NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F048235

Metagenome Family F048235

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048235
Family Type Metagenome
Number of Sequences 148
Average Sequence Length 63 residues
Representative Sequence MASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDIDEILSGNEAYQEFVSEKNNGY
Number of Associated Samples 97
Number of Associated Scaffolds 148

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 62.84 %
% of genes near scaffold ends (potentially truncated) 34.46 %
% of genes from short scaffolds (< 2000 bps) 70.95 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.189 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(39.189 % of family members)
Environment Ontology (ENVO) Unclassified
(63.514 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(91.892 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 56.82%    β-sheet: 0.00%    Coil/Unstructured: 43.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 148 Family Scaffolds
PF08804gp32 14.19
PF16805Trans_coact 10.81
PF01791DeoC 8.78
PF13884Peptidase_S74 4.05
PF13186SPASM 2.70
PF04055Radical_SAM 2.70
PF13599Pentapeptide_4 2.70
PF137592OG-FeII_Oxy_5 2.03
PF136402OG-FeII_Oxy_3 1.35
PF00805Pentapeptide 0.68
PF06841Phage_T4_gp19 0.68
PF06714Gp5_OB 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 148 Family Scaffolds
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 0.68

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.46 %
UnclassifiedrootN/A15.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10060464All Organisms → Viruses → Predicted Viral1594Open in IMG/M
3300000117|DelMOWin2010_c10249961Not Available519Open in IMG/M
3300001748|JGI11772J19994_1044958All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95535Open in IMG/M
3300004448|Ga0065861_1086762All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95803Open in IMG/M
3300005747|Ga0076924_1015062All Organisms → Viruses → Predicted Viral3727Open in IMG/M
3300005942|Ga0070742_10124913All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95713Open in IMG/M
3300006025|Ga0075474_10003886All Organisms → Viruses6169Open in IMG/M
3300006025|Ga0075474_10120628All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95836Open in IMG/M
3300006026|Ga0075478_10062628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1210Open in IMG/M
3300006027|Ga0075462_10003358All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED955200Open in IMG/M
3300006027|Ga0075462_10101245All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95894Open in IMG/M
3300006752|Ga0098048_1025174All Organisms → Viruses → Predicted Viral1962Open in IMG/M
3300006802|Ga0070749_10032749All Organisms → Viruses → Predicted Viral3231Open in IMG/M
3300006802|Ga0070749_10190848All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300006810|Ga0070754_10011371All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae5564Open in IMG/M
3300006810|Ga0070754_10138817Not Available1171Open in IMG/M
3300006810|Ga0070754_10360985All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95641Open in IMG/M
3300006867|Ga0075476_10002460All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED958813Open in IMG/M
3300006867|Ga0075476_10052606All Organisms → Viruses → Predicted Viral1642Open in IMG/M
3300006868|Ga0075481_10189846All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95738Open in IMG/M
3300006869|Ga0075477_10235308All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95741Open in IMG/M
3300006874|Ga0075475_10260289All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95726Open in IMG/M
3300006874|Ga0075475_10281100All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95691Open in IMG/M
3300006916|Ga0070750_10044327Not Available2171Open in IMG/M
3300006916|Ga0070750_10187062All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95923Open in IMG/M
3300006916|Ga0070750_10191679All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95909Open in IMG/M
3300006916|Ga0070750_10471875All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95517Open in IMG/M
3300006919|Ga0070746_10124310All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae1272Open in IMG/M
3300006919|Ga0070746_10322788All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95705Open in IMG/M
3300006924|Ga0098051_1196777All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95527Open in IMG/M
3300007236|Ga0075463_10079351All Organisms → Viruses → Predicted Viral1059Open in IMG/M
3300007345|Ga0070752_1312910All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.596Open in IMG/M
3300007346|Ga0070753_1068213All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED951426Open in IMG/M
3300007346|Ga0070753_1081264Not Available1284Open in IMG/M
3300007538|Ga0099851_1152190Not Available861Open in IMG/M
3300008012|Ga0075480_10141337All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1314Open in IMG/M
3300009507|Ga0115572_10762877Not Available522Open in IMG/M
3300010149|Ga0098049_1006927All Organisms → Viruses → Predicted Viral3967Open in IMG/M
3300010149|Ga0098049_1015140All Organisms → Viruses → Predicted Viral2579Open in IMG/M
3300010300|Ga0129351_1215891Not Available741Open in IMG/M
3300010300|Ga0129351_1407002All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95507Open in IMG/M
3300011253|Ga0151671_1120753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.759Open in IMG/M
3300017743|Ga0181402_1087551Not Available811Open in IMG/M
3300017744|Ga0181397_1113856All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95705Open in IMG/M
3300017779|Ga0181395_1117843All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95845Open in IMG/M
3300017951|Ga0181577_10007309Not Available8371Open in IMG/M
3300017951|Ga0181577_10049495Not Available2993Open in IMG/M
3300017951|Ga0181577_10069256All Organisms → Viruses → Predicted Viral2482Open in IMG/M
3300017951|Ga0181577_10415179All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.854Open in IMG/M
3300017951|Ga0181577_10657532All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95641Open in IMG/M
3300017956|Ga0181580_10133341All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED951792Open in IMG/M
3300017956|Ga0181580_10161838All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED951595Open in IMG/M
3300017963|Ga0180437_10505901All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95890Open in IMG/M
3300017967|Ga0181590_10015245All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED956244Open in IMG/M
3300017967|Ga0181590_10210168All Organisms → Viruses → Predicted Viral1456Open in IMG/M
3300017967|Ga0181590_10720360All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95670Open in IMG/M
3300017985|Ga0181576_10533020All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95717Open in IMG/M
3300017986|Ga0181569_10100273All Organisms → Viruses → Predicted Viral2063Open in IMG/M
3300017991|Ga0180434_10882618All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95673Open in IMG/M
3300018039|Ga0181579_10370943All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95780Open in IMG/M
3300018049|Ga0181572_10341384All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95945Open in IMG/M
3300018049|Ga0181572_10496649All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95752Open in IMG/M
3300018080|Ga0180433_11389331Not Available505Open in IMG/M
3300018418|Ga0181567_10475372All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95820Open in IMG/M
3300018420|Ga0181563_10286155All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95969Open in IMG/M
3300018421|Ga0181592_10223695Not Available1395Open in IMG/M
3300018421|Ga0181592_10880972All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95584Open in IMG/M
3300018426|Ga0181566_10135436Not Available1859Open in IMG/M
3300018428|Ga0181568_11176099All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95577Open in IMG/M
3300019751|Ga0194029_1086460All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95542Open in IMG/M
3300019756|Ga0194023_1001683All Organisms → Viruses → Predicted Viral4357Open in IMG/M
3300019756|Ga0194023_1002774All Organisms → Viruses → Predicted Viral3478Open in IMG/M
3300019765|Ga0194024_1125031All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95595Open in IMG/M
3300019765|Ga0194024_1149665All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95548Open in IMG/M
3300020054|Ga0181594_10011067All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED957421Open in IMG/M
3300020055|Ga0181575_10642150All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95548Open in IMG/M
3300020165|Ga0206125_10009356All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED957176Open in IMG/M
3300020165|Ga0206125_10019377All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED954141Open in IMG/M
3300020165|Ga0206125_10324177All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95572Open in IMG/M
3300020166|Ga0206128_1047281All Organisms → Viruses → Predicted Viral2121Open in IMG/M
3300020182|Ga0206129_10348125All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95576Open in IMG/M
3300020184|Ga0181573_10026580All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED954096Open in IMG/M
3300020189|Ga0181578_10089566All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED951765Open in IMG/M
3300020347|Ga0211504_1004383All Organisms → cellular organisms → Bacteria5112Open in IMG/M
3300020352|Ga0211505_1082077All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95774Open in IMG/M
3300020392|Ga0211666_10144578All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95934Open in IMG/M
3300020439|Ga0211558_10202033All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.947Open in IMG/M
3300020595|Ga0206126_10018485All Organisms → cellular organisms → Bacteria4768Open in IMG/M
3300020595|Ga0206126_10260850All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95790Open in IMG/M
3300021335|Ga0213867_1000038Not Available61106Open in IMG/M
3300021335|Ga0213867_1020390All Organisms → Viruses → Predicted Viral2713Open in IMG/M
3300021335|Ga0213867_1145338All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.817Open in IMG/M
3300021335|Ga0213867_1283778All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95526Open in IMG/M
3300021364|Ga0213859_10257423All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95797Open in IMG/M
3300021365|Ga0206123_10438221All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95532Open in IMG/M
3300021373|Ga0213865_10046455All Organisms → Viruses → Predicted Viral2412Open in IMG/M
3300021379|Ga0213864_10149011All Organisms → Viruses → Predicted Viral1180Open in IMG/M
3300021425|Ga0213866_10275308Not Available850Open in IMG/M
3300021425|Ga0213866_10401474All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.669Open in IMG/M
3300022069|Ga0212026_1065266All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95552Open in IMG/M
3300022167|Ga0212020_1070792All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95588Open in IMG/M
3300022187|Ga0196899_1027707All Organisms → Viruses → Predicted Viral2014Open in IMG/M
3300022187|Ga0196899_1038146All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED951642Open in IMG/M
3300022200|Ga0196901_1169526Not Available717Open in IMG/M
3300023180|Ga0255768_10499573All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95616Open in IMG/M
3300024343|Ga0244777_10506946All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95740Open in IMG/M
3300024346|Ga0244775_10004767All Organisms → cellular organisms → Bacteria13939Open in IMG/M
3300024346|Ga0244775_10081371Not Available2767Open in IMG/M
3300024346|Ga0244775_10308463All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED951311Open in IMG/M
3300025070|Ga0208667_1009188All Organisms → Viruses → Predicted Viral2347Open in IMG/M
3300025083|Ga0208791_1004203All Organisms → Viruses → Predicted Viral4180Open in IMG/M
3300025084|Ga0208298_1066891All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95680Open in IMG/M
3300025085|Ga0208792_1005940All Organisms → Viruses → Predicted Viral3047Open in IMG/M
3300025098|Ga0208434_1017213All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED951858Open in IMG/M
3300025098|Ga0208434_1047411All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95950Open in IMG/M
3300025483|Ga0209557_1067636Not Available830Open in IMG/M
3300025610|Ga0208149_1020418All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED951896Open in IMG/M
3300025653|Ga0208428_1176404All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95559Open in IMG/M
3300025671|Ga0208898_1010625All Organisms → cellular organisms → Bacteria4603Open in IMG/M
3300025671|Ga0208898_1027897All Organisms → Viruses → Predicted Viral2351Open in IMG/M
3300025671|Ga0208898_1066634All Organisms → Viruses → Predicted Viral1217Open in IMG/M
3300025671|Ga0208898_1105418All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95847Open in IMG/M
3300025751|Ga0208150_1127553All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95817Open in IMG/M
3300025759|Ga0208899_1009703All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED955447Open in IMG/M
3300025759|Ga0208899_1016623Not Available3815Open in IMG/M
3300025759|Ga0208899_1028895All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED952628Open in IMG/M
3300025759|Ga0208899_1047039Not Available1875Open in IMG/M
3300025759|Ga0208899_1087176All Organisms → Viruses → Predicted Viral1199Open in IMG/M
3300025759|Ga0208899_1235351All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95555Open in IMG/M
3300025769|Ga0208767_1170476All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95767Open in IMG/M
3300025769|Ga0208767_1241448All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95572Open in IMG/M
3300025769|Ga0208767_1273992All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95511Open in IMG/M
3300025771|Ga0208427_1185400All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95669Open in IMG/M
3300025803|Ga0208425_1076608All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95803Open in IMG/M
3300025828|Ga0208547_1030755All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED952031Open in IMG/M
3300025853|Ga0208645_1010913All Organisms → cellular organisms → Bacteria5565Open in IMG/M
3300025853|Ga0208645_1044773All Organisms → Viruses → Predicted Viral2156Open in IMG/M
3300025853|Ga0208645_1196787All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95718Open in IMG/M
3300025853|Ga0208645_1222863Not Available650Open in IMG/M
3300025889|Ga0208644_1000433All Organisms → cellular organisms → Bacteria35214Open in IMG/M
3300027406|Ga0208965_1063360Not Available789Open in IMG/M
3300027416|Ga0207994_1058888All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95777Open in IMG/M
(restricted) 3300027861|Ga0233415_10539195Not Available566Open in IMG/M
3300029308|Ga0135226_1017035All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95646Open in IMG/M
3300029308|Ga0135226_1028891All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95561Open in IMG/M
3300029448|Ga0183755_1008405All Organisms → Viruses → Predicted Viral4325Open in IMG/M
3300032136|Ga0316201_11552262All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95548Open in IMG/M
3300034375|Ga0348336_041460All Organisms → Viruses → Predicted Viral2007Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous39.19%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh17.57%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.76%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.08%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater5.41%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater3.38%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.38%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.38%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.03%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment2.03%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.35%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.35%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.35%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor1.35%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.68%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.68%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.68%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.68%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.68%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.68%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.68%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001748Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m)EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005747Seawater microbial communities from Vineyard Sound, MA, USA - control T14EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017991Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaGEnvironmentalOpen in IMG/M
3300018039Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300020054Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020184Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020189Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020392Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027406Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027416Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300029308Marine harbor viral communities from the Indian Ocean - SRB2EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_1006046433300000117MarineMTTIHQPEEYNMATLKNKIRKKHFDTQFRKKKRQDKLAAFDMDYAHNHNLDEILSGNEAYQEFVFEKNNGY*
DelMOWin2010_1024996123300000117MarineMATLKNKLRKKHFDTQFRMKKKLERQAAYDLEYAQSYDINEILSGNEAYQEFLSEKNDGY*E*
JGI11772J19994_104495833300001748Saline Water And SedimentKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY*
Ga0065861_108676223300004448MarineMATLKTKLRKKHFDTQFRLKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNNEY
Ga0076924_101506243300005747MarineMRKDILHMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNNEY*
Ga0070742_1012491313300005942EstuarineMNNMSSLKNKLRKKTFDTQFRKKKKLDKLAAFDMDYAHSHNLDDILSNNEAYQEFLSEKNYDY*
Ga0075474_1000388643300006025AqueousMKGIYTMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY*
Ga0075474_1012062813300006025AqueousMEQEILKKVLDKPPKIVYTLTQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY*
Ga0075478_1006262823300006026AqueousMASLKNKLRKKHFDTQFRMKKKMEKQAAYDLEYAQSYDINEILSGNEAYQEFVSEKNNDFY*
Ga0075462_1000335853300006027AqueousMSVLMKGIYTMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY*
Ga0075462_1010124513300006027AqueousPKIVYTLTQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY*
Ga0098048_102517413300006752MarineMATLKNKIRKKHFDTQFRMKKKMEKQASYDLEYAQSYDMDEILYGNDAYQEFVNEKNSDFY*
Ga0070749_1003274923300006802AqueousMTIIHQQEEYNMATLKNKIRKKHFDTQFRKKKRQDKLAAFDMDYAHNHNLDEILSGNEAYQEFVFEKNNGY*
Ga0070749_1019084813300006802AqueousIVYTLTQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNDAYQEFVSNKNYEY*
Ga0070754_1001137113300006810AqueousMATLKNKIRKKHFDTQFRMKKKMDKLAAYDLEYAQSYDIDEILSGNEAYQEFVSEKNNGY
Ga0070754_1013881723300006810AqueousMASLKNKLRKKHFDTQFRMKKKMDKLAAYDLEYAQSYDINEILSGNEAYQEFV
Ga0070754_1036098523300006810AqueousMASLKNKLRKKHYDTQFRKKKRLDKLAAFDMDYAHSHNMDDILSGNEAYQEFLYEK
Ga0075476_10002460133300006867AqueousLMKGIYTMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY*
Ga0075476_1005260623300006867AqueousVELLKKVLDKPPKIVYTLTQCNNERIYYMATLKNKLRKKHFDTQFRMKKKMEKQAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY*
Ga0075481_1018984623300006868AqueousMKGIYTMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY*VQNPKS*
Ga0075477_1023530813300006869AqueousMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVS
Ga0075475_1026028923300006874AqueousMSVLMKGIYTMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY*VQNPKS*
Ga0075475_1028110033300006874AqueousNKLRKKHFDTKFRKKKALDNLAAFDMEYAHNHDINEILRGNEAYAEFLNEKNNGY*
Ga0070750_1004432743300006916AqueousMATLKNKIRKKHFDTKFRMKKKMDKLAAYDLEYAQSYDIDEILSGNEAYQEFVSNKNY*
Ga0070750_1018706223300006916AqueousMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNDAYQEFVSNKNYEY*R*
Ga0070750_1019167933300006916AqueousMATLKNKLRKKHFDTQFRKKKRLDKLAAFDMDYAHSHNIDEILSGNEAYQEFLYEKNNGY*I*
Ga0070750_1047187523300006916AqueousMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYE
Ga0070746_1012431033300006919AqueousMATLKNKIRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNDAYQEFVSNKNYEY
Ga0070746_1032278833300006919AqueousYTLTQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSEKNNGY*
Ga0098051_119677723300006924MarineMATLKTKLRKKHFDTKFRKKKALDNLAAFDLEYAHSHDINEILSGNDAYQEFLSEKNNGY
Ga0075463_1007935113300007236AqueousYTMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY*
Ga0070752_131291023300007345AqueousIYYMASLKNKLRKKHFDTQFRMKKKMEKQAAYDLEYAQSYDINEILSGNEAYQEFVSEKNNDFY*
Ga0070753_106821313300007346AqueousKLRKKHYDTQFRKKKRLDKLAAFDMDYAHSHNMDDILSGNEAYQEFLYEKNNGY*
Ga0070753_108126413300007346AqueousVELLKKVLDKPPKIVYTLTQCNNERIYYMATLKNKLRKKHFDTQFRMKKKMEKQAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY
Ga0099851_115219023300007538AqueousMASLKNKLRKKHFDTQFRMKKKMDKLAAYDLEYAQSYDINEILSGNEAYQEFVSQKNNGY
Ga0075480_1014133713300008012AqueousKNKLRKKHFDTQFRMKKKMEKQAAYDLEYAQSYDINEILSGNEAYQEFVSEKNNDFY*
Ga0115572_1076287713300009507Pelagic MarineMRKDILHMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNYEY*
Ga0098049_100692783300010149MarineMATLKNKIRKKHFDTQFRMKKKMEKQASYDLEYAQSYDMDEILYGNDAYQEFVNEK
Ga0098049_101514023300010149MarineMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDIDEILSGNEAYQEFVSNKNYEY
Ga0129351_121589113300010300Freshwater To Marine Saline GradientMATLKNKLRKKHFDTQFRMKKRMEKLAAFDLEEAQSYDIDEVLSGNEAYQE
Ga0129351_140700213300010300Freshwater To Marine Saline GradientVYTLTQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY*
Ga0151671_112075323300011253MarineMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNSDFY*
Ga0181402_108755113300017743SeawaterMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNSDF
Ga0181397_111385613300017744SeawaterSNMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNYEY
Ga0181395_111784333300017779SeawaterKKHFDTKFRKKKALDNLAAFDLEYAHSHDINEILSGNDAYQEFLSEKNNGY
Ga0181577_1000730943300017951Salt MarshMNMATLKNKIRKKHFDTQFRLKKNMEKMAAFDMEYAHNHDLNDILRGNEAYGEFMNEKNSDFY
Ga0181577_1004949563300017951Salt MarshMASLKNKLRKKHYDTQFRKKKRLDKLAAFDMDYAHSHNIDDILSGNEAYQEFLYEKNNGY
Ga0181577_1006925623300017951Salt MarshMATLKNKLRKKHFDTQFRKKKRLDKLAAFDMDYAHSHNVDDILAGNEAYQEFLYEKNNGY
Ga0181577_1041517923300017951Salt MarshMKGYRMSTLKNKIRNKKFDNQYRLNQKMEQQAAHDLEYAQSYDMNEILSGNEAYQEFVNEKNSGFY
Ga0181577_1065753213300017951Salt MarshLRKKHFDTQFRMKKKMDKLAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY
Ga0181580_1013334133300017956Salt MarshMATLKNKIRKKHFDTQFRKKKRQDKLAAFDMDYAHNHNLDEILSGNEAYQEFVFEKNNGY
Ga0181580_1016183823300017956Salt MarshMATLKNKLRKKHFDTKFRKKKALDNLAAFDMEYAHSHDINEILRGNEAYAEFLNEKNNGY
Ga0180437_1050590133300017963Hypersaline Lake SedimentMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY
Ga0181590_1001524563300017967Salt MarshMKGIYYMATLKNKIRKKHFDTQFRKKKRQDKLAAFDMDYAHNHNLDEILSGNEAYQEFVFEKNNGY
Ga0181590_1021016833300017967Salt MarshMATLKNKLRKKHFDTKFRKKKALDNLAAFDMEYAHNHDINEILRGNEAYAEFLNEKNNGY
Ga0181590_1072036033300017967Salt MarshMATLKNKLRKKHFDTKLRKKKALDNLAAFDMEYAHSHDINEILRGNEAYAEFLNEKNNGY
Ga0181576_1053302023300017985Salt MarshMATLKNKLRKKHFDTQFRMKKRMEKLAAFDLEEAQSYDIDEVLSGNEAYQEFLYEKNNGY
Ga0181569_1010027323300017986Salt MarshMASLKNKLRKKHFDTQFRMKKKMDKLAAYDLEYAQSYDINEILSGNEAYQEFLSEKNNGY
Ga0180434_1088261833300017991Hypersaline Lake SedimentMATLKNKLRKKHFDTQFRMKKKMEKQAAYDLEYAQSYDINEILSGNEAYQEFVSEKNNGY
Ga0181579_1037094313300018039Salt MarshMASLKNKLRKKHYDTQFRKKKRLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY
Ga0181572_1034138423300018049Salt MarshMATLKNKLRKKHFDTQFRMKKRMEKLAAFDLEEAQSYDIDEVLSGNEAYQEFLYEKNNGYXVQNFK
Ga0181572_1049664913300018049Salt MarshNPTKIVYTLTQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDIDEILSGNEAYQEFVSNKNYEY
Ga0180433_1138933123300018080Hypersaline Lake SedimentMEQYRMATLKNKIRKKHFDTQFRLKKNMEKMASYDLEYAQSYDMDEILSGNEAYQEFVNEKNSDFY
Ga0181567_1047537213300018418Salt MarshMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDIDEILSGNEAYQEFVSNKNYEY
Ga0181563_1028615523300018420Salt MarshMTVEFTAIQTSQYLKKKELDKPPKIVYTLTQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY
Ga0181592_1022369513300018421Salt MarshLRKKHFDTKFRKKKALDNLAAFDMEYAHNHDINEILRGNEAYAEFLNEKNNGY
Ga0181592_1088097213300018421Salt MarshLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY
Ga0181566_1013543633300018426Salt MarshMATLKNKLRKKHFDTQFRMKKRMEKLAAFDLEEAQSYDIDEVLSGNEAYQ
Ga0181568_1117609923300018428Salt MarshMATLKNKLRKKHFDTQFRMKKKLERQAAYDLEYAQSYDINEILSGNEAYQEFLSEKNNGY
Ga0194029_108646013300019751FreshwaterMSVLMKGIYTMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGYXVQNPKS
Ga0194023_100168353300019756FreshwaterMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDIDEILSGNEAYQEFVSEKNNGY
Ga0194023_100277443300019756FreshwaterMTTIHQPEEYNMATLKNKIRKKHFDTQFRKKKRQDKLAAFDMDYAHNHNLDEILSGNEAYQEFVFEKNNGY
Ga0194024_112503113300019765FreshwaterMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFV
Ga0194024_114966523300019765FreshwaterMASLKNKLRKKHYDTQFRKKKRLDKLAAFDMDYAHSHNMDDILSGNEAYQEFLYEKNNGY
Ga0181594_1001106773300020054Salt MarshMSVLMKGIYTMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY
Ga0181575_1064215013300020055Salt MarshNMATLKNKIRKKHFDTQFRLKKNMEKMAAFDMEYAHNHDLNDILRGNEAYGEFMNEKNSDFY
Ga0206125_1000935673300020165SeawaterMRKDILHMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNNEY
Ga0206125_1001937753300020165SeawaterMATLKNKLRKKHFDTQYRKKKALDHLAAFDMEYAHSHDIDEILRGNEAYGEFLYEKNNEY
Ga0206125_1032417733300020165SeawaterMATLKTKLRKKHFDTKFRKKKALDNLAAFDLEYAHNHDISEIMSGNEAYQEFLYEKNNGYXI
Ga0206128_104728153300020166SeawaterMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNNEY
Ga0206129_1034812513300020182SeawaterMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNYEY
Ga0181573_1002658013300020184Salt MarshMASLKNKLRKKHYDTQFRKKKRLDKLAAFDMDYAHSHNVDDILAGNEAYQEFLYEKNNGY
Ga0181578_1008956633300020189Salt MarshMKGIYTMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY
Ga0211504_100438353300020347MarineMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDINEILSGNEAYQEFVSNKNSDV
Ga0211505_108207733300020352MarineKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNNEY
Ga0211666_1014457823300020392MarineMKGIYSMATLKNKIRKKHFDTQFRLKKNMEKQATYDLEYAQSYDMDEILSGNEAYQEFVNEKNSDFY
Ga0211558_1020203323300020439MarineMEQYRMATLKNKIRNKKFDNQYRLSQKMEQQAAHDLEYVQSFDMNEILSGNEAYQEFVNEKNSDFY
Ga0206126_1001848533300020595SeawaterMATLKTKLRKKHFDTKFRKKKALDNLAAFDLEYAHNHDISEIMSGNEAYQEFLYEKNNGY
Ga0206126_1026085023300020595SeawaterMRKDILHMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNYEYXRQNTN
Ga0213867_1000038513300021335SeawaterMASLKNKLRKKHFDTQFRMKKKMDKLAAHDLEYAQSYDINEILSGNEAYQEFVSNKNYEY
Ga0213867_102039053300021335SeawaterMASLKNKIRKKHFDTQYRLKKSMEKQATYDLEYAQSYDMDEILYGNEAYQEFVNEKNSDF
Ga0213867_114533823300021335SeawaterIRNKKFDNQYRLSQKMEQQAAHDLEYVQSFDMNEILSGNEAYQEFVNEKNSDFY
Ga0213867_128377813300021335SeawaterKRLKIVYTLTQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSEKNNGY
Ga0213859_1025742323300021364SeawaterMATLKNKLRKKHFDTQFRKKKALDHLAAFDMEYAHNHDLNEILRGNEAYDEFLNEKKHGY
Ga0206123_1043822133300021365SeawaterMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDINEILSGNEAYQEFVSNKNNEY
Ga0213865_1004645523300021373SeawaterMASLKNKLRKKHFDTQYRAKKRMNKIAAYDLEYAHSHDIDEILSGNEAYQEFMSEKSNGY
Ga0213864_1014901153300021379SeawaterMATLKNKLRKKHFDTQFRMKKRMEKLAAFDLEEAQSYDIDEVLSGNEAYQEFLYEKNNAY
Ga0213866_1027530813300021425SeawaterMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSN
Ga0213866_1040147413300021425SeawaterMATLKNKIRNKKFDNQYRLSQKMEQQAAHDLEYVQSFDMNEILSGNEAYQEFVNEKNSDF
Ga0212026_106526633300022069AqueousMASLKNKLRKKHFDTQFRMKKKMDKLAAYDLEYAQSYDINEILSGNEAYQEFVSEKNNGY
Ga0212020_107079223300022167AqueousMASLKNKLRKKHFDTQFRMKKKMDKLAAYDLEYAQSYDIDEILSGNEAYQEFVSEKNNGY
Ga0196899_102770733300022187AqueousMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSEKNNGY
Ga0196899_103814643300022187AqueousMASLKNKLRKKHFDTQYRKKKRLDKLAAFDMDYAHSHNVDDILAGNEAYQEFLYEKNNGY
Ga0196901_116952623300022200AqueousMASLKNKLRKKHFDTQFRMKKKMDKLAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY
Ga0255768_1049957313300023180Salt MarshINMATLKNKLRKKHFDTQFRMKKKLERQAAYDLEYAQSYDINEILSGNEAYQEFLSEKNDGY
Ga0244777_1050694613300024343EstuarineNMSSLKNKLRKKTFDTQFRKKKKLDKLAAFDMDYAHSHNLDDILSNNEAYQEFLSEKNYD
Ga0244775_10004767183300024346EstuarineMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILYGNEAYQEFVSNKNYEY
Ga0244775_1008137133300024346EstuarineMSSLKNKLRKKTFDTQFRKKKKLDKLAAFDMDYAHSHNLDDILSNNEAYQEFLSEKNYDY
Ga0244775_1030846323300024346EstuarineMATLKTKLRKKHFDTKFRKKKALDNLAAFDLEYAHSHDINEILSGNDAYKEFLSEKNNGY
Ga0208667_100918823300025070MarineMATLKNKIRKKHFDTQFRMKKKMEKQASYDLEYAQSYDMDEILYGNDAYQEFVNEKNSDF
Ga0208791_100420353300025083MarineMRKDILHMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNYEY
Ga0208298_106689113300025084MarineMATLKTKLRKKHFDTKFRKKKALDNLAAFDLEYAHSHDINEILSGNDAYQEFLSEKNNGYXI
Ga0208792_100594013300025085MarineMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVS
Ga0208434_101721313300025098MarineMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNK
Ga0208434_104741113300025098MarineMATLKTKLRKKHFDTKFRKKKALDNLAAFDLEYAHNHDISEIMSGNEA
Ga0209557_106763613300025483MarineGYSNMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEFVSNKNYEY
Ga0208149_102041823300025610AqueousMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY
Ga0208428_117640413300025653AqueousYCLSVLMKGIYTMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY
Ga0208898_101062543300025671AqueousMATLKNKLRKKHFDTQYRKKKRLDKLAAFDMDYAHSHNVDDILAGNEAYQEFLYEKNNGY
Ga0208898_102789713300025671AqueousMATLKNKLRKKHFDTQFRMKKKMEKQAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY
Ga0208898_106663413300025671AqueousPKIVYTLTQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSEKNNGY
Ga0208898_110541823300025671AqueousMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNDAYQEFVSNKNYEYXR
Ga0208150_112755313300025751AqueousVYTLTQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY
Ga0208899_1009703113300025759AqueousMATLKNKLRKKHFDTQFRMKKKLERQAAYDLEYAQSYDINEILSGNEAYQEFLSEKNDGY
Ga0208899_101662373300025759AqueousMATLKNKIRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDIDEILSDNEAYQEFVSEKNNGY
Ga0208899_102889553300025759AqueousMATLKNKLRKKHFDTQFRKKKRLDKLAAFDMDYAHSHNIDEILSGNEAYQEFLYEKNNGY
Ga0208899_104703913300025759AqueousMATLKNKIRKKHFDTKFRMKKKMDKLAAYDLEYAQSYDIDEILSGNEA
Ga0208899_108717623300025759AqueousMIIIHRQEAYNMATLKNKIRKKHFDTQFRKKKRQDKLAAFDMDYAHNHNLDEILSGNEAYQEFVFEKNNGY
Ga0208899_123535123300025759AqueousPPKIVYTLTQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDIDEILSGNEAYQEFVSEKNNGY
Ga0208767_117047623300025769AqueousMATLKNKLRKKHFDTQFRKKKRLDKLAAFDMDYAHSHNIDEILSGNEAYQEFLYEKNNGYXI
Ga0208767_124144823300025769AqueousMATLKNKIRKKHFDTKFRMKKKMDKLAAYDLEYAQSYDIDEILSGNEAYQEFVSNKNYEY
Ga0208767_127399213300025769AqueousQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDIDEILSGNEAYQEFVSEKNNGYXK
Ga0208427_118540013300025771AqueousMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEYXR
Ga0208425_107660833300025803AqueousMEQEILKKVLDKPPKIVYTLTQCNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY
Ga0208547_103075533300025828AqueousMASLKNKLRKKHFDTQFRMKKKMEKQAAYDLEYAQSYDINEILSGNEAYQEFVSEKNNDF
Ga0208645_101091393300025853AqueousMATLKNKIRKKHFDTQFRMKKKMDKLAAYDLEYAQSYDIDEILSGNEAYQEFVSNKNYEY
Ga0208645_104477343300025853AqueousMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNDAYQEFVSNKNYEY
Ga0208645_119678713300025853AqueousNNERIYYMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSNKNYEY
Ga0208645_122286323300025853AqueousMATLKNKLRKKHFDTQFRMKKKMEKQAAYDLEYAQSYDINEILSGNEAYQEFV
Ga0208644_1000433203300025889AqueousVIHSMSVLMKGIYTMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGY
Ga0208965_106336023300027406MarineMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDIDEILSGNEAYQEFVSNKNSDF
Ga0207994_105888813300027416EstuarineMNNMSSLKNKLRKKTFDTQFRKKKKLDKLAAFDMDYAHSHNLDDILSNNEAYQEFLSEKNYDY
(restricted) Ga0233415_1053919513300027861SeawaterVIDYLCILIKCNNEKGYSNMATLKTKLRKKHFDTQFRMKKRMEKIAAYDLEYAQSYDISEILSGNEAYQEF
Ga0135226_101703533300029308Marine HarborMATLKNKIRKKHFDTQFRKKKRQDKLAAFDMDYAHSHNLDEIMSGNEAYQEFLYEKNNGY
Ga0135226_102889113300029308Marine HarborMGVLMKGIYTMATLKNKLRKKHFDTQFRKKKQLDKLAAFDMDYAHSHNLDEILSGNEAYQEFLYEKNNGYXVQNSKS
Ga0183755_100840553300029448MarineMASLKNKLRKKHFDTQYRAKKRMNKIAAYDLEYAHSHDIDEILSGNEAYQEFVSYKNNEY
Ga0316201_1155226223300032136Worm BurrowKIVYKLTQCNNERIYNMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSEKNNGY
Ga0348336_041460_801_9863300034375AqueousMASLKNKLRKKHFDTQFRMKKKMEKLAAYDLEYAQSYDINEILSGNEAYQEFVSENDFVI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.