 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F048715 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 147 |
| Average Sequence Length | 51 residues |
| Representative Sequence | LKSEGMLAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSRVHKIGYA |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.68 % |
| % of genes near scaffold ends (potentially truncated) | 68.71 % |
| % of genes from short scaffolds (< 2000 bps) | 99.32 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.959 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (74.830 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.476 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (89.796 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.77% β-sheet: 0.00% Coil/Unstructured: 69.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.96 % |
| All Organisms | root | All Organisms | 2.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 74.83% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 10.88% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 4.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.40% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.04% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028052 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028464 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028469 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070690_1010679742 | 3300005330 | Switchgrass Rhizosphere | MYYGPESLKSEGMLAVEITENDRQHTPTPKLCSSRAKRVETDSEDQAKPRVHKIGYA* |
| Ga0070706_1016028611 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MYYGPESMKSEGMLAVEITENDANTPPTPRLCSSRAKRVETDPEDQAKSRVHEIGYA* |
| Ga0068859_1018928872 | 3300005617 | Switchgrass Rhizosphere | MMHYGPESQKSEGMLAVEITENDRQHTPTPRLCLSRAKRVKIDPEDQAKSRVHKIGYA* |
| Ga0068862_1008687592 | 3300005844 | Switchgrass Rhizosphere | MKSEGMLAVKIIEIDRQHTPTPRLCSSRAKGVDKDPEDQAKSGVHELRYA* |
| Ga0105249_107363541 | 3300009553 | Switchgrass Rhizosphere | ESLKSEEILAVEITKNDRQHTPTPRLCSSREKRVETDPEDQAKSRVHEIEYA* |
| Ga0105136_1070871 | 3300009973 | Switchgrass Associated | MKSEGMLAVEITENDRQHTPTPRLCLSRAKRVKIDPEDQAKSR |
| Ga0105131_1151771 | 3300009989 | Switchgrass Associated | MKSEGMLAVKIIEIDRQHTPTPRLCSSLEKEVDKDPEDQAKSGVH |
| Ga0105120_10327121 | 3300009992 | Switchgrass Associated | MKSEGMLAIKLIEIDRQHTPTLRLCSSRAKRVDIDPEDQAKSRVHELGYA* |
| Ga0105126_10071581 | 3300009994 | Switchgrass Associated | MHYSPESLKSEGMLAVEITENDRQHTPTPRLCSSRAKTVETDPEDQAKSRVHKIG |
| Ga0105126_10169972 | 3300009994 | Switchgrass Associated | MYYGPESLKSEGMLAIEITENDRQHTPTPRLCSSRAERVETDPEDQAKSRVHEIGYA |
| Ga0105126_10456581 | 3300009994 | Switchgrass Associated | KLMYYGPESLKSEGMLVVEITENDRQHTPTPILCSSRAKRVETDSEDQAKPRVHKIGYA* |
| Ga0105139_10972541 | 3300009995 | Switchgrass Associated | GPESLKSEGMLMVEITENDRQYTPTPRICSSRAKRVETDPKDQAKSRVHRIGYA* |
| Ga0134125_125103882 | 3300010371 | Terrestrial Soil | MKSEGMLAVKIIEIDSQYTPTPRLCSSRAKGVDKDPEDQAKPRVHELGYA* |
| Ga0134127_111232772 | 3300010399 | Terrestrial Soil | MYYVSESMKSEGMLAVEFIENDHQHTPTPRLCSSRAKRVETDPEDQAKSRVHEIGYA* |
| Ga0134127_130017392 | 3300010399 | Terrestrial Soil | YSPESLKSEGMFAVEITENDRQHTPTPRLCSSRAKRVETDLEDQAKSRVHEIEYA* |
| Ga0157379_107767361 | 3300014968 | Switchgrass Rhizosphere | MYYGPESMKSEGILAVEITENDRQHTPTPRLCSSRAKRVETDSEDQAKPRVHKIGSA* |
| Ga0182102_10031831 | 3300015273 | Switchgrass Phyllosphere | MCYGPESLKSEGMLAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSRVHEIEYA* |
| Ga0182102_10473041 | 3300015273 | Switchgrass Phyllosphere | MKSEGMLALKIIEIDRQHTPTPRLCSSRAKGVDIDPEDQAKSGVHKR* |
| Ga0182100_10190811 | 3300015280 | Switchgrass Phyllosphere | MNSGEMLAVKIIEIDRQHTPTPRLCSSRAKRVGIDPADQAKS |
| Ga0182100_10262411 | 3300015280 | Switchgrass Phyllosphere | QYSPKSMKSEEMLAVKIIKIDRQRTPTPRLFSSQAKEVDKEPEDQAKSGVHECMCA* |
| Ga0182101_10376941 | 3300015284 | Switchgrass Phyllosphere | MKSKGMLAVKFIEIDSQHTPTPRLCSSRAKRVDIDLEDQGKSRIDELRY |
| Ga0182105_10293091 | 3300015290 | Switchgrass Phyllosphere | PESMKSEGMLAVEFTENDRQHTPTPRLCSSRAKRVDIDPEDQAKSRVHEIGYA* |
| Ga0182105_10907621 | 3300015290 | Switchgrass Phyllosphere | MKSEGMLAVEFTENDRQHTPTPRLCSSRAKRVETDLEDQAKFRVHNIGYA* |
| Ga0182105_10920431 | 3300015290 | Switchgrass Phyllosphere | MYYGPESLKSEGMLAVEIIENDYQHTPSPRLCSSRAKRVETDPEDQAKSRVHEKGYA* |
| Ga0182184_10654441 | 3300015301 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIDRQHTPTPRLCLSRAKRVEIDPEDQAKSRIHELKECIRIISKL |
| Ga0182180_10624781 | 3300015306 | Switchgrass Phyllosphere | MHYNPESLKSEGMLAVEITENDRQHTPATRLCSSRAKRVKTDPEDQAKSRVHKIGYA* |
| Ga0182098_10713661 | 3300015309 | Switchgrass Phyllosphere | VEITENNREHTPTPRLCSSQAKRVEIDPEDQAKFRVHKIGYS* |
| Ga0182098_10853452 | 3300015309 | Switchgrass Phyllosphere | MYYGPESLKSEGMLAVEIIENDYQHTPSPRLCSSRAKRVETDPEDQAKSRVHKIGYA* |
| Ga0182162_10196602 | 3300015310 | Switchgrass Phyllosphere | MKSEEMLAVEFTKNDRQHIPTPRLCSSQAKRVEIDLEDQAESRVHKIGHA* |
| Ga0182162_11162801 | 3300015310 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIDRQHTPTPRLCSSRAKGVDKDPEDQAKPRVHELGYA* |
| Ga0182182_10293461 | 3300015311 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIDRQHTPTPRLCSSRAKGVDRDPEDQAKSGVHKLRC |
| Ga0182182_10428841 | 3300015311 | Switchgrass Phyllosphere | MKSEGMLAVKFIEIDRQHTPTLRLCSSRAKRVDIDPEDQAKSRVHELGY |
| Ga0182182_10733061 | 3300015311 | Switchgrass Phyllosphere | LSSKSMKSEGMLAVKIIEIDRQHTPTPRLCSSRAEGVDKDPEDQAKSWVHELRYA* |
| Ga0182168_11238591 | 3300015312 | Switchgrass Phyllosphere | AVEITENDRQHTPTPRLCSSRAKTVETDPEDQAKSRVHEIGYA* |
| Ga0182164_11084871 | 3300015313 | Switchgrass Phyllosphere | GMLTVKIIEIDRQHTPTPRLCSSQAKGVDKDPEDQAKPRVHVLGYA* |
| Ga0182120_10285541 | 3300015315 | Switchgrass Phyllosphere | SEGMLAVEFTENDRQHTPTPRLCSSRAKRVETDLEDQAKFRVHKIGYA* |
| Ga0182120_10377471 | 3300015315 | Switchgrass Phyllosphere | MHYSPESLKSKGMLVLEITENDRQHTPTPRLCSSRAKRVEIDPEDQAKSRVHEI |
| Ga0182181_10113931 | 3300015318 | Switchgrass Phyllosphere | KSLKSEGMLVEEITENDRQHTPTSRLCSSRAKRVKIDPEDQAKSRVHEIEYA* |
| Ga0182181_11078141 | 3300015318 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIDRQHTPTPRLCSSRAKGVDKDPEDQAKSG |
| Ga0182130_10382651 | 3300015319 | Switchgrass Phyllosphere | MKSEGMLAVKFIEIDSQHTPTPRLCSSRAKRVDIDLEDQGKS |
| Ga0182130_10932901 | 3300015319 | Switchgrass Phyllosphere | ESMKSEGMLAVEFIKNDRQHTPTPRLCSSQTKRVDIDPEDQAKSRVHEIGYA* |
| Ga0182130_11227301 | 3300015319 | Switchgrass Phyllosphere | MKSEGMLAVKFIEIDRQHTPTPRLCLSRAKGVDIDPDDQAMSRVHEL |
| Ga0182134_10283701 | 3300015324 | Switchgrass Phyllosphere | MYYGPESMKSEGILAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSRVHKIRYA* |
| Ga0182134_10674581 | 3300015324 | Switchgrass Phyllosphere | MKSKEMLAVKFVEIDRQHTPTPGLCSFRAKRVDIDPEDQAKSMVHELGMHKGYFKA |
| Ga0182134_10809121 | 3300015324 | Switchgrass Phyllosphere | MHYGPESLKSEGMLAVEFTKNDRQHTPTPRLCSSRAKRVETDSE |
| Ga0182134_10818652 | 3300015324 | Switchgrass Phyllosphere | MHYGPESLKSEGMLAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAMSKVHKIGYA* |
| Ga0182134_10819251 | 3300015324 | Switchgrass Phyllosphere | KIIEIDRQHTPKPKLCSSRAKGVDKDPEDQAKPRIHKLGYA* |
| Ga0182148_10339781 | 3300015325 | Switchgrass Phyllosphere | QNGSKSMKSEGMLAVKFIEIDRQHTPTPRLCLSRAKGVDIDPDDQAMSRVHELGYA* |
| Ga0182148_10751072 | 3300015325 | Switchgrass Phyllosphere | IKSEGMLAVKIIEIDSQHTPTPRLCKSRAKGVDKDPEDQAKSKVHELRYA* |
| Ga0182148_11059901 | 3300015325 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIDRQHTPTPRLCSSRAKGVDKYPQDQAKSGVHELMY |
| Ga0182148_11082931 | 3300015325 | Switchgrass Phyllosphere | PENMKSEGPLAVEFTKNDRQYTPTPRLCSSRAKSVETDPEDQAKSRVHKIGYA* |
| Ga0182148_11340101 | 3300015325 | Switchgrass Phyllosphere | LMHYGPESLKSEGFLAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSKVHEIGYA* |
| Ga0182166_10160101 | 3300015326 | Switchgrass Phyllosphere | MYYGPESMKSEGMLAVEITENDRQHTPTPRLCSSRAKKVEIDPEDHAKSRVHKIGYA* |
| Ga0182166_11032681 | 3300015326 | Switchgrass Phyllosphere | MKSGEILVAKIIEIVRQHTPTPRLCSSLAKRIEIDLEDQAKFGGMN* |
| Ga0182166_11340691 | 3300015326 | Switchgrass Phyllosphere | KSEGMLAVKIIEIDHQHTPTPRLCSSRAKGVEIDPEDQAKFGVHKRRYA* |
| Ga0182166_11408601 | 3300015326 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIDRQHTPKPKLCSSRAKGVNKDPEDQAKPRIHELGYA* |
| Ga0182114_10298861 | 3300015327 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIEHQHTPTPRLCSSRAKGVDKDPEDQAKSRVHELRYA* |
| Ga0182114_10361211 | 3300015327 | Switchgrass Phyllosphere | YYGPESRKSEGMLAVEITENDRQHTPTPRLCSSRAKRVETDSEDQAKPRVHKIGYA* |
| Ga0182114_10389692 | 3300015327 | Switchgrass Phyllosphere | MKSEGMLVVKIIEIDRQHTPTPRLCSSQAKGVDKDPEDQAKSKVMNSKNA* |
| Ga0182153_11322661 | 3300015328 | Switchgrass Phyllosphere | MKSKGMLVVKIIEIDRQHTPTPRLCSSRAKGVDKDPEDQAKPRVHELGYA* |
| Ga0182135_10424981 | 3300015329 | Switchgrass Phyllosphere | IEIDRQHTPTPRLCSSRAKGVDKDPEDQAKSGVHELRYA* |
| Ga0182135_10730112 | 3300015329 | Switchgrass Phyllosphere | MESKGMLVVKIIEIDRQHTPTPRLCSFQAKRADKDPEDQAKSRVHELGYA* |
| Ga0182135_11458951 | 3300015329 | Switchgrass Phyllosphere | HYSPESLKSEEILAVEITKNDRQHTPTPRLCSSRAKRVETDPEDQAKSRVHEIGYA* |
| Ga0182135_11492981 | 3300015329 | Switchgrass Phyllosphere | MYYGPESLKSEGMLAVEIIENDYQHTPSPRLCSSRAKRVETDPDDQAKSRVHEIEYA* |
| Ga0182152_11001221 | 3300015330 | Switchgrass Phyllosphere | MKSEGMLVVKFIEIDRQHTPTPRLCSSQVKGVDKDPEDLGKLRIHELG |
| Ga0182152_11005901 | 3300015330 | Switchgrass Phyllosphere | MNFGGMLAVKIIEIDRQHTLTPRLCSSRAKRVNKDPEDQAKSRIHELKE |
| Ga0182131_11026581 | 3300015331 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIFRQHIPTPRLCSSRAKGVDKDPEDQAKSRVH |
| Ga0182117_10359101 | 3300015332 | Switchgrass Phyllosphere | MKSEGMLVVEFIGNDRQHTPTPRLCLSRAKRVDKDPEDQAKPRAHGIRYAQELFQSFPF |
| Ga0182117_10766391 | 3300015332 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIVCQLTPTPRLCSSQAKGVDKDPENRAKYGVHEL |
| Ga0182117_10768611 | 3300015332 | Switchgrass Phyllosphere | MKSEGMLAVEITENDRQHTPTPRLCLSRAKRVKIDPEDQAKSRVHKIGYA* |
| Ga0182147_10339281 | 3300015333 | Switchgrass Phyllosphere | EGMLVVKFIEIDRQHTPTPRLCSSRAKRVDIDPEDQAKSRVHEIGYA* |
| Ga0182132_10296901 | 3300015334 | Switchgrass Phyllosphere | LSSKSMKSEGMLVVKIIEIDRQHTPTPRLCSSRAKGVDKDPEDQAKSRVHEL* |
| Ga0182132_11655161 | 3300015334 | Switchgrass Phyllosphere | MMHYGPESQKSEGMLAVEITENDRQHTPTTRLCSSRAKRVETDPEDQAKSRVHEIEYA* |
| Ga0182116_10168783 | 3300015335 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIDRQHTPTPRLCSSRAKGVDKDPEDQAKSGIHELRYA* |
| Ga0182116_10633871 | 3300015335 | Switchgrass Phyllosphere | MYYGLDSLKSEGMLAIEITENDRQHTPTPRLCSSRAKIVETDPEDQAKSRVHKIGYA* |
| Ga0182150_10848471 | 3300015336 | Switchgrass Phyllosphere | MYYGPESMKSEGMLAVEITENDRQHTPTPRLCSSRAKRVGTGPEYQAKSRVHKIG |
| Ga0182150_10952861 | 3300015336 | Switchgrass Phyllosphere | GPKSTKSEGMLAVKLIEIDHQHSPTPRLCSSRVKRVDIDPEDQAKSKVHEFRYA* |
| Ga0182150_11440341 | 3300015336 | Switchgrass Phyllosphere | MLVVEITKNDRQHTPTPRLCSSRAKRVETDPEDQAMSRVHEIEYA* |
| Ga0182137_10324931 | 3300015338 | Switchgrass Phyllosphere | QTDLRRKLWCNGPESMKSEGMLAVEFTENDRQHTPTPTPRLCSSRAKRVDIDPEDQAKSRVHEIGYA* |
| Ga0182137_10396671 | 3300015338 | Switchgrass Phyllosphere | VEITENDRQHTPTPRLCSSRAKRVETDPEDQAMSRVHEIEYA* |
| Ga0182137_10870481 | 3300015338 | Switchgrass Phyllosphere | LESLKSEGMLAIEITENDHQHTPTPRLCSSRAKRVETDSEDQAKPRVHKIGYA* |
| Ga0182149_10518082 | 3300015339 | Switchgrass Phyllosphere | MMHYGPESQKSEGMLAVEITENDRQHTPTPRLCSSRAKIVETDPEDQAKSRVHKIGYA* |
| Ga0182133_10782581 | 3300015340 | Switchgrass Phyllosphere | MKSEGMLVVKFIEIDRQHTPTPRLCSSRAKRVDIDPKDQAKSRVHELG |
| Ga0182133_10886532 | 3300015340 | Switchgrass Phyllosphere | MKFEAMLAVKSIGNDRQHTPTPRLCSSRAKRVDKDPEDHAKPGVHKIRYAQEL |
| Ga0182115_11461081 | 3300015348 | Switchgrass Phyllosphere | MKSEGMLAVKIIKIDRQHTPTPRLCSSRAKGVDKDPEDQVKSGVYELRYA* |
| Ga0182115_11756161 | 3300015348 | Switchgrass Phyllosphere | VEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSKVHEIGYA* |
| Ga0182185_10979821 | 3300015349 | Switchgrass Phyllosphere | SLKSEGMLAVEITENDRQHSPTPRLCSSRAKRVKTYPEDQAKSMVHKIGYA* |
| Ga0182185_11182021 | 3300015349 | Switchgrass Phyllosphere | MLAVEFTENDRQHTPTPRLCSSRAKRVETDLEDQAKFRVHNIGYA* |
| Ga0182185_11261031 | 3300015349 | Switchgrass Phyllosphere | MHYSPESLKSEGMLAVEITENDRQHTPTPRLCLSRAKRVKIDPEDQAKSRVHKIGYA* |
| Ga0182185_11951731 | 3300015349 | Switchgrass Phyllosphere | NSPKTVKSEGMLTVKIIEIDRQHTPTPRLCSSQAKGVDKDPEDQAKPRVHVLGYA* |
| Ga0182185_12382641 | 3300015349 | Switchgrass Phyllosphere | SKSMKSEGMLAVKIIEIDLQHTPTPRLCSSRAKGVDKDPEDQAKSGVYELRCA* |
| Ga0182185_12787781 | 3300015349 | Switchgrass Phyllosphere | NMKSEGMLAVKITENDRQHTPTPRLCSSRAKKVEIDPEDHAKSRVH* |
| Ga0182163_12093502 | 3300015350 | Switchgrass Phyllosphere | MKSEGMLAVEFTENDCQHTPTPRLCSSRAKKVKIDPEDQAK |
| Ga0182163_12370241 | 3300015350 | Switchgrass Phyllosphere | MKSEGMLAVKFIEIDRQHTPTPRLCSSQAKRVDKDPEDQAKSRVHE |
| Ga0182169_10683431 | 3300015352 | Switchgrass Phyllosphere | KSEGMLAVKITEYDRQHTPTPRLCSFRAKRVEIDPEDQVKSRVHELGYA* |
| Ga0182169_13130422 | 3300015352 | Switchgrass Phyllosphere | MHYGPESLKSEGMLVVEITENDRQHTPTTRLCSSQAKRVETDPEDQAKSRVHEIE |
| Ga0182179_10547781 | 3300015353 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIDRQHTPTPRLCSSRAKGVDKDPEDQAKSRVHEL |
| Ga0182179_11543061 | 3300015353 | Switchgrass Phyllosphere | VKIIEIDRQHTPTPRLCSSRAKGVDKDPEDQAKSRVHELRYA* |
| Ga0182179_12824871 | 3300015353 | Switchgrass Phyllosphere | MHFGPESLKSEGILAVEITENERQHPSTPRLCSSRAKRVETDPEDQAKSRVH |
| Ga0182167_10513521 | 3300015354 | Switchgrass Phyllosphere | MLVVKFFENDCQHTPTPRLCSFLAKRVDIDPEDQAKLRVHEIGYA* |
| Ga0182167_11172641 | 3300015354 | Switchgrass Phyllosphere | YGPESMKSEGMLAVEFTENDRQHTPTPRLCSSRAKSVDIDPEDQAKSRVHEIGYA* |
| Ga0182167_11219642 | 3300015354 | Switchgrass Phyllosphere | MKSEGMLAVEITENDHEHTPTPRLCSSQPKRVEIDPEDQAKFRVHKIGYS* |
| Ga0182167_12093191 | 3300015354 | Switchgrass Phyllosphere | VEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSRVHEIGYA* |
| Ga0182167_12696812 | 3300015354 | Switchgrass Phyllosphere | GFLAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSKVHEIGYA* |
| Ga0182167_13419461 | 3300015354 | Switchgrass Phyllosphere | MHYGPESLKSEGFLAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSKVH |
| Ga0182199_10158721 | 3300017412 | Switchgrass Phyllosphere | MLAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAMSRVHEIEYA |
| Ga0182199_10498861 | 3300017412 | Switchgrass Phyllosphere | MKSEGMLAVKIIKIDRQHTPTPRLCSSRAKEVDKDPEDQVKSGVYELR |
| Ga0182199_10611902 | 3300017412 | Switchgrass Phyllosphere | PKSMKFEGMLAVKFIEIDRQDTPTPRLCSSRSKGVDIDPEDQVKSRVHELGYA |
| Ga0182199_11818351 | 3300017412 | Switchgrass Phyllosphere | SLKSEGMLAVEITENDRQHTPTPRLCLSRAKRVKIDPEDQAKSRVHKIGYA |
| Ga0182199_12041652 | 3300017412 | Switchgrass Phyllosphere | MKSERMFAVKFIEIDLQHIPTPRLYSSRAKGVDIDPEDQAKSRVHELGYA |
| Ga0182195_11467811 | 3300017414 | Switchgrass Phyllosphere | MHYSPESLKSEGMLAVEITENNRQHTPTPRLCSSRPKRVEKDPEDQAMSRVHEIE |
| Ga0182195_11692731 | 3300017414 | Switchgrass Phyllosphere | MKSEGMLAVEFTENDRQHIPTPRLFSSRAKRVDIDPEDQAKSRVHEIGY |
| Ga0182201_10826571 | 3300017422 | Switchgrass Phyllosphere | MYYGPESLKSEGMLAVEIIENDYQHTPSPRLCSSRAKRVETDPEDQAKSRVHKIGYA |
| Ga0182201_11113411 | 3300017422 | Switchgrass Phyllosphere | MKSEGMLAVKFIEIDRQHTPTPRLCSSRAKGVDIDPEDQVKSRVHELGYA |
| Ga0182194_11471301 | 3300017435 | Switchgrass Phyllosphere | KSMKSEGMLAVKIIEIDCQHTPTPRLCSSRAKGVDKDPEDQAKSRVHEL |
| Ga0182200_10469921 | 3300017439 | Switchgrass Phyllosphere | MNSGGMFAVKIIEIDRQHTLTPRLCSSRAKRVNKDPEDQAKSRIHELKE |
| Ga0182200_10492261 | 3300017439 | Switchgrass Phyllosphere | MKSEGMLAVEITENDHEHTPTPRLCSSQAKRVEIDPEDQAKFRVHKIGYS |
| Ga0182200_10791721 | 3300017439 | Switchgrass Phyllosphere | MKSEGMFAVKIIKIDRQHTPTPRLCSSRAKGVDKDPEDQAKSGVHELR |
| Ga0182214_11413111 | 3300017440 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIDRQLTPTPRLCSSRAKGVDKDPENRAKYGVHELRY |
| Ga0182198_10228832 | 3300017445 | Switchgrass Phyllosphere | MHYSPKSLKSEGMLVEEITENDRQHTPTSRLCLSRAKRVKIDPEDQAKSRVHEIEYA |
| Ga0182198_11503511 | 3300017445 | Switchgrass Phyllosphere | KSEGMLAVEITENDRQHTPTPRLCSSRAKRVGTGPEDQAKSRVHKIGYA |
| Ga0182215_11365571 | 3300017447 | Switchgrass Phyllosphere | MHYSPESLKSEEILAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSRVHEIEYAQALFQNFP |
| Ga0182212_11458011 | 3300017691 | Switchgrass Phyllosphere | MHYSLERLKSEGMLVEEITENDRQHTPTSRLCSSRAKRVKIDPEDQAKSRVHEI |
| Ga0182210_10201402 | 3300017692 | Switchgrass Phyllosphere | YSPESLKSEGMLAAEITENDRQHTPTPRLCSSRAKRVETDPEDQAMSRVHEIEYA |
| Ga0182211_11407961 | 3300017694 | Switchgrass Phyllosphere | MKSEGMLAVKIIEIDRQHTPTPRLCSSRAKGVNKDPEDQAKSRIHE |
| Ga0207712_114202591 | 3300025961 | Switchgrass Rhizosphere | MHYSPESLKSEGMLAVEITENDRQHTPTPRLCSSRAKRVEIDPEDQAKSRVHE |
| Ga0207668_112427611 | 3300025972 | Switchgrass Rhizosphere | MKFEGMLAVKFIEIDRQDTPTPRLCSSRAKGVDIDPEDQVKSRVHELGYA |
| Ga0207641_124124171 | 3300026088 | Switchgrass Rhizosphere | MKSEGMLAVKIIEIDRQHTPTPRLCSSRAKGVEKDPEDQAKSGVHELS |
| Ga0207675_1005197701 | 3300026118 | Switchgrass Rhizosphere | KSEGMFAVEITENDRQHTPTPRLCSSRAKRVEIDPEDQAKSRVHEIEYA |
| Ga0268322_10324032 | 3300028049 | Phyllosphere | MKSEGMLAVKFTENDCQHTPTPRLCSTRAKRVEIDPEDQAKSRVHNIG |
| Ga0268322_10339191 | 3300028049 | Phyllosphere | MYYGPESLKSEGMLAVEITENDRQHTPTPRLCSSRAKRVETDSEDQAKPRVHKI |
| Ga0268328_10545971 | 3300028050 | Phyllosphere | MLAVKIIKIDRQHTPTPRLCSSRAKEVDKDPEDQVKSGVYELRYA |
| Ga0268300_10072861 | 3300028052 | Phyllosphere | MMHYGPESQKSEGMLAVEITENDRQHTPTPRLCSSRAKIVETDPEDQAKSRVHKIGYA |
| Ga0268330_10126592 | 3300028056 | Phyllosphere | MHYGPESLKSEGMLAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSRVHEIDYA |
| Ga0268355_10016611 | 3300028139 | Phyllosphere | HYGPESLKSEGLLAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSRDHKIGYA |
| Ga0268343_10043311 | 3300028150 | Phyllosphere | LKSEGMLAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSRVHKIGYA |
| Ga0268336_10249051 | 3300028152 | Phyllosphere | LMYYGLESLKSEGMLAIEITENDHQHTPTPRLCSSRAKRVETDPEDQAKPRVHKIGYA |
| Ga0268320_10029911 | 3300028153 | Phyllosphere | MLAIEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSRVHEIGY |
| Ga0268264_123771211 | 3300028381 | Switchgrass Rhizosphere | LKSEGFLAVEITENDRQHTPTPRLCSSRAKRVETDPEDQAKSRVHEIEYA |
| Ga0268302_1030322 | 3300028464 | Phyllosphere | MKSEGMLAVKIIEIDRQHTPTPRLCSSRAKGVDKDPEDQAKSRVHELGYA |
| Ga0268333_10094631 | 3300028467 | Phyllosphere | MKSEGMLAVKIIEIDSQYTPTPRLCSSRAKGVDKDPEDQAKPRVHELGYA |
| Ga0268337_10194601 | 3300028469 | Phyllosphere | MKSEGMLVVKIIEIDRQHTPTPRLCSSRAKGVDKDPEDQAKSGVHERRYA |
| Ga0268307_10086161 | 3300028470 | Phyllosphere | MKFEGMLAVKIIEIDRQHTPTPRLCSSRAKGVDKDPQDQAKSGVHELMYA |
| Ga0268331_10087871 | 3300028474 | Phyllosphere | LMYYGPESMKSEGMLAVEITENDRQHTPTSRLCSSRAKRVGTGPEDQAKSRVHKIGYA |
| Ga0268311_10032851 | 3300028529 | Phyllosphere | LKSKGMLAVEITENNRQNTPTPRLCSSRAKRVETDPEDQAKSRVHKIGYA |
| Ga0268311_10170971 | 3300028529 | Phyllosphere | MHYGPKSLKSEGMLAVEITENDRQHTPTPKLCSSRAKRDETDPEDQAKSRVHK |
| Ga0214488_10556482 | 3300032467 | Switchgrass Phyllosphere | MKSEGMLAVKIIKIDRQHTPTPRLCSSRAIGVEIDPEDQAKFGVHKRRYA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |