NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F048673

Metagenome / Metatranscriptome Family F048673

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048673
Family Type Metagenome / Metatranscriptome
Number of Sequences 148
Average Sequence Length 36 residues
Representative Sequence MRTFAMLLILVAIAASQPHHWLSVVMAAIAHLLGR
Number of Associated Samples 103
Number of Associated Scaffolds 148

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 95.27 %
% of genes near scaffold ends (potentially truncated) 3.38 %
% of genes from short scaffolds (< 2000 bps) 60.81 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.919 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(9.460 % of family members)
Environment Ontology (ENVO) Unclassified
(35.135 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(50.676 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 50.79%    β-sheet: 0.00%    Coil/Unstructured: 49.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 148 Family Scaffolds
PF01807zf-CHC2 11.49
PF13155Toprim_2 10.81
PF00436SSB 5.41
PF04002RadC 3.38
PF01656CbiA 2.03
PF04014MazE_antitoxin 2.03
PF02604PhdYeFM_antitox 1.35
PF02768DNA_pol3_beta_3 1.35
PF08240ADH_N 0.68
PF07690MFS_1 0.68
PF10040CRISPR_Cas6 0.68
PF13208TerB_N 0.68
PF01555N6_N4_Mtase 0.68
PF00196GerE 0.68
PF12696TraG-D_C 0.68
PF01145Band_7 0.68
PF08666SAF 0.68
PF08305NPCBM 0.68
PF00534Glycos_transf_1 0.68
PF07681DoxX 0.68
PF08818DUF1801 0.68
PF13280WYL 0.68
PF08388GIIM 0.68
PF00271Helicase_C 0.68
PF00712DNA_pol3_beta 0.68
PF12728HTH_17 0.68
PF01980TrmO 0.68
PF13784Fic_N 0.68
PF01408GFO_IDH_MocA 0.68
PF02683DsbD 0.68
PF01551Peptidase_M23 0.68
PF01022HTH_5 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 148 Family Scaffolds
COG0358DNA primase (bacterial type)Replication, recombination and repair [L] 11.49
COG2965Primosomal replication protein NReplication, recombination and repair [L] 5.41
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 5.41
COG2003DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motifReplication, recombination and repair [L] 3.38
COG0592DNA polymerase III sliding clamp (beta) subunit, PCNA homologReplication, recombination and repair [L] 2.03
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 1.35
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 1.35
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.68
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.68
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.68
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.68
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.68
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.68
COG1720tRNA (Thr-GGU) A37 N6-methylaseTranslation, ribosomal structure and biogenesis [J] 0.68
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.68
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.68

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.92 %
UnclassifiedrootN/A6.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_100512015Not Available541Open in IMG/M
3300001380|JGI1356J14229_10009589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi6648Open in IMG/M
3300005529|Ga0070741_10028026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi8101Open in IMG/M
3300005657|Ga0073903_10364579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi640Open in IMG/M
3300005659|Ga0073900_10171981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi985Open in IMG/M
3300005827|Ga0074478_1598373Not Available591Open in IMG/M
3300005831|Ga0074471_10904073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium837Open in IMG/M
3300005836|Ga0074470_10336730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi29623Open in IMG/M
3300005836|Ga0074470_10906451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi5513Open in IMG/M
3300005836|Ga0074470_10938425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi934Open in IMG/M
3300005892|Ga0075275_1000293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae7106Open in IMG/M
3300005901|Ga0075274_1030739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium767Open in IMG/M
3300005902|Ga0075273_10007684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium1752Open in IMG/M
3300005961|Ga0075157_10237685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium704Open in IMG/M
3300005982|Ga0075156_10085916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1775Open in IMG/M
3300006033|Ga0075012_10322969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1043Open in IMG/M
3300006417|Ga0069787_10006297All Organisms → cellular organisms → Bacteria112990Open in IMG/M
3300006417|Ga0069787_10010280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi27715Open in IMG/M
3300006417|Ga0069787_10021833All Organisms → cellular organisms → Bacteria37008Open in IMG/M
3300006417|Ga0069787_10069330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1825Open in IMG/M
3300006865|Ga0073934_10001553All Organisms → cellular organisms → Bacteria54206Open in IMG/M
3300006865|Ga0073934_10006757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi16448Open in IMG/M
3300006865|Ga0073934_10137657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1766Open in IMG/M
3300006917|Ga0075472_10073391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1644Open in IMG/M
3300007072|Ga0073932_1000078All Organisms → cellular organisms → Bacteria240419Open in IMG/M
3300007072|Ga0073932_1047983Not Available2292Open in IMG/M
3300007216|Ga0103961_1172114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3807Open in IMG/M
3300007351|Ga0104751_1003924All Organisms → cellular organisms → Bacteria20394Open in IMG/M
3300007351|Ga0104751_1048244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2083Open in IMG/M
3300007521|Ga0105044_10015506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi10296Open in IMG/M
3300007614|Ga0102946_1000148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi23864Open in IMG/M
3300007986|Ga0100380_10085459All Organisms → cellular organisms → Bacteria → Terrabacteria group1995Open in IMG/M
3300008002|Ga0100390_10320124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi754Open in IMG/M
3300009131|Ga0115027_11894786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi502Open in IMG/M
3300009157|Ga0105092_10102276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1573Open in IMG/M
3300009179|Ga0115028_10359055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium1006Open in IMG/M
3300009179|Ga0115028_10402687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi962Open in IMG/M
3300009179|Ga0115028_10576111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi836Open in IMG/M
3300009179|Ga0115028_11541560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi566Open in IMG/M
3300009295|Ga0103747_10152109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi614Open in IMG/M
3300009540|Ga0073899_10367612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1069Open in IMG/M
3300009685|Ga0116142_10093949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1642Open in IMG/M
3300009687|Ga0116144_10213451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1025Open in IMG/M
3300009711|Ga0116166_1000013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi157559Open in IMG/M
3300009711|Ga0116166_1000666All Organisms → cellular organisms → Bacteria32449Open in IMG/M
3300009868|Ga0130016_10001746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi44584Open in IMG/M
3300009868|Ga0130016_10002589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi36245Open in IMG/M
3300009868|Ga0130016_10136564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2007Open in IMG/M
3300009868|Ga0130016_10483832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi797Open in IMG/M
3300010293|Ga0116204_1003547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi8120Open in IMG/M
3300010293|Ga0116204_1122809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi884Open in IMG/M
3300010357|Ga0116249_10266876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1584Open in IMG/M
3300010412|Ga0136852_11183917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi726Open in IMG/M
3300011391|Ga0137331_1014172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium764Open in IMG/M
3300011413|Ga0137333_1000885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi7730Open in IMG/M
3300011419|Ga0137446_1082733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium750Open in IMG/M
3300011431|Ga0137438_1099581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi884Open in IMG/M
3300011438|Ga0137451_1252847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium555Open in IMG/M
3300012018|Ga0119867_1141482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi642Open in IMG/M
3300012174|Ga0137338_1076610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi724Open in IMG/M
3300012174|Ga0137338_1115025Not Available591Open in IMG/M
3300012179|Ga0137334_1000634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi6083Open in IMG/M
3300012228|Ga0137459_1127882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi743Open in IMG/M
3300012228|Ga0137459_1260310Not Available500Open in IMG/M
3300012231|Ga0137465_1238679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi539Open in IMG/M
3300012533|Ga0138256_10458390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1040Open in IMG/M
3300012533|Ga0138256_10746071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi760Open in IMG/M
3300012956|Ga0154020_10142294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2285Open in IMG/M
3300012956|Ga0154020_10166353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2071Open in IMG/M
(restricted) 3300013123|Ga0172368_10045847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2989Open in IMG/M
(restricted) 3300013123|Ga0172368_10442868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi576Open in IMG/M
(restricted) 3300013123|Ga0172368_10453582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium567Open in IMG/M
(restricted) 3300013126|Ga0172367_10434838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi734Open in IMG/M
(restricted) 3300013126|Ga0172367_10521313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi649Open in IMG/M
(restricted) 3300013131|Ga0172373_10064638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3007Open in IMG/M
(restricted) 3300013131|Ga0172373_10727880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi583Open in IMG/M
(restricted) 3300013136|Ga0172370_10291724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi949Open in IMG/M
3300013315|Ga0173609_10839339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1215Open in IMG/M
3300013793|Ga0119894_1001294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2880Open in IMG/M
3300014303|Ga0075358_1118302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi542Open in IMG/M
3300014309|Ga0075317_1113353Not Available605Open in IMG/M
3300014309|Ga0075317_1187386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi503Open in IMG/M
3300014863|Ga0180060_1061083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi530Open in IMG/M
3300014868|Ga0180088_1100955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi523Open in IMG/M
3300014885|Ga0180063_1022192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1739Open in IMG/M
3300015360|Ga0163144_10050859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi7367Open in IMG/M
3300018059|Ga0184615_10057194Not Available2174Open in IMG/M
3300018465|Ga0190269_11422374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi565Open in IMG/M
3300020048|Ga0207193_1064433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3651Open in IMG/M
3300020198|Ga0194120_10017818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi7551Open in IMG/M
3300020198|Ga0194120_10461495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi582Open in IMG/M
3300020213|Ga0163152_10007797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi11586Open in IMG/M
3300021604|Ga0226835_1000044All Organisms → cellular organisms → Bacteria266802Open in IMG/M
3300021604|Ga0226835_1000130All Organisms → cellular organisms → Bacteria135578Open in IMG/M
3300022554|Ga0212093_1000167All Organisms → cellular organisms → Bacteria267385Open in IMG/M
3300025017|Ga0210022_1004259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi8306Open in IMG/M
3300025115|Ga0209835_1008235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium3958Open in IMG/M
3300025124|Ga0210058_1158922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi827Open in IMG/M
3300025161|Ga0209381_1154310Not Available725Open in IMG/M
3300025310|Ga0209172_10000016All Organisms → cellular organisms → Bacteria572055Open in IMG/M
3300025310|Ga0209172_10016342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae5676Open in IMG/M
3300025525|Ga0208244_106344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2668Open in IMG/M
3300025631|Ga0209204_1000896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi30410Open in IMG/M
3300025631|Ga0209204_1000905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi30271Open in IMG/M
3300025631|Ga0209204_1006882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi6786Open in IMG/M
3300025784|Ga0209200_1303912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi524Open in IMG/M
3300025982|Ga0208139_1002386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1942Open in IMG/M
3300026010|Ga0207999_1018806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium649Open in IMG/M
3300026135|Ga0209939_1000442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi7453Open in IMG/M
3300026282|Ga0209053_1022122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1358Open in IMG/M
3300026516|Ga0209573_1001139All Organisms → cellular organisms → Bacteria43587Open in IMG/M
3300027705|Ga0209063_1073524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1234Open in IMG/M
3300027722|Ga0209819_10069082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium1222Open in IMG/M
3300027776|Ga0209277_10009715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4432Open in IMG/M
3300027776|Ga0209277_10052905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1843Open in IMG/M
3300027786|Ga0209812_10325831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi674Open in IMG/M
3300027819|Ga0209514_10001174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi47569Open in IMG/M
3300027850|Ga0209591_10377251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium997Open in IMG/M
3300027851|Ga0209066_10014575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi6907Open in IMG/M
3300027851|Ga0209066_10020033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi5577Open in IMG/M
3300027885|Ga0209450_11294704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi501Open in IMG/M
3300027890|Ga0209496_10338615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi765Open in IMG/M
3300028804|Ga0268298_10000730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi41492Open in IMG/M
3300028804|Ga0268298_10003408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi16292Open in IMG/M
3300028804|Ga0268298_10044772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2957Open in IMG/M
3300028804|Ga0268298_10094148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1801Open in IMG/M
3300028804|Ga0268298_10278260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi875Open in IMG/M
3300028804|Ga0268298_10496107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi595Open in IMG/M
3300029893|Ga0246236_1010227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2115Open in IMG/M
3300029893|Ga0246236_1013462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1642Open in IMG/M
3300029990|Ga0311336_10491247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1039Open in IMG/M
3300031521|Ga0311364_11702509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium621Open in IMG/M
3300031902|Ga0302322_102204930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi678Open in IMG/M
3300032156|Ga0315295_10692552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium1029Open in IMG/M
3300032173|Ga0315268_10000085All Organisms → cellular organisms → Bacteria104172Open in IMG/M
3300032173|Ga0315268_10175576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium2041Open in IMG/M
3300032173|Ga0315268_10584133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium1107Open in IMG/M
3300032173|Ga0315268_10650915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium1048Open in IMG/M
3300032173|Ga0315268_12347597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi547Open in IMG/M
3300033233|Ga0334722_10314208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1140Open in IMG/M
3300033418|Ga0316625_100333776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1103Open in IMG/M
3300033488|Ga0316621_10289929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium1071Open in IMG/M
3300033488|Ga0316621_10663463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi750Open in IMG/M
3300033521|Ga0316616_102914910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium645Open in IMG/M
3300033521|Ga0316616_103703025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi576Open in IMG/M
3300034128|Ga0370490_0077178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium1088Open in IMG/M
3300034157|Ga0370506_098957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium650Open in IMG/M
3300034158|Ga0370507_0188310Not Available667Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil9.46%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment6.08%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge6.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.41%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.73%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland4.05%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge4.05%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)3.38%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.38%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil3.38%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent3.38%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer2.70%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge2.70%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater2.70%
Enhanced Biological Phosphorus Removal BioreactorEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor2.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.03%
Anoxic Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water2.03%
WatershedsEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds2.03%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil2.03%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.03%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.03%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.35%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat1.35%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater1.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.35%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.35%
Fracture FluidEnvironmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracture Fluid1.35%
Deep Subsurface AquiferEnvironmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer1.35%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge1.35%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge1.35%
Wastewater TreatmentEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment1.35%
Anaerobic Bioreactor BiomassEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass1.35%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.68%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.68%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.68%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.68%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.68%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.68%
Serpentinite Rock And FluidEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid0.68%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.68%
WastewaterEngineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater0.68%
SedimentEngineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment0.68%
Wastewater SludgeEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001380Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 mEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005657Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulkEngineeredOpen in IMG/M
3300005659Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-KitEngineeredOpen in IMG/M
3300005827Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBAEnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005892Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305EnvironmentalOpen in IMG/M
3300005901Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201EnvironmentalOpen in IMG/M
3300005902Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102EnvironmentalOpen in IMG/M
3300005961Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNAEngineeredOpen in IMG/M
3300005982Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNAEngineeredOpen in IMG/M
3300006033Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15EnvironmentalOpen in IMG/M
3300006417Combined Assembly of Gp0110018, Gp0110022, Gp0110020EngineeredOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007072Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaGEnvironmentalOpen in IMG/M
3300007216Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007351Combined Assembly of Gp0115775, Gp0115815EnvironmentalOpen in IMG/M
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300007614Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MGEnvironmentalOpen in IMG/M
3300007986Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-04EnvironmentalOpen in IMG/M
3300008002Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-14EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009295Microbial communities of wastewater sludge from Singapore - Sludge5_b2_FebruaryEnvironmentalOpen in IMG/M
3300009540Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-PhEngineeredOpen in IMG/M
3300009685Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaGEngineeredOpen in IMG/M
3300009687Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaGEngineeredOpen in IMG/M
3300009711Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaGEngineeredOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300010293Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaGEnvironmentalOpen in IMG/M
3300010357AD_USSTcaEngineeredOpen in IMG/M
3300010412Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10EnvironmentalOpen in IMG/M
3300011391Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT163_2EnvironmentalOpen in IMG/M
3300011413Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300012018Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR)EngineeredOpen in IMG/M
3300012174Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012533Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MGEngineeredOpen in IMG/M
3300012956Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MGEngineeredOpen in IMG/M
3300013123 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11mEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013136 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5mEnvironmentalOpen in IMG/M
3300013315Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1BEngineeredOpen in IMG/M
3300013793Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - WX_AS_metaEngineeredOpen in IMG/M
3300014303Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1EnvironmentalOpen in IMG/M
3300014309Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D1EnvironmentalOpen in IMG/M
3300014863Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10DEnvironmentalOpen in IMG/M
3300014868Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10DEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020198Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65mEnvironmentalOpen in IMG/M
3300020213Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2EnvironmentalOpen in IMG/M
3300021604Anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaG_1EngineeredOpen in IMG/M
3300022554Dewar_combined assemblyEnvironmentalOpen in IMG/M
3300025017Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-20 (SPAdes)EnvironmentalOpen in IMG/M
3300025115Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025124Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-11 (SPAdes)EnvironmentalOpen in IMG/M
3300025161Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025525Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_5A (SPAdes)EnvironmentalOpen in IMG/M
3300025631Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025784Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025982Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 (SPAdes)EnvironmentalOpen in IMG/M
3300026010Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026135Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026282Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_7/15/2010_ DNA (SPAdes)EngineeredOpen in IMG/M
3300026516Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor_6/25/2014_ DNA (SPAdes)EngineeredOpen in IMG/M
3300027705Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit (SPAdes)EngineeredOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027776Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes)EngineeredOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027850Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027851Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300028804Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP WeurtEngineeredOpen in IMG/M
3300029893Fracture fluid microbial communities from borehole on the 26 level of Beatrix Gold Mine, Welkom, South Africa - Be326_2012_MFEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M
3300034157Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18EnvironmentalOpen in IMG/M
3300034158Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10051201523300001213WetlandMRTLAILFFLIAIAASQPHHWLLVVMAFIARTLGA*
JGI1356J14229_1000958973300001380GroundwaterMSILAMLLILVAVAASQPYHWFSLVMASIAHCLGG*
Ga0070741_10028026113300005529Surface SoilMRTLALLLILVAIAASQPHDWLSVVIASLAHCLGK*
Ga0073903_1036457923300005657Activated SludgeMIMRTFALLLILVAIAASQPHHWLSEIMAAIAHCIGR*
Ga0073900_1017198123300005659Activated SludgeMRTLAMLLILVAIAANQPYHWLSIIVAFIAQLLGG*
Ga0074478_159837323300005827Sediment (Intertidal)MRTFALLLVLVAIAASQPHHWLSVIVAAIAHILGM*
Ga0074471_1090407333300005831Sediment (Intertidal)MRTLAFLLILVAFAASQPNYWLSVVMASIAHLLGR*
Ga0074470_1033673083300005836Sediment (Intertidal)MRTFAMLLILVAIAASQPHHWLAVILAAIARCIGK*
Ga0074470_1090645123300005836Sediment (Intertidal)MRTFALLLILVAIAASQPHHWLSVSVAAIAHILGR*
Ga0074470_1093842523300005836Sediment (Intertidal)MRTFALLLVLVAIAASQPHHWLSVIMAAIAHILGM*
Ga0075275_100029393300005892Rice Paddy SoilMRTLALLLILVAIAASQPHHLLLAVMAAIARLSGM*
Ga0075274_103073923300005901Rice Paddy SoilMRTLALLLILVAIAASQPHHLLLALMAAIARLSGM*
Ga0075273_1000768453300005902Rice Paddy SoilMRTLALLLILVALASSQPRHLLLALMAAIARLSGM*
Ga0075157_1023768523300005961Wastewater EffluentMRTLAFLLILVAIAASQPNYWLSVVMASIAHLLGR*
Ga0075156_1008591623300005982Wastewater EffluentMRTFALLLILVAIAASQPHHWLSEIMAAIARCIGK*
Ga0075012_1032296913300006033WatershedsMRTFALLLILVAIAASQPHHWLSVIMVAIIRRIGK*
Ga0069787_10006297183300006417Enhanced Biological Phosphorus Removal BioreactorMRTFALLLILVAIAASQPHHWLAVCMAAIAQCLGH*
Ga0069787_10010280163300006417Enhanced Biological Phosphorus Removal BioreactorMRTFAMLLILVAIAASQPHHWLSAIMVAIARCIGR*
Ga0069787_10021833193300006417Enhanced Biological Phosphorus Removal BioreactorMRTFAMLLILVAIAASEPHHWLTVLMAAIAHCIGK*
Ga0069787_1006933023300006417Enhanced Biological Phosphorus Removal BioreactorMRTFAFLLIMVAIAASQPHHWLAVCMAAIAHCLGR*
Ga0073934_10001553573300006865Hot Spring SedimentMRTFAMLLILVAIAASQPHHWLTVLMAAIVRCIGK*
Ga0073934_10006757123300006865Hot Spring SedimentMRTLAILLILVAIAASQPHHWLAVLMAAIAHCICR*
Ga0073934_1013765743300006865Hot Spring SedimentMIMRTFALILILVAIAASEPHHWLTVIIAAIVRCIGK*
Ga0075472_1007339133300006917AqueousMKTFAWLLILVAIAASQPQHWLAVSMAAIAHILGK*
Ga0073932_1000078453300007072Hot Spring SedimentMRTFAMLLILVAIAASRRSRSVFLRGQPHHWLTVLMAAIAHCIGK*
Ga0073932_104798333300007072Hot Spring SedimentMRTLAILLILVAIAASQPHHWLSVILAAIAHLLGR*
Ga0103961_117211423300007216Freshwater LakeMKTLAMLLILVAIATSQPHRWLVVLMAAIAHCLGN*
Ga0104751_100392483300007351Deep Subsurface AquiferMRTLAMLLILVAIAASQPHRWLSVAVAFITHLLGA*
Ga0104751_104824443300007351Deep Subsurface AquiferMRTFAMLLILVAIAASQPHHWLTVLMAAIAHCIGK*
Ga0105044_1001550653300007521FreshwaterMRTLAMLLILVAIAASQPNHWLSVVMASIAHLLGR*
Ga0102946_100014883300007614SoilMRTYAFILILVAIAASQPHHWLSAVMTAITHCMGR*
Ga0100380_1008545943300007986AquiferMRTLAAFLVLIAIAASQPHHWLGIALAALAHCLGG*
Ga0100390_1032012423300008002AquiferMIMRTLAAFLVLIAIAASQPHHWLGIALAALAHCLGG*
Ga0115027_1189478613300009131WetlandMRTLAMLLILVAIAASQPHHWLAVLMVAIARCIGR*
Ga0105092_1010227633300009157Freshwater SedimentMRTLALILILVAIAASQPHHWFLTVMTSLTHCLGS*
Ga0115028_1035905513300009179WetlandMRTYALLLILIAIAASQPHHWLLVVMEFIARILGV*
Ga0115028_1040268713300009179WetlandQIMRTFAMLLILVAIAASQPHYWLSVVLAAIAHLLGR*
Ga0115028_1057611123300009179WetlandMRTYAFILILIAIAASQPHHWLLVVMAFIARILGA*
Ga0115028_1154156013300009179WetlandMIMRTFALLLVLVAIAASQPHHWLAVIVAAIAHILDK*
Ga0103747_1015210923300009295Wastewater SludgeMRTFAMLLILVAIVASQPHHWLTVLMAAIAHCIGR*
Ga0073899_1036761223300009540Activated SludgeMRTLATLLILVAIAASQPHHWLAVLMAAIASCIGR*
Ga0116142_1009394913300009685Anaerobic Digestor SludgeMRTFAMLLILVAIAASQPHHWLAVLMAAIASCIGR*
Ga0116144_1021345133300009687Anaerobic Digestor SludgeMRTFAMLLILVAIAASQPHHWLTVLMAAIARCIGR*
Ga0116166_10000131383300009711Anaerobic Digestor SludgeMRTLALILILVAIAASQPYHWLGSFLADLAHLLGA*
Ga0116166_1000666313300009711Anaerobic Digestor SludgeMSMRTYAWLLILVAIAASQPQHWLGSFLAALARLLGE*
Ga0130016_1000174653300009868WastewaterMSMRTLALLLILVAIAASQPYHWLGSFLAVLAHLLGA*
Ga0130016_10002589163300009868WastewaterMRTLALLLILVAIAASQPHHWLSAVMAALAHCLGG*
Ga0130016_1013656423300009868WastewaterMSMKTHALILILVAIAASQPQHWLGSFLATLAHLLGA*
Ga0130016_1048383223300009868WastewaterRMSMRTFAWLLILVAIAVSQPHLWLGSFLAPLAHFLGA*
Ga0116204_1003547133300010293Anoxic Lake WaterMRTLATLLILVAIAASQPHHWLAVVMAAIANCMGN*
Ga0116204_112280923300010293Anoxic Lake WaterMKTLAFLLILVAIAASQPHHWLSVVLAAIAHYLGN*
Ga0116249_1026687623300010357Anaerobic Digestor SludgeMRTFAMLLILVAIAASQPHHWLAVLMAAIAHCIGK*
Ga0136852_1118391723300010412Mangrove SedimentMRTFAILLILVAIAASQPHHWLSVVVAAITHCIGR*
Ga0137331_101417223300011391SoilMRTLALLLILVAIAASQPNHWLSVVMASIAHLLGR*
Ga0137333_100088563300011413SoilMIMRTFALLLVLVAIAASQPHHWLALIVAAIAQILGR*
Ga0137446_108273323300011419SoilMRTLAMLLILVAIAASQPNHWLSVVMASIAHFLGR*
Ga0137438_109958123300011431SoilMIMRTFALLLVLVAIAASQPHQWLSGIVAAIAHILGM*
Ga0137451_125284713300011438SoilMRTLAMLLILVAIAVSQPNHWLSVVMASIALTLGR*
Ga0119867_114148223300012018Activated SludgeMRTFAFLLILVAIAASQPHHWLSAIMVAIAHCIGR*
Ga0137338_107661023300012174SoilMIMRTFALLLVLVAIAASQPHHWLSVIMAAIAHILGS*
Ga0137338_111502513300012174SoilMIMRTFALLLILVAIAASQPHHWLALIMAAIAHILGR*
Ga0137334_100063473300012179SoilMIMRTFALLLVLVAIAASQPHHWLSAIMAAIAHILGS*
Ga0137459_112788213300012228SoilRRMIMRTFALLLVLVAIAASQPHHWLALIVAAIAQILGR*
Ga0137459_126031023300012228SoilMIMRTFALLLILVAIAASQPYHWLSLIMAAIAHILGR*
Ga0137465_123867923300012231SoilMIMKTLALLLILVAIAASQPHHWLAVIMAAIARCIGK*
Ga0138256_1045839023300012533Active SludgeMIMRTFALLLIMVAIAASQPHHWLSEIMAAIARCIGK*
Ga0138256_1074607123300012533Active SludgeMRTFAFLLILVAIAASQPHHWLAVCMAAIAHCLGS*
Ga0154020_1014229433300012956Active SludgeMIMRTFALLLILVAIAASQPHHWLSEIMAAIARCIGK*
Ga0154020_1016635323300012956Active SludgeMRTLAMLLILVAIAASQPYHWLSVVMASIARLLGR*
(restricted) Ga0172368_1004584713300013123FreshwaterMRTFALLLILVAIAASQPHYWLSVVLAAIAHLRRR*
(restricted) Ga0172368_1044286823300013123FreshwaterMRTFALLLILVAIAASQPHHWLSVILATIAHLLGR*
(restricted) Ga0172368_1045358213300013123FreshwaterMKTFAWLLVLIAIAASQPQHWLGSFLAILAHLLGA*
(restricted) Ga0172367_1043483823300013126FreshwaterMRTFALLLILVAIAASQPHHWLSVVLAAIAHLLGR*
(restricted) Ga0172367_1052131323300013126FreshwaterMRTFALLLILVTIAASQPHYWLSVVLAAIAHLLGR*
(restricted) Ga0172373_1006463853300013131FreshwaterMRTFAILLILVAIAASQPHHWLAVVMAAIAHCLGN*
(restricted) Ga0172373_1072788013300013131FreshwaterMIMRTFALLLILVAIAASQPHHWLSEIMAAIARCIGR*
(restricted) Ga0172370_1029172423300013136FreshwaterMRTFALLLILVAIAASQPHYWLSVVLAAIAHLLGR*
Ga0173609_1083933923300013315SedimentMRTFAMLLILVAIADSQPHYWLSVVLADIAHLLGR*
Ga0119894_100129413300013793WastewaterMRTLATLLILVAIAASQPHHWLAVLMAAIAHCIGK*
Ga0075358_111830213300014303Natural And Restored WetlandsMRTYAFLLILIAIAASQPHQWLLVVMAFIARILGA*
Ga0075317_111335313300014309Natural And Restored WetlandsMIMRTFATLLILVAIAASQPHHWLSVILAAIAHMVGK*
Ga0075317_118738613300014309Natural And Restored WetlandsMRTFALLLILVAIAASQPHHWLSVVLATITHLLGR*
Ga0180060_106108323300014863SoilMRTFALLLVLVAIAASQPHHWLSVIVTAIAHILGM*
Ga0180088_110095523300014868SoilMRTFALLLILVAIAASQPHHWLAVIVAAIAHILGM*
Ga0180063_102219223300014885SoilMRTFALLLILVAIAASQPHHWLSVIVAAITHCMGR*
Ga0163144_1005085983300015360Freshwater Microbial MatMRTLAMLLTLVAIAASQPNHWLSVVMASIAHLLGR*
Ga0184615_1005719433300018059Groundwater SedimentMRTFALLLILVAIAASQPHHWLAVILAAIAHILGR
Ga0190269_1142237423300018465SoilMRTFALLLILVAIAASQPHQWLILMLQSILHCISS
Ga0207193_106443323300020048Freshwater Lake SedimentMRTLAMLLILVAIAASQPHQWLSVVMASIAHLLGR
Ga0194120_10017818133300020198Freshwater LakeMRTLATLLILVAIAASQPHHWLAVVMAAIANCMGN
Ga0194120_1046149523300020198Freshwater LakeMRTFAMLLILVAIAASQPHYWLTVIMVAIARCIGR
Ga0163152_10007797123300020213Freshwater Microbial MatMRTLAMLLTLVAIAASQPNHWLSVVMASIAHLLGR
Ga0226835_1000044803300021604Anaerobic Bioreactor BiomassMRTLAWLLILVALAASQPQHWLGSFLAALAHLLGA
Ga0226835_1000130753300021604Anaerobic Bioreactor BiomassMRTFAWLLILVAIAVSQPHHWLGSFLATLAHLLGA
Ga0212093_10001671543300022554Hot Spring SedimentMRTFAMLLILVAIAASRRSRSVFLRGQPHHWLTVLMAAIAHCIGK
Ga0210022_100425983300025017AquiferMRTLAAFLVLIAIAASQPHHWLGIALAALAHCLGG
Ga0209835_100823523300025115Anoxic Lake WaterMKTLAFLLILVAIAASQPHHWLSVVLAAIAHYLGN
Ga0210058_115892223300025124AquiferMIMRTLAAFLVLIAIAASQPHHWLGIALAALAHCLGG
Ga0209381_115431023300025161Hot Spring SedimentMRTLAILLILVAIAASQPHHWLSVILAAIAHLLGR
Ga0209172_100000161863300025310Hot Spring SedimentMRTFAMLLILVAIAASQPHHWLTVLMAAIVRCIGK
Ga0209172_1001634233300025310Hot Spring SedimentMRTLAILLILVAIAASQPHHWLAVLMAAIAHCICR
Ga0208244_10634423300025525Serpentinite Rock And FluidMRTFAMLLILVAIAASQPHHWLAVLMAAIARCIGR
Ga0209204_1000896153300025631Anaerobic Digestor SludgeMRTFAWLLILVAIAASQPQHWLGNFLAVLARLLGG
Ga0209204_1000905333300025631Anaerobic Digestor SludgeMRTLALILILVAIAASQPYHWLGSFLADLAHLLGA
Ga0209204_100688263300025631Anaerobic Digestor SludgeMRTYAWLLILVAIAASQPQHWLGSFLAALARLLGE
Ga0209200_130391223300025784Anaerobic Digestor SludgeMRTFAMLLILVAIAASQPHHWLAVLMAAIASCIGR
Ga0208139_100238623300025982Rice Paddy SoilMRTLALLLILVAIAASQPHHLLLAVMAAIARLSGM
Ga0207999_101880623300026010Rice Paddy SoilMRTLALLLILVAIAASQPHHLLLALMAAIARLSGM
Ga0209939_100044283300026135SoilMRTYAFILILVAIAASQPHHWLSAVMTAITHCMGR
Ga0209053_102212223300026282Wastewater TreatmentMRTFAMLLILVAIAASQPHHWLTVLMAAIARCIGR
Ga0209573_100113963300026516Wastewater TreatmentMRTFAVLLILVAIAASQPHHWLAVCMAAIAHCLGR
Ga0209063_107352423300027705Activated SludgeMRTFAMLLILVAIAASQPNYWLSVVMASIAHLLGR
Ga0209819_1006908223300027722Freshwater SedimentMRTLALILILVAIAASQPHHWFLTVMTSLTHCLGS
Ga0209277_1000971563300027776Wastewater EffluentMRTLAFLLILVAIAASQPNYWLSVVMASIAHLLGR
Ga0209277_1005290523300027776Wastewater EffluentMIMRTFALLLILVAIAASQPHHWLSEIMAAIARCIGK
Ga0209812_1032583123300027786Wastewater EffluentMRTLAFLLILVAIAASQPNHWLSVVMASIAHLLGR
Ga0209514_10001174193300027819GroundwaterMSILAMLLILVAVAASQPYHWFSLVMASIAHCLGG
Ga0209591_1037725123300027850FreshwaterMRTLAMLLILVAIAASQPNHWLSVVMASIAHLLGR
Ga0209066_1001457553300027851WatershedsMRTFALLLILVAIAASQPHHWLSVIMVAIIRRIGK
Ga0209066_1002003363300027851WatershedsMRTFAMLLILVAIAASQPHHWLTVLMAAIAHCIGK
Ga0209450_1129470413300027885Freshwater Lake SedimentMRTFALLLILVAIAASQPHHWLSVVLAAIAHLLGR
Ga0209496_1033861523300027890WetlandMRTLAMLLILVAIAASQPHHWLTVIMVAIAHCIGK
Ga0268298_10000730383300028804Activated SludgeMRTFAMLLILVAIAASQPHHWLSAIMAAIARCIGR
Ga0268298_1000340823300028804Activated SludgeMRTFAILLILVAIAASQPHHWLTVVLAASAQCMGH
Ga0268298_1004477243300028804Activated SludgeMRTLAMLLILVAIAASQPYHWLSVVMASIARLLGR
Ga0268298_1009414823300028804Activated SludgeMRTFAMLLILVAIAASQPHHWLAVLMAAIAHCIGR
Ga0268298_1027826023300028804Activated SludgeMRTFAMLLILVAIAASQPHHWLTVIMVAIAHCIGK
Ga0268298_1049610723300028804Activated SludgeIMRTFATLLILVAIAASQPHHWLTVLMAAIAHCIGR
Ga0246236_101022733300029893Fracture FluidMRTLAMLLILVAIAASQPHHWLAVLMAAIAHCMGT
Ga0246236_101346223300029893Fracture FluidMRTFAMLLILVAIAASQPHHWLTVLMAVIARCIGR
Ga0311336_1049124723300029990FenMRTLAMLLILVAIAASQPNHWLSVVMASIAHFLGR
Ga0311364_1170250923300031521FenMRTLTFMLILVAIAASQPHHWLSVIMATLVHFLGA
Ga0302322_10220493023300031902FenMRTFALLLVLVAIAASQPQHWLSLIVAAIAHILGR
Ga0315295_1069255223300032156SedimentMRTLAMLLILVAIAASQPYHWLSVVMASIAHTLGR
Ga0315268_10000085193300032173SedimentMRTLAMLLILVAVAVSQPYHWLSVAMASIAHCLGR
Ga0315268_1017557623300032173SedimentMRTLAMLLILVAIAASQPNHWLSVVMASIAHILGR
Ga0315268_1058413323300032173SedimentMRTIALLLILVAIAASQPFYWLGSFLALLTHLLNG
Ga0315268_1065091523300032173SedimentMRTYAFILILIAIAASQPHHWLLLVMAFIARTLGV
Ga0315268_1234759723300032173SedimentMRTFAMLLILVAIAASQPHHWLSVVMAAIAHLLGR
Ga0334722_1031420813300033233SedimentMRTLAMLLFLTAIAASQPHTWLTALMAFLARMPGG
Ga0316625_10033377613300033418SoilERSPIMRTYAFILILIAIAASQPHHWLLVVITFIARTLGV
Ga0316621_1028992923300033488SoilMRTLATLLILVAIAASQPHHWLSVVMATIAHILGR
Ga0316621_1066346323300033488SoilMRTLAFLLILVAIAASQPHHWLSVVMAAIAHLLGR
Ga0316616_10291491023300033521SoilMRTYAFILILIAIAASQPHHWLLVVMAFIARILGV
Ga0316616_10370302523300033521SoilMRTFALLLILVAIAASQPHHWLAIIMAAIARCMGR
Ga0370490_0077178_482_5893300034128Untreated Peat SoilMRTFALFLVLIAIAASQPHHWLTALMAFIARTLGV
Ga0370506_098957_240_3473300034157Untreated Peat SoilMRTLAMLLILVAIAASQPNHWLSVVMASVAHLLGR
Ga0370507_0188310_468_5753300034158Untreated Peat SoilMRTYALLLILIAIAASQPHHWLLVVMEFIARILGV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.