NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F048377

Metagenome Family F048377

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048377
Family Type Metagenome
Number of Sequences 148
Average Sequence Length 41 residues
Representative Sequence VSRWRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA
Number of Associated Samples 74
Number of Associated Scaffolds 148

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 5.52 %
% of genes near scaffold ends (potentially truncated) 91.89 %
% of genes from short scaffolds (< 2000 bps) 97.30 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (81.757 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere
(85.811 % of family members)
Environment Ontology (ENVO) Unclassified
(86.486 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(86.486 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 54.41%    β-sheet: 0.00%    Coil/Unstructured: 45.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 148 Family Scaffolds
PF03131bZIP_Maf 2.03


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.76 %
UnclassifiedrootN/A18.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005334|Ga0068869_100542997All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor975Open in IMG/M
3300005338|Ga0068868_100341563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1280Open in IMG/M
3300005338|Ga0068868_101755774All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor585Open in IMG/M
3300005354|Ga0070675_100835602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor843Open in IMG/M
3300005459|Ga0068867_101964040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor552Open in IMG/M
3300005718|Ga0068866_10337334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor953Open in IMG/M
3300005719|Ga0068861_102308701All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor540Open in IMG/M
3300006237|Ga0097621_100438751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1175Open in IMG/M
3300009148|Ga0105243_12597459All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor546Open in IMG/M
3300009148|Ga0105243_13018490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor510Open in IMG/M
3300013296|Ga0157374_12152023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor585Open in IMG/M
3300013296|Ga0157374_12733825All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor521Open in IMG/M
3300013297|Ga0157378_11436563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor733Open in IMG/M
3300015267|Ga0182122_1017143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor745Open in IMG/M
3300015267|Ga0182122_1025600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor671Open in IMG/M
3300015267|Ga0182122_1035328All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor615Open in IMG/M
3300015267|Ga0182122_1049556All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor561Open in IMG/M
3300015274|Ga0182188_1030119Not Available608Open in IMG/M
3300015275|Ga0182172_1005427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1038Open in IMG/M
3300015275|Ga0182172_1018061Not Available752Open in IMG/M
3300015275|Ga0182172_1018296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor749Open in IMG/M
3300015275|Ga0182172_1060129All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor541Open in IMG/M
3300015276|Ga0182170_1017906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor758Open in IMG/M
3300015276|Ga0182170_1028035Not Available673Open in IMG/M
3300015276|Ga0182170_1032537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor646Open in IMG/M
3300015277|Ga0182128_1033312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor646Open in IMG/M
3300015279|Ga0182174_1077334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor519Open in IMG/M
3300015281|Ga0182160_1028416Not Available684Open in IMG/M
3300015281|Ga0182160_1044068All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor607Open in IMG/M
3300015282|Ga0182124_1036261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor637Open in IMG/M
3300015282|Ga0182124_1044274Not Available603Open in IMG/M
3300015283|Ga0182156_1023109All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor739Open in IMG/M
3300015283|Ga0182156_1045939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor610Open in IMG/M
3300015286|Ga0182176_1068006Not Available542Open in IMG/M
3300015287|Ga0182171_1007396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1002Open in IMG/M
3300015287|Ga0182171_1033691Not Available666Open in IMG/M
3300015289|Ga0182138_1012410All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor875Open in IMG/M
3300015289|Ga0182138_1038044All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor646Open in IMG/M
3300015291|Ga0182125_1017815All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor811Open in IMG/M
3300015291|Ga0182125_1026448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor728Open in IMG/M
3300015291|Ga0182125_1050499Not Available607Open in IMG/M
3300015291|Ga0182125_1077618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor534Open in IMG/M
3300015294|Ga0182126_1047694All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor619Open in IMG/M
3300015294|Ga0182126_1064301Not Available568Open in IMG/M
3300015295|Ga0182175_1076500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor544Open in IMG/M
3300015295|Ga0182175_1078776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor539Open in IMG/M
3300015296|Ga0182157_1030835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor718Open in IMG/M
3300015296|Ga0182157_1064426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor582Open in IMG/M
3300015298|Ga0182106_1072498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor560Open in IMG/M
3300015299|Ga0182107_1101760All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor506Open in IMG/M
3300015299|Ga0182107_1104614All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor502Open in IMG/M
3300015300|Ga0182108_1023584All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor786Open in IMG/M
3300015300|Ga0182108_1069187All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor576Open in IMG/M
3300015302|Ga0182143_1009709Not Available991Open in IMG/M
3300015302|Ga0182143_1038011Not Available680Open in IMG/M
3300015302|Ga0182143_1098469All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor512Open in IMG/M
3300015303|Ga0182123_1050800All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor611Open in IMG/M
3300015304|Ga0182112_1052242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor622Open in IMG/M
3300015304|Ga0182112_1077892All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor553Open in IMG/M
3300015305|Ga0182158_1049857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor629Open in IMG/M
3300015305|Ga0182158_1102250All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor506Open in IMG/M
3300015314|Ga0182140_1034756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor723Open in IMG/M
3300015314|Ga0182140_1094047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor537Open in IMG/M
3300015314|Ga0182140_1099293Not Available528Open in IMG/M
3300015314|Ga0182140_1110296Not Available511Open in IMG/M
3300015321|Ga0182127_1059532All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor635Open in IMG/M
3300015321|Ga0182127_1073622All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor596Open in IMG/M
3300015321|Ga0182127_1077859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor585Open in IMG/M
3300015321|Ga0182127_1087495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor564Open in IMG/M
3300015322|Ga0182110_1012369All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor996Open in IMG/M
3300015322|Ga0182110_1049336Not Available670Open in IMG/M
3300015322|Ga0182110_1075091Not Available590Open in IMG/M
3300015323|Ga0182129_1056268Not Available626Open in IMG/M
3300015323|Ga0182129_1075708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor574Open in IMG/M
3300015323|Ga0182129_1115323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor503Open in IMG/M
3300015341|Ga0182187_1075136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor713Open in IMG/M
3300015342|Ga0182109_1165816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor564Open in IMG/M
3300015343|Ga0182155_1089073Not Available704Open in IMG/M
3300015343|Ga0182155_1091015All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor699Open in IMG/M
3300015343|Ga0182155_1149302All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor586Open in IMG/M
3300015345|Ga0182111_1130638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor641Open in IMG/M
3300015345|Ga0182111_1229913All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor515Open in IMG/M
3300015346|Ga0182139_1116327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor670Open in IMG/M
3300015346|Ga0182139_1134703All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor634Open in IMG/M
3300015346|Ga0182139_1180883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor567Open in IMG/M
3300015347|Ga0182177_1138240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor630Open in IMG/M
3300015351|Ga0182161_1201279All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor564Open in IMG/M
3300015351|Ga0182161_1246366All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor519Open in IMG/M
3300015355|Ga0182159_1179368All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor673Open in IMG/M
3300015355|Ga0182159_1189604All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor658Open in IMG/M
3300015355|Ga0182159_1305219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor534Open in IMG/M
3300017404|Ga0182203_1022942All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor929Open in IMG/M
3300017404|Ga0182203_1050862All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor733Open in IMG/M
3300017404|Ga0182203_1093992All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor604Open in IMG/M
3300017407|Ga0182220_1049699Not Available627Open in IMG/M
3300017409|Ga0182204_1107407All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor520Open in IMG/M
3300017410|Ga0182207_1083123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor648Open in IMG/M
3300017410|Ga0182207_1102953All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor604Open in IMG/M
3300017410|Ga0182207_1147489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor535Open in IMG/M
3300017411|Ga0182208_1119377All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor516Open in IMG/M
3300017415|Ga0182202_1090821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor578Open in IMG/M
3300017415|Ga0182202_1101598All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor557Open in IMG/M
3300017415|Ga0182202_1121289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor526Open in IMG/M
3300017417|Ga0182230_1089272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor563Open in IMG/M
3300017420|Ga0182228_1044178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor749Open in IMG/M
3300017420|Ga0182228_1064526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor648Open in IMG/M
3300017420|Ga0182228_1086742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor581Open in IMG/M
3300017425|Ga0182224_1075137All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor648Open in IMG/M
3300017425|Ga0182224_1077890Not Available641Open in IMG/M
3300017425|Ga0182224_1159236All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor509Open in IMG/M
3300017425|Ga0182224_1166970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor500Open in IMG/M
3300017427|Ga0182190_1116728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor567Open in IMG/M
3300017427|Ga0182190_1118289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor564Open in IMG/M
3300017430|Ga0182192_1127424Not Available560Open in IMG/M
3300017433|Ga0182206_1091645All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor601Open in IMG/M
3300017433|Ga0182206_1094776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor594Open in IMG/M
3300017436|Ga0182209_1083767All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor637Open in IMG/M
3300017438|Ga0182191_1091437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor635Open in IMG/M
3300017442|Ga0182221_1166768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor506Open in IMG/M
3300017443|Ga0182193_1026113All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor975Open in IMG/M
3300017680|Ga0182233_1034661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor888Open in IMG/M
3300017680|Ga0182233_1098795All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor539Open in IMG/M
3300017681|Ga0182226_1037980All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor863Open in IMG/M
3300017681|Ga0182226_1040415All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor837Open in IMG/M
3300017681|Ga0182226_1116603Not Available510Open in IMG/M
3300017682|Ga0182229_1023157All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1127Open in IMG/M
3300017682|Ga0182229_1034800All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor867Open in IMG/M
3300017682|Ga0182229_1059162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor652Open in IMG/M
3300017683|Ga0182218_1051184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor704Open in IMG/M
3300017683|Ga0182218_1086539Not Available601Open in IMG/M
3300017685|Ga0182227_1030715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor927Open in IMG/M
3300017685|Ga0182227_1033597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor889Open in IMG/M
3300017685|Ga0182227_1043031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor793Open in IMG/M
3300017685|Ga0182227_1047661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor758Open in IMG/M
3300017685|Ga0182227_1091747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor583Open in IMG/M
3300017686|Ga0182205_1101101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor602Open in IMG/M
3300017690|Ga0182223_1066314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor599Open in IMG/M
3300017690|Ga0182223_1102084Not Available532Open in IMG/M
3300021060|Ga0182232_1086105All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor509Open in IMG/M
3300025908|Ga0207643_10415205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor852Open in IMG/M
3300025935|Ga0207709_11585921All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor544Open in IMG/M
3300025938|Ga0207704_11090242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor678Open in IMG/M
3300025940|Ga0207691_10877219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor752Open in IMG/M
3300025940|Ga0207691_11013194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor693Open in IMG/M
3300025942|Ga0207689_10135251Not Available2029Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Miscanthus PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere85.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.68%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015267Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015274Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015275Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015276Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015277Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015279Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015281Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015282Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015283Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015286Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015287Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015289Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015291Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015294Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015295Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015296Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015298Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015299Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015300Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015302Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015303Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015304Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015305Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015314Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015321Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015322Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015323Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015341Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015342Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015343Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015345Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015346Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015347Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015351Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015355Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017404Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017407Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017409Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017410Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017411Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017415Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017417Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017420Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017425Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017427Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017430Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017433Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017436Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017438Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017442Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017443Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017680Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017681Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017682Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017683Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017685Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017686Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017690Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300021060Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068869_10054299713300005334Miscanthus RhizosphereNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV*
Ga0068868_10034156313300005338Miscanthus RhizosphereEWVMHEEIPEVEETLRVERVAKRLVTEVQVYLALVLDPVV*
Ga0068868_10175577413300005338Miscanthus RhizosphereVYVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLA*
Ga0070675_10083560223300005354Miscanthus RhizosphereVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVVDPVV*
Ga0068867_10196404013300005459Miscanthus RhizosphereQHVYVSRRRNDEWVMYEEIPEIEETQKVERAAKRLVTEV*
Ga0068866_1033733433300005718Miscanthus RhizosphereEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV*
Ga0068861_10230870123300005719Switchgrass RhizosphereKRQHVYVSRWWNDQWVVHEEIPEVEETKKVERAAKRLVTEV*
Ga0097621_10043875123300006237Miscanthus RhizosphereVSRRQNDEWVMYEEIPEIEETQKVERAAKRLVTEVQVCLA*
Ga0105243_1259745933300009148Miscanthus RhizosphereQHVYVSRWRNDHWVVHEEIPEVEETAKVERAAKRLVTEVQVCLA*
Ga0105243_1301849023300009148Miscanthus RhizosphereYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV*
Ga0157374_1215202313300013296Miscanthus RhizosphereRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV*
Ga0157374_1273382513300013296Miscanthus RhizosphereVSRLRNDEWVMHEEIPKVEETLRVEWVAKRLVTEVQVCLA*
Ga0157378_1143656313300013297Miscanthus RhizosphereKGQHVYVSRWRNDQWVVHEEILKVEETQKVERAVKRLVTED*
Ga0157378_1305531013300013297Miscanthus RhizospherePQDKQQHVYVSCWRNDQWVVHEEIPEVEETMKVERAVKRLVMEVQVCFA*
Ga0182122_101714313300015267Miscanthus PhyllosphereNDEWVMYEEIPEIEETQKVERAAKRLVTEVQVCLA*
Ga0182122_102560023300015267Miscanthus PhyllosphereVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVSEVQVYLA*
Ga0182122_103532833300015267Miscanthus PhyllosphereHVYVSRWRDDHWVMHEEILEVEETLKVERAAKRLVTEVQVCLA*
Ga0182122_104955613300015267Miscanthus PhyllosphereDEWVMHEEIPEVEETLRVERAAKHLVIEVQVCLA*
Ga0182188_103011913300015274Miscanthus PhyllosphereVYVSRWRNNQWVMHEEIPEVEETMKVERAAKRLVTEVQVCFGFII*
Ga0182172_100542733300015275Miscanthus PhyllosphereYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVFLALVLDPVV*
Ga0182172_101806113300015275Miscanthus PhyllosphereRNDEWVMYEEIPEIEETQKVERAAKRLVTEVQVCLA*
Ga0182172_101829613300015275Miscanthus PhyllosphereRNDEWVMHEEIPEVKETLRVERAAKRLVTEVQVCLA*
Ga0182172_106012913300015275Miscanthus PhyllosphereQHVYVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLA*
Ga0182170_101790613300015276Miscanthus PhyllosphereYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA*
Ga0182170_102803523300015276Miscanthus PhyllosphereVSRWQNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCL
Ga0182170_103253723300015276Miscanthus PhyllosphereHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV*
Ga0182128_103331223300015277Miscanthus PhyllosphereRRRNDEWVMYEEIPEIEETQKVERAAKCLVTEVQVCLA*
Ga0182174_107733423300015279Miscanthus PhyllosphereEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLVLVLDPVV*
Ga0182160_102841633300015281Miscanthus PhyllosphereNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCLA*
Ga0182160_104406813300015281Miscanthus PhyllosphereDKRQHVYVSRWRNDQWVVHEEIPEIEETMKVERAAKRLVMEV*
Ga0182124_103626133300015282Miscanthus PhyllosphereYVSRRWNDEWVMHEEIPEVEETLKVERAAKCLVTEVQVCLA*
Ga0182124_104427413300015282Miscanthus PhyllosphereVYVSHWRNDQWVVHEEIPEVEETKKVERAAKRLVTE
Ga0182156_102310913300015283Miscanthus PhyllosphereRRNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCLA*
Ga0182156_104593923300015283Miscanthus PhyllosphereWRNDEWVMHEEILEVEETLRVERAAKRLVTEVQVCLA*
Ga0182176_106800623300015286Miscanthus PhyllosphereVPHWRNDQWVVHEEILEVEETMKVEQAVKQLVMEVQVCFA*
Ga0182171_100739633300015287Miscanthus PhyllosphereYVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLA*
Ga0182171_103369113300015287Miscanthus PhyllosphereVYVSRWWNNQWVVHEEIPEVEETKKVEWVAKRLVMEV
Ga0182138_101241023300015289Miscanthus PhyllosphereWRNDEWVMHEEILEVEETLKVERAAKRLVTEVQVCLA*
Ga0182138_103804413300015289Miscanthus PhyllosphereQHVYVSRYRNDGWVMHEEIPEVKETLRVERAAKRLVTEVQVRLA*
Ga0182125_101781513300015291Miscanthus PhyllosphereRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA*
Ga0182125_102644823300015291Miscanthus PhyllosphereHVYVSRWRNDEWVMHEEIPEVEETLRVERAAKHLVIEVQVCLA*
Ga0182125_105049913300015291Miscanthus PhyllosphereHVYVSRWRNNKWVMHEEILEVKETLKVERAAKRLVTEVQVCLA*
Ga0182125_107761833300015291Miscanthus PhyllosphereRRRNDEWVMYEEIPEIEETQKVERAAKRLVTEVQVYLA*
Ga0182126_104769413300015294Miscanthus PhyllospherePQDKRQHIYVSRWWNDQWVVHEEIPEVEETKKVEQAAKRLVTEV*
Ga0182126_106430113300015294Miscanthus PhyllosphereMHEEIPEVEETLKVEQAAKCLVTEVHVCLAWPLDPAI*
Ga0182175_107650013300015295Miscanthus PhyllosphereWRNDEWVMHEEIPEVEETLRVERAAKHLVIEVQVCLA*
Ga0182175_107877613300015295Miscanthus PhyllosphereVYVSRWWNDVWVMHEEILEVEETLKVERAAKRLVIEV*
Ga0182157_103083533300015296Miscanthus PhyllosphereVSRWRNDQWVMHEEIPEVEETMKVERAAKRLVMEVQVCLA*
Ga0182157_106442613300015296Miscanthus PhyllosphereNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVPDPVV*
Ga0182157_109173813300015296Miscanthus PhyllosphereVSRWRNDQWVVHEEIPEVEETAKVERAAKRLVTEVQVCLDLPLDST
Ga0182106_107249823300015298Miscanthus PhyllosphereSRWRNDQWVVHEEIPEVEETMKVERAAKRLVTEVQVCFA*
Ga0182107_110176023300015299Miscanthus PhyllosphereSRFRNDEWVIHEEIPEIEETIRVERAAKRLVTEVQVYLALVVDPVV*
Ga0182107_110461413300015299Miscanthus PhyllosphereNDQWVMHEEIPEVEETLKVERAAKRLVMEVQVCLA*
Ga0182108_102358413300015300Miscanthus PhyllosphereQDKRQHVYVSRWQNDQWVMHEEILEVEETMKVERAAKRLVTEVQVCLA*
Ga0182108_106918713300015300Miscanthus PhyllosphereNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA*
Ga0182143_100970933300015302Miscanthus PhyllosphereRNDEWVMHEEILEVEETLKVERAAKCLVTEVQVCLA*
Ga0182143_103801123300015302Miscanthus PhyllosphereVSRWQNDQWVVHEEIPEIEETMKVERVAKRLVMEVQVCFA*
Ga0182143_109846923300015302Miscanthus PhyllosphereRQHVYVSRWRNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCLA*
Ga0182123_105080013300015303Miscanthus PhyllosphereHVYVSRWRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVWLACPLDPVM*
Ga0182112_105224213300015304Miscanthus PhyllosphereRYRNDGWVMHKEIPEVKETLRVERAAKRLVTEVQVRLA*
Ga0182112_107789213300015304Miscanthus PhyllosphereVYVSRWRNDQWVMHEEIPEVEETMKVERAAKRLVTEVQVCFA*
Ga0182158_104985723300015305Miscanthus PhyllosphereWRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA*
Ga0182158_110225023300015305Miscanthus PhyllosphereYVLRRRNDEWVMHEEILEVEETLKVKRAAKHLVTEVQVCLA*
Ga0182140_103475613300015314Miscanthus PhyllosphereVYVSRWRNDQWVVHEEIPEIEETMKVEQAAKHLVMEVQVCFA*
Ga0182140_109404713300015314Miscanthus PhyllosphereRWWNDEWVMHEEIPEVEETLKVERAAKRLVIEVQVCLA*
Ga0182140_109929323300015314Miscanthus PhyllosphereMYVSRWWNDQWVVHEEIPEVKETKKVERAAKRLVTEV*
Ga0182140_111029613300015314Miscanthus PhyllosphereRNDQWVMHEEIPEVEETMKVERAAKCLVTEVQVCLA*
Ga0182127_105953223300015321Miscanthus PhyllospherePQDKRQHVYVSRWRNDEWVMHEEIPEVEETLRVERAAKRLVTEV*
Ga0182127_107362213300015321Miscanthus PhyllospherePQDKRQYVYVSRWRNDQWVMHEEIPEVKETLKVERAAKRLVTEV*
Ga0182127_107785923300015321Miscanthus PhyllosphereVLRWWNDQWVMHEEILEVEETMKVERAAKHLVMKVQVCLA*
Ga0182127_108749513300015321Miscanthus PhyllosphereVYVSRWRNDEWVMHEEIPEVEETLKVERAAKCLVIEVQVCLA*
Ga0182110_101236933300015322Miscanthus PhyllosphereVSRFRNDEWVMHEEIPEIEETIRVERAAKRLVTEVQVYLALVVDPVV*
Ga0182110_104933623300015322Miscanthus PhyllosphereSRWRNDQWVVHEEIPEVEETMKVERAAKCLVTEVQVCFGFII*
Ga0182110_107509113300015322Miscanthus PhyllosphereVYVSRWWNDEWVVHEEILEVEETKKVERAAKRLVTEVQVG
Ga0182129_105626813300015323Miscanthus PhyllosphereMYVSHWQNNQWVVHKEIPEVEETKKVERAVKRLVT
Ga0182129_107570833300015323Miscanthus PhyllosphereWNDEWVMHEEIPEVEETLKVERAAKHLVTEVQVCLA*
Ga0182129_111532313300015323Miscanthus PhyllosphereEEIPEVEETLRVERAAKRLVTEVQVYLVLVLDPVV*
Ga0182187_107513623300015341Miscanthus PhyllosphereVSRWRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA*
Ga0182109_116581613300015342Miscanthus PhyllosphereKRQHVYVSRWRNDQWVVHEEIPEVEETTKVERAAKRLVTEV*
Ga0182155_108907313300015343Miscanthus PhyllosphereVYVLRWWNDQWVVHEEIPEVKETKKVERAAKRLVLEVQVSFA
Ga0182155_109101523300015343Miscanthus PhyllosphereWRNNEWVMHEEILEVEETLRVERAAKHLVTEVQVCLA*
Ga0182155_114930233300015343Miscanthus PhyllosphereDKRQHVYVSRWRNDQWVMHEEILEVKETLKVERAAKRLVAEVQVCLA*
Ga0182111_113063813300015345Miscanthus PhyllosphereDRRQHVYVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLA*
Ga0182111_122991313300015345Miscanthus PhyllosphereRWRNDEWVMHKEIPEVEETLRVERAAKRLVTEVQVCLA*
Ga0182139_111632723300015346Miscanthus PhyllosphereDEWVMHEEIPEVEETLRVERAAKHLVTEVQVYLA*
Ga0182139_113470323300015346Miscanthus PhyllosphereVSRWRNDEWVMHEEIPEVEETLRVERAAKRLLTEVQVCLA*
Ga0182139_118088333300015346Miscanthus PhyllosphereVYVSRWRNDEWVMHEEILEVEETLKVERAAKRLVTEVQVCLVWPLDPVM*
Ga0182177_113824033300015347Miscanthus PhyllosphereVSRWRNDQWIVHEEIPEVEETMKVERAAKCLVMEVQVCFA*
Ga0182161_120127913300015351Miscanthus PhyllosphereVYVLRRRNAERVMHEEIHEIKETQKVERAAKHLVTEVQVCLS*
Ga0182161_124636633300015351Miscanthus PhyllosphereRWRNDQWVVHKEIPEVEETAKVERAAKRLVTEVQVCFGFII*
Ga0182159_117936823300015355Miscanthus PhyllosphereHVYVSRRRNDEWVMYEEIPEIEETQKVERAAKRLVTEVQVCLA*
Ga0182159_118960423300015355Miscanthus PhyllospherePKDKRQHVYVSRRRNDEWVMHEEIPEIEETLKVERAAKRLVTEVQVCLA*
Ga0182159_130521913300015355Miscanthus PhyllospherePQDKRQHVYVSRWQNDQWVMHEEIPEVEETMKVERVAKRLVMEVQVCLA*
Ga0182203_102294233300017404Miscanthus PhyllosphereVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV
Ga0182203_105086213300017404Miscanthus PhyllosphereAYVSRWRNDQWVMHEEIPEVEETLKVEQAAKRLVTEVQVCLA
Ga0182203_109399213300017404Miscanthus PhyllosphereHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPIV
Ga0182203_116326123300017404Miscanthus PhyllosphereYVSRWRNNQWVVHEEILEVKETAKVERAAKRLVTEVQVCLALPLDPTIQSNRQT
Ga0182220_104969933300017407Miscanthus PhyllosphereVSRWRNDQWVMHEEIPEVEETMKVERAAKRLVTEVQVCLA
Ga0182204_110740713300017409Miscanthus PhyllosphereHEEIPEIEETIRVERAAKRLVTEVQVYLALVVDPVV
Ga0182207_108312323300017410Miscanthus PhyllosphereNDEWVMHEEILEVEETLKVERAAKRLVTEVQVCLA
Ga0182207_110295313300017410Miscanthus PhyllosphereDKRQHVYVSRWQNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA
Ga0182207_114748933300017410Miscanthus PhyllosphereRYQNDEWVIHEEILEVKETLRVEWAAKRLVTEVQVRLA
Ga0182208_111937723300017411Miscanthus PhyllosphereWRNDEWVMHEETPEVEETLKVERAAKRLVTEVQLCLA
Ga0182202_109082133300017415Miscanthus PhyllosphereVSRWQNDQWVMHEEIPEVEETVKVERAAKRLVMEVQVCLA
Ga0182202_110159823300017415Miscanthus PhyllosphereRQHVYVSRWRNDQWVMHEEIPEVEETLKVEQAAKRLVTEV
Ga0182202_112128913300017415Miscanthus PhyllosphereRQHVYVSRRRNDEWVMYEEIPEIEETQKVERAAKHLVAEVQVCLA
Ga0182230_108927233300017417Miscanthus PhyllosphereNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVPDPVV
Ga0182228_104417823300017420Miscanthus PhyllosphereSRYRNDEWVMHEEILEVEETLRVERVAKHLVTEVQVCLA
Ga0182228_106452613300017420Miscanthus PhyllosphereQHVYVLRWWNDQWVMHEEIPEVEETLKVERAAKRLVMEVQVCLA
Ga0182228_108674213300017420Miscanthus PhyllosphereNDEWVMHEEILEVEETLKVERAAKHLVIEVQVCLA
Ga0182224_107513713300017425Miscanthus PhyllosphereRWWNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCLA
Ga0182224_107789023300017425Miscanthus PhyllosphereRNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCLA
Ga0182224_115923623300017425Miscanthus PhyllosphereSRWQNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCLA
Ga0182224_116697013300017425Miscanthus PhyllosphereRWWNDQWVMHEEIPEVEETMKVERAAKRLVTEVQVCFA
Ga0182190_111672813300017427Miscanthus PhyllosphereHVYVSRWWNDQWVMHEEILEVEETLKVERAAKHLVTEVQVCLA
Ga0182190_111828913300017427Miscanthus PhyllosphereRPKDKRQHVYVSRWRNDEGVTHEEIPEIEETLKVEQAAKSLVTEVQVRLA
Ga0182192_112742413300017430Miscanthus PhyllosphereHVYVSRWRNDQWVVHEEIPKVEKTMKVERAVKRLVTEV
Ga0182206_109164513300017433Miscanthus PhyllosphereWRNDQWVVHEEIPEVEETMKVERAAKRLVTEVQVCFP
Ga0182206_109477613300017433Miscanthus PhyllosphereEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLVLVLDPVV
Ga0182209_108376723300017436Miscanthus PhyllosphereMSRWQNDQWVVHEEILEVEETMKVERAAKRLVTEV
Ga0182191_109143723300017438Miscanthus PhyllosphereVSHWRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA
Ga0182221_116676823300017442Miscanthus PhyllosphereWRNDEWVMHEETPEVEETLKVERAAKRLVAEVQVCLA
Ga0182193_102611333300017443Miscanthus PhyllosphereDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVPDPVV
Ga0182233_103466113300017680Miscanthus PhyllosphereQHVYVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEV
Ga0182233_109879513300017680Miscanthus PhyllosphereQHVYVSRWRNDQWVVHEEIPEVEETMKVERAAKRLVTEVQVCFA
Ga0182226_103798013300017681Miscanthus PhyllosphereSRFRNDEWVIHEEIPEIEETIRVERAAKRLVTEVQVYLALVVDPVV
Ga0182226_104041513300017681Miscanthus PhyllosphereHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV
Ga0182226_111660323300017681Miscanthus PhyllosphereVSRRRNNEWVMYEEIPEIEETQKVERAAKRLVIEVQVCLA
Ga0182229_102315743300017682Miscanthus PhyllospherePQDKRQHVYVSRWRNDEWVMHEEILEVKETLKVERAAKRLVTEVQVCLA
Ga0182229_103480013300017682Miscanthus PhyllosphereVYVSRYRNDGWVMHEEIPEVKETLRVEWAAKHLVTEVQVHLA
Ga0182229_105916233300017682Miscanthus PhyllosphereHEEIPEIEETIRVERAAKRLVTEVQVYLVLVLDPVV
Ga0182218_105118433300017683Miscanthus PhyllosphereRWRNDQWVVHEEIPEIEETMKVERAAKRLVTEVQVCLA
Ga0182218_108653913300017683Miscanthus PhyllosphereRYRNDGWVMHEEIPEVEETLRVERAAKRLVTEVQVRLA
Ga0182227_103071533300017685Miscanthus PhyllosphereRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVFLA
Ga0182227_103359713300017685Miscanthus PhyllospherePQDRRQHVYVSRYRNDGWVMHEEIPEVEETLRVERAAKRLVTEVQVRLA
Ga0182227_104303113300017685Miscanthus PhyllosphereHVYVSRWRNNQWVVHEEILEVKETAKVERAAKRLVTEV
Ga0182227_104766113300017685Miscanthus PhyllosphereGPSQHKRQHIYVSRWRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA
Ga0182227_109174733300017685Miscanthus PhyllosphereQDKRQHVYVSRWRNDQWVVHEEIPEIEETMKVERAAKRLVTEVQVHFA
Ga0182205_110110113300017686Miscanthus PhyllosphereKRQHVYVSRWRNDEWVMHEEVPEVEETLRVERAAKRLVTEV
Ga0182223_106631413300017690Miscanthus PhyllospherePKDKRQHVYVSRWRNDEWVMHEEIPEIEETLKVERAAKRLVTEVQVCLA
Ga0182223_110208423300017690Miscanthus PhyllosphereVYVSRWRNDQWVMHEEIPEVEETMKVERAAKRLVMEVQVCFGFII
Ga0182232_108610513300021060PhyllosphereHVYVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV
Ga0207643_1041520533300025908Miscanthus RhizosphereQDRRQHVYVSRYRNDEWVMHEEIPEVEETLRVKRAAKRLVTEV
Ga0207709_1158592123300025935Miscanthus RhizosphereHVYVSRFRNDEWVMHEEIPEIEETIRVERAAKRLVTEVQVYLALVVDPVV
Ga0207704_1109024213300025938Miscanthus RhizosphereCFWNDEWVMHEEIPEIEETIRVERAAKRLVTEVQVYLALVVDPVV
Ga0207691_1087721923300025940Miscanthus RhizosphereQHVYVSRYRNDEWVMHEEILEVEETLRVERAAKRLVTEVQVYLA
Ga0207691_1101319423300025940Miscanthus RhizosphereRQHVHVSRYRNDEWVMHEEIPEVEETLRVEWAAKRLVTEVQVHLA
Ga0207689_1013525143300025942Miscanthus RhizosphereNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.