPEMVAEYRGATTEFLAYNMAQRIRHSTP
Ga0182175_108311013300015295Miscanthus PhyllosphereMEDTIAEGFKGHRQLPYAHWITWLIHRAVTVRPPEMLAEYSGATTEFPAYNMT*
Ga0182175_109330323300015295Miscanthus PhyllosphereMFDVWDVILSEMEDTLVEGFRGHRQLPYAHWITFLIHRAVIVRPPEMLAEYSGATTEFPA
Ga0182175_109521513300015295Miscanthus PhyllosphereMEDTIAEGFRGHRQLSYAHWITFLIHRAVTVRPPEMLAEYSGATTEFPAYNMT*
Ga0182157_103351933300015296Miscanthus PhyllosphereMEDTIAEGFRGRRQLPYAHWITWLIHRAVIVRPLEMLAEYSGATTKFPAYNMT*
Ga0182157_105251813300015296Miscanthus PhyllosphereEDTIAEEIRGHRQLPYAHWITFLIHRAAAVRPPKMLAEYSGATTEFPAYNLT*
Ga0182106_104896813300015298Miscanthus PhyllosphereGFKGRRQLPYAHWITFLILKAMQVRTPEMVAEYRGATIEFLAYNMAQRIRHSTP*
Ga0182106_107400313300015298Miscanthus PhyllosphereMEDTLVEGFRGHRQLPYAHWITFLIRKAVTVKSPETMVEYTS
Ga0182107_110280513300015299Miscanthus PhyllosphereEIEDTIAEGFKGRRQLPHAHWITFIILKAVTVRSPEMVVEYRGATTEFPTYNMAQRIRHSMP*
Ga0182108_108477013300015300Miscanthus PhyllosphereMEDTLVEGFRGHRQLPYAHWITFLICKVVTHKSPETMAEYTS
Ga0182143_104968933300015302Miscanthus PhyllosphereIAEGFRGHRQLPYAHWITFLIHRAVTVRPPEMLAEYSSATTELPTYNMT*
Ga0182123_104809323300015303Miscanthus PhyllosphereDLLLSKMEDMIDEGFKGHRQLPYAHWITFLILKVVQVRTPEMVAEYRGATIEFPAYNMA*
Ga0182123_108036323300015303Miscanthus PhyllosphereEDTFTEGFKGRRQLPYAHWITFLIHRVVHDKPPGMMDEYSGATTEFLAYNLS*
Ga0182123_108988913300015303Miscanthus PhyllosphereMEDTIAEGFKGHRQLPYAHWITFLMLKAVQVRTPEMVVEYRGATIEFPAYNMA*
Ga0182112_110614713300015304Miscanthus PhyllosphereMEDIIAKGFKGHRQLPYAHWITFLIRRVVLDKPLGMMDEYIGATTEFPTYNLS*
Ga0182158_103864923300015305Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWVTFLIHRAISVKSHEMIAEYSGAMTEFPSYNLSQMIR
Ga0182158_104274323300015305Miscanthus PhyllosphereMEDTIAKGFKGHRQLPYAHWVTFLIHRAVLVKLPKIMAVYSGA
Ga0182158_109496413300015305Miscanthus PhyllosphereDLFLSEMEDTIAEGFRGHRQLPYAHWITFLIHRVVTIRSLEMIAEYSGAMIEFPAYNLSQMI*
Ga0182144_105497313300015307Miscanthus PhyllosphereMEDTIAKGFRGHMQLPYAHWVTFLIHRAVSIKLPEMIAEYSGATIEFPSYN
Ga0182144_105652013300015307Miscanthus PhyllosphereMEDTIAEGFKGRRQLPYAHWITFLIHRVVLDKPPGMMDEYTSATTE
Ga0182140_101303113300015314Miscanthus PhyllosphereLLLLEMEDTFTEGFKGRRQLPYAHWITFLIHRVVHDKPPGMMDEYSGATTEFLAYNLS*
Ga0182140_107570513300015314Miscanthus PhyllosphereVFDIWDILLSEMEDTIAEGFKGRRQLPYAHWITFLILKAVQVRTPEMVAEYRGATTE
Ga0182127_110825813300015321Miscanthus PhyllosphereMEDTIAEGFKGHRQLPYAHWITFLMLKSVQVRTLEMVAEYKGATTEFPAYNMAQRIRHSTP*
Ga0182110_101276023300015322Miscanthus PhyllosphereMEDTIAEGFKGCRQLPYAHWITWLIHRAVIVRPPKMIAEYSGATTEFPTYNMAQRIRHSMPQA
Ga0182110_105727613300015322Miscanthus PhyllosphereIWDLLLSEMEDTIAKGFKGRRQLPYAHWITFLMLKAVSVRTPDMVAEYRGATTEFPAYNMA*
Ga0182110_109947913300015322Miscanthus PhyllosphereDTIAEGFKGHQQLPYAHWITFLIHRAVIVKPPEMLAEYSGATIEFPTYNLT*
Ga0182110_110583723300015322Miscanthus PhyllosphereMEDTLVEGFRGHRQLPYAHWITFLIRKAITVKSPEMMAEY
Ga0182129_102773623300015323Miscanthus PhyllosphereMEDTIAEGFKGRRQLPYAHWITFLILKVVQVRTPEMVAEYRGATTEFPAYNMA*
Ga0182129_107300113300015323Miscanthus PhyllosphereKMEDTIVEGFRGHRQLPYAHWITFLIHRAVIVRPPEMLAEYSGATIEFPTYNLT*
Ga0182129_111081423300015323Miscanthus PhyllosphereGRRQLPYAHWITFLILKAMKVRTPEMVVEYRGATIEFLAYNMAQRIKHSTP*
Ga0182187_111057413300015341Miscanthus PhyllosphereMEDTIAEGFRGRRQLPYAHWITFLIHRAVIVRPPEMFAEYSGATTEFLAYNMTQMIRYST
Ga0182187_115999413300015341Miscanthus PhyllosphereMEDTIAEGFKGRRHLPYAHWITFLMLKAVQVRTPEMVAEYKGATTEFPAYNMA*
Ga0182109_118585313300015342Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWITWLIHRAVTVRPPEMLAEYSGATIEFPAYNMA*
Ga0182109_121773013300015342Miscanthus PhyllosphereMEDTIAEGFRGRRQLSYAHWITFLIHRAVTVRPPEMLAEYSGATTEFPAYNMTQMIRHSTP*
Ga0182155_104153113300015343Miscanthus PhyllosphereMEDTIAEGFKGHRQLPYAHWVTFLIHRAISVKSPEMIAEYSGATTEIPAYNLTQMIRHSTSQAPS*
Ga0182155_104431113300015343Miscanthus PhyllosphereMEDTLAEGFRGHRQLSYAHWITFLIRKAVTVKSPEMMTEYTSATTEFPTYNMT*
Ga0182155_106433023300015343Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWIIFLIHRAVTVRPPEMIAEYSGATIEFPT
Ga0182155_114071713300015343Miscanthus PhyllosphereMEDTIAKGFRGHRQLPYAHWITFLIHRAVTVRLPEMLAEYSGATTEFPAYNMTQMIRH
Ga0182155_117136723300015343Miscanthus PhyllosphereMEDTLVEGFRGHRQLSYAHWITFLIRKAVTVKSPETMAEYTGATTEFPPYNMT
Ga0182155_118530113300015343Miscanthus PhyllosphereEGFRGHRQLPYAHWITFLIHRAVIVRPPEMLVEYSGATAEFPSYNLT*
Ga0182189_117813413300015344Miscanthus PhyllosphereEGFRGHRQLPYAHWITFLIRKAVTVKSPETMAEYTGATTEFPPYNMT*
Ga0182189_121439813300015344Miscanthus PhyllosphereMEDTLAEGFRGHRQLPYAHWITFLIRKAVTQKSLEMMAEYTGTTTEFPPYNMTQMLRH
Ga0182189_122914113300015344Miscanthus PhyllosphereDLLLSEMEDTIAEGFKGRRQLPYAHWITFLMLKTVQVRTPEMVVEYRGATTEFPAYNMA*
Ga0182111_121907213300015345Miscanthus PhyllosphereMEDMIAEGFKGRRQLPYAHWITFLMLKAIQVRTPEMVAEYRGATTEFPAYNMV*
Ga0182139_113514113300015346Miscanthus PhyllosphereMEDTLVEGFRGHRQLPYAHWITFLIHWAVTVRPPEMLLEYSSATIEFPAYNMT*
Ga0182139_114922313300015346Miscanthus PhyllosphereMEDTIAKGFKGRRQLPYAHWITFLMLKAVSVRTPDMVAEYKGATTEFPAYNMA*
Ga0182139_120692213300015346Miscanthus PhyllosphereMEDMIAEGFKGHRQLPYAHWITFLILKAVQVRTPEMVAEYRGATIEFPAYNMA*
Ga0182177_112993713300015347Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWITWLIHRAVTVRTPEMLAEYSGAITEFPAYNMT*
Ga0182161_117416713300015351Miscanthus PhyllosphereLSEMEDTIAEGFKGRRQLPYAHWITFLMLKAVQVRTPEMVAEYRGATTEFLAYNMA*
Ga0182159_112976423300015355Miscanthus PhyllosphereEDTIAKGFRGHRQLPYAHWITFLIHRAVIVRPPEMLAEYSGATTEFPTYNLT*
Ga0182145_105147113300015361Miscanthus PhyllosphereMEDTIAEGFKGHRQLPYAHWVTFLIHRAMLVKSPEMIAEYSGATIEFPAYNLTQMIRHSTP*
Ga0182145_115676013300015361Miscanthus PhyllosphereGFKGRRQLPYAHWITFLILKAVQVRTPEMVAEYRGATTEFPAYNMT*
Ga0182145_116008313300015361Miscanthus PhyllosphereMEDTIVEGFRGHRKLPYAHCITFLIHRAVTMRPPEMLAEYSGATTEFPAYNMTQMI*
Ga0182203_105505623300017404Miscanthus PhyllosphereMENTIAKGFRGHRQLPYAHWITFLIHRAVIVRPPEMLAEYSGATIEFSTYNLTQMIH
Ga0182203_109543023300017404Miscanthus PhyllosphereEDTIAEGFKGRRKLPYAHWITFLMLKSVQVRTPEMVAEYKAATTEFPTYNMA
Ga0182203_110466313300017404Miscanthus PhyllosphereGFRGHMQLPYAHWVTFLIHIAISIKLPEMIAEYSGATTEFPTYNLS
Ga0182203_111958013300017404Miscanthus PhyllosphereMEDTIAEGFKGRRQLPYAHWITFLILKVVQVRTPEMVVEYRGATIEFLAYNMA
Ga0182203_112727413300017404Miscanthus PhyllosphereMEDTLAEGFRGHRQLPYAHWITFLIRKAIIVKSPETMAEYTGATTEFP
Ga0182220_107383413300017407Miscanthus PhyllosphereVILLELEDTLAEGFKGHRQLPYAHWITFLIRKAVTQKSLETMVEY
Ga0182204_102628423300017409Miscanthus PhyllospherePYAHWVTFLMLKSVQVRTPEMVAEYKAATIEFPAYNMAQRIRHSTP
Ga0182204_108040713300017409Miscanthus PhyllosphereMSFLSEMEDTLAEGFKGHRQLPYAHWITFLIHRAVIVRPPEILVEYSGATIEFPTYNMT
Ga0182207_105377213300017410Miscanthus PhyllosphereFDIWDLLLSEMADTIAEGFRGHQQLPYAHWITFLIHKAVTVRPPKMLAEYSGATIEFPTYNMT
Ga0182207_117017413300017410Miscanthus PhyllosphereMEDTIAEGFRGHMQLPYAHWITFLIHIAVTVRPSEMITEYSGATIEFPAYNLT
Ga0182208_107791413300017411Miscanthus PhyllosphereMEDTLVEGFRGHMQLSYAHWITFLIHRAVTVRPPEMLAEYSGATIEFLAYNMTQMLCHSRVRTSS
Ga0182208_109861423300017411Miscanthus PhyllosphereMEDTIAKGFKGRRQLPYAHWITFLILKAVQVRTPEMVEEYRGATTEFLAYNMAQ
Ga0182208_112066313300017411Miscanthus PhyllosphereIAKGFRGHRKLSYAHWITFLIHRVVIVRPPEMLAEYSGATTEFPAYNMTQMIQHSAVRTS
Ga0182222_106667813300017413Miscanthus PhyllosphereTLVEGFRCHRQLPYAHWITFLIHRAVIERPFEMLAEYSGATTEFLAYNMTWNSATVQ
Ga0182222_107066813300017413Miscanthus PhyllosphereEMEDTLAKGFKGHRQLPYAHWITFLIRKEVTVKSLETMAEYTGATTEFPLYNMT
Ga0182222_107592913300017413Miscanthus PhyllosphereMEDTISEGFRGHRQLPYAHWITWLIHKAVTMRPLEMLAEYSGAMTEFPTYN
Ga0182222_107954923300017413Miscanthus PhyllosphereMVFDIWDLLLSEMEDTIAEGFRGRRQLPYAHWITFLIHRVVTMRPPEMLAEYSGATIEFP
Ga0182202_102338813300017415Miscanthus PhyllosphereRQLLYAHWITFLMLKSVQVRTPEMVTEYKGATIEFLAYNMAQRIRHSTP
Ga0182202_108253513300017415Miscanthus PhyllosphereMEDTIAEGFRGHMQLPYAHWVTFLIHIAISIKLPEMIAE
Ga0182219_109833623300017424Miscanthus PhyllosphereMEDTIAEGFRGHQQLPYAHWITFLIHRAVTVRPLEMLAEYSGATTKFPTYNMT
Ga0182224_110416013300017425Miscanthus PhyllosphereIWDLLLLEMEDTIAEGFRGHRQLPYAHWVTFLIHRAISVKSPEMIAEYSGAMIEFPAYNLSQMIHHSTPQALS
Ga0182224_110548213300017425Miscanthus PhyllosphereILSEMEDTLAEGFRGHRQLPYAHWIIFLIHRAVIVRPPKMLAYYSGATTEFPTYKMT
Ga0182224_112034823300017425Miscanthus PhyllosphereSEMEDTIAEGFKGRRQLPYAHWITFLILKVVQVRTPEMVAEYRGATTEFPAYNMA
Ga0182190_109257323300017427Miscanthus PhyllosphereSEMEDTIAEGFRGHRQLPYAHWITFLIHKAVIVRPPEMLAEYSGATTEFPAYNQS
Ga0182190_110037823300017427Miscanthus PhyllosphereIAEGFKGRRQLPYAHWITFLILKAVQVRTPEMVAEYRGATIEFPAYNMTQRIRHSTP
Ga0182192_103644813300017430Miscanthus PhyllosphereMEDTLAEGFRGHRQLLYAHWITFMIHRAVTVSPLEMLVEYSG
Ga0182192_108771913300017430Miscanthus PhyllosphereIWDVILSEMEDTLAEGFRGHKQLSYAHWITFLIRKAVTVKSPEAMAEYTGATTEFPSYNM
Ga0182192_113204213300017430Miscanthus PhyllosphereEMEDTLEEGFRGHRQLSYAHWITFLIHRAVTVRHPEMLVEYSGATTEFPPYNMT
Ga0182192_116397313300017430Miscanthus PhyllosphereMEETIAEGFRGHRQLPYAHWVTFLIHRTVSVKSPEMIAEYSGATIEFPT
Ga0182206_109054423300017433Miscanthus PhyllosphereMEDIIAEEFRGHRQLSYAHWITFLIHRAVIVRPPEMLAEYSGATTEFPAYNMT
Ga0182206_112132913300017433Miscanthus PhyllosphereEMEDTIAEGFKGRRQLPYAHWITFLMLKSVQVRTLEMVAEYKGATTEFLAYNMAQRIRHSTP
Ga0182206_114494313300017433Miscanthus PhyllosphereAEGFSGHRQLPYAHWVPFLIHRAMSVKSPEMIAEYSGATIEFPAYNLSEMIRHITPQTPS
Ga0182209_106451113300017436Miscanthus PhyllosphereLAEGFRGHKQLSYAHWITFLIRKAVTVKSPETMAEYTGATTEFPSYNMT
Ga0182209_113871023300017436Miscanthus PhyllosphereMEDTIAKGFKGHRQLPYAHWIIFLILKAVQVRTPEMVAEYRGATTEFLAYNM
Ga0182209_115753913300017436Miscanthus PhyllosphereMEDIIAEGFRGHRQLPYAHWITFLIHRAVTVRPPEMLAEYSGATTEFP
Ga0182191_102749913300017438Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWVTFLIHRAMSVKSPEMIAEYSGATIE
Ga0182221_102205813300017442Miscanthus PhyllosphereMEDTLVEGFIGHRQLPYAHCITFLIHRAVIVRPPEMLAE
Ga0182221_114434813300017442Miscanthus PhyllosphereMFDIWDFILSEMEDTLAEEFRGHRQLSYAHWITFLIHRAVTVRPPEMLAKYSGATIEFLAYNMT
Ga0182193_117580723300017443Miscanthus PhyllosphereMEDTIVERFMGHRQLPYAHWITFLIHREVTMRPPEMLAEYSGATTEFPSFNMT
Ga0182229_104634313300017682Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWVTFLIHRAVSVKLPEMIAEYSGATTEFPAYNLS
Ga0182218_106524313300017683Miscanthus PhyllosphereMEDTIAEGFRGHMQLPYAHWVTFLIHRAVIVRSPEMIAEYSGATIEFPTYNLTQMIHHST
Ga0182225_103469323300017684Miscanthus PhyllosphereMDDIIAEGFKGHRQLPYAHWITFLIHRAVTVRPPEMLAEYSGATTEFLAYNMTQMI
Ga0182225_108102713300017684Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWITFLIHRVVTVRSPKMIAEYSGATIEFP
Ga0182225_110296813300017684Miscanthus PhyllosphereMEDTIAEGFKGRRQLPYAHWITFLIRRVVLDKPPGMMDEYTGATTE
Ga0182225_112139013300017684Miscanthus PhyllosphereEDTLVEGFRGHMQLSYAHWITFLIHRVVIVGPLEMVAEYSGATIEFPAYNMT
Ga0182205_106924523300017686Miscanthus PhyllosphereLSEMEDTIAKGFRGHRQLPYAHWVTFLIHRAISVKSPEMIAEYSGATTEFLAYNRSQMIRHSTPQALS
Ga0182205_110309613300017686Miscanthus PhyllosphereLSEMEDTIAEGFKGHRQLPYAHWITFLMLKVVQVRTPEMVAEYRGATTEFSAYNMGQRIRHSTP
Ga0182205_113884313300017686Miscanthus PhyllosphereVILSEMEDTLAEGFNDHRQLSYAHWITFLIHRAVTVRPPEMLVEYSGATTEFPAYNMT
Ga0182205_114162313300017686Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWITFLIHRAVTVRPPEMLAEYSGATTEF
Ga0182231_106632823300017689Miscanthus PhyllosphereMEDTIAEGFRGHRQLPYAHWVTFLIHRTVSVKSPEMIAEYSDATTEFPAYNLLR
Ga0182223_108532513300017690Miscanthus PhyllosphereEDTIAEGFKGHRQLPYAHWITFLMLQSVQVRTPEMVAEYKGATTEFPAYNLA
Ga0182223_112037913300017690Miscanthus PhyllosphereMEETIAEGFRGHRQLPYAHWVTFLIHRAISVKSPEMIAEYSGATTEFLAYNRSQM
Ga0207677_1173715813300026023Miscanthus RhizosphereMEDTIAEGFRGHRQLPYAHWITWLIHRAVIVRPPEKFAEYSGATT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.