NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F048923

Metagenome / Metatranscriptome Family F048923

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048923
Family Type Metagenome / Metatranscriptome
Number of Sequences 147
Average Sequence Length 117 residues
Representative Sequence MAFVPSKLQETFRIQCPGAEMNDELKDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN
Number of Associated Samples 105
Number of Associated Scaffolds 147

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 18.18 %
% of genes near scaffold ends (potentially truncated) 38.10 %
% of genes from short scaffolds (< 2000 bps) 73.47 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.116 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh
(38.776 % of family members)
Environment Ontology (ENVO) Unclassified
(51.701 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(91.837 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 60.33%    β-sheet: 0.00%    Coil/Unstructured: 39.67%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 147 Family Scaffolds
PF13264DUF4055 1.36
PF01312Bac_export_2 0.68
PF13649Methyltransf_25 0.68
PF04404ERF 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.28 %
UnclassifiedrootN/A2.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001355|JGI20158J14315_10203405All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium563Open in IMG/M
3300001948|GOS2228_1021762All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1518Open in IMG/M
3300002040|GOScombined01_104272451All Organisms → Viruses → Predicted Viral2150Open in IMG/M
3300002518|JGI25134J35505_10063323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium887Open in IMG/M
3300002519|JGI25130J35507_1024406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1357Open in IMG/M
3300005512|Ga0074648_1000282All Organisms → cellular organisms → Bacteria67645Open in IMG/M
3300006026|Ga0075478_10210998All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium591Open in IMG/M
3300006736|Ga0098033_1000829All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium13416Open in IMG/M
3300006802|Ga0070749_10001945All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium13957Open in IMG/M
3300006802|Ga0070749_10004650All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium9104Open in IMG/M
3300006810|Ga0070754_10011629All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium5487Open in IMG/M
3300006810|Ga0070754_10012533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium5246Open in IMG/M
3300006810|Ga0070754_10041039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium2509Open in IMG/M
3300006810|Ga0070754_10069641All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1801Open in IMG/M
3300006810|Ga0070754_10156004All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1088Open in IMG/M
3300006810|Ga0070754_10370175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium631Open in IMG/M
3300006810|Ga0070754_10418110All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium585Open in IMG/M
3300006810|Ga0070754_10480985All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium536Open in IMG/M
3300006868|Ga0075481_10074739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1275Open in IMG/M
3300006869|Ga0075477_10014049All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium3758Open in IMG/M
3300006869|Ga0075477_10305310All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium632Open in IMG/M
3300006870|Ga0075479_10274599All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium664Open in IMG/M
3300006874|Ga0075475_10014968All Organisms → Viruses → Predicted Viral3866Open in IMG/M
3300006874|Ga0075475_10150536All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1021Open in IMG/M
3300007236|Ga0075463_10029753All Organisms → Viruses → Predicted Viral1787Open in IMG/M
3300007344|Ga0070745_1006079All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium6064Open in IMG/M
3300007344|Ga0070745_1036057All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium2097Open in IMG/M
3300007344|Ga0070745_1051230All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1699Open in IMG/M
3300007344|Ga0070745_1163831All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium836Open in IMG/M
3300007346|Ga0070753_1115476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1037Open in IMG/M
3300007539|Ga0099849_1019963All Organisms → Viruses → Predicted Viral2918Open in IMG/M
3300007539|Ga0099849_1257267All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium640Open in IMG/M
3300007640|Ga0070751_1150439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium931Open in IMG/M
3300007960|Ga0099850_1340000All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium563Open in IMG/M
3300007960|Ga0099850_1369569All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium535Open in IMG/M
3300008012|Ga0075480_10042218All Organisms → Viruses → Predicted Viral2712Open in IMG/M
3300008952|Ga0115651_1065707All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium2843Open in IMG/M
3300009001|Ga0102963_1311560All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium619Open in IMG/M
3300009071|Ga0115566_10174924All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1325Open in IMG/M
3300009481|Ga0114932_10145007All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1461Open in IMG/M
3300009703|Ga0114933_10307714All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1050Open in IMG/M
3300010297|Ga0129345_1107999All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1027Open in IMG/M
3300010299|Ga0129342_1086073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1191Open in IMG/M
3300010318|Ga0136656_1032184All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1901Open in IMG/M
3300012525|Ga0129353_1357542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium822Open in IMG/M
3300012953|Ga0163179_10054185All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium2773Open in IMG/M
3300016732|Ga0182057_1375332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium605Open in IMG/M
3300016735|Ga0182074_1004612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium865Open in IMG/M
3300016739|Ga0182076_1223640All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium761Open in IMG/M
3300016741|Ga0182079_1208884All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1470Open in IMG/M
3300016781|Ga0182063_1338310All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium590Open in IMG/M
3300016781|Ga0182063_1565516All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium519Open in IMG/M
3300016787|Ga0182080_1360530All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium738Open in IMG/M
3300017818|Ga0181565_10071083All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium2490Open in IMG/M
3300017818|Ga0181565_10285416All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1111Open in IMG/M
3300017818|Ga0181565_10328042All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1022Open in IMG/M
3300017949|Ga0181584_10261296All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1119Open in IMG/M
3300017951|Ga0181577_10341345All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium964Open in IMG/M
3300017952|Ga0181583_10152450All Organisms → Viruses → Predicted Viral1544Open in IMG/M
3300017952|Ga0181583_10172904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1431Open in IMG/M
3300017957|Ga0181571_10596520All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium667Open in IMG/M
3300017957|Ga0181571_10619904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium652Open in IMG/M
3300017964|Ga0181589_10188131All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1443Open in IMG/M
3300017969|Ga0181585_10129232All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1867Open in IMG/M
3300017985|Ga0181576_10942048All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium504Open in IMG/M
3300017986|Ga0181569_10131535All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1778Open in IMG/M
3300017986|Ga0181569_10188542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1454Open in IMG/M
3300017986|Ga0181569_10524323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium799Open in IMG/M
3300018049|Ga0181572_10327477All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium969Open in IMG/M
3300018049|Ga0181572_10746197All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium586Open in IMG/M
3300018416|Ga0181553_10563066All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium604Open in IMG/M
3300018416|Ga0181553_10595245All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium584Open in IMG/M
3300018418|Ga0181567_10241415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1228Open in IMG/M
3300018418|Ga0181567_10865241All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium570Open in IMG/M
3300018420|Ga0181563_10228216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1120Open in IMG/M
3300018420|Ga0181563_10533409All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium657Open in IMG/M
3300018421|Ga0181592_10045404All Organisms → Viruses → Predicted Viral3521Open in IMG/M
3300018421|Ga0181592_10547113All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium793Open in IMG/M
3300018426|Ga0181566_10956596All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium578Open in IMG/M
3300018428|Ga0181568_10012922All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium7182Open in IMG/M
3300018428|Ga0181568_11308046All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium541Open in IMG/M
3300018876|Ga0181564_10760825All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium508Open in IMG/M
3300018989|Ga0193030_10055893All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1082Open in IMG/M
3300019253|Ga0182064_1030912All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium546Open in IMG/M
3300019262|Ga0182066_1516040All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium578Open in IMG/M
3300019266|Ga0182061_1484535All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium539Open in IMG/M
3300019271|Ga0182065_1347417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium3135Open in IMG/M
3300019272|Ga0182059_1123824All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium646Open in IMG/M
3300019272|Ga0182059_1257980All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium791Open in IMG/M
3300019274|Ga0182073_1125437All Organisms → Viruses → Predicted Viral1374Open in IMG/M
3300019280|Ga0182068_1353258All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1447Open in IMG/M
3300019280|Ga0182068_1460220All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium552Open in IMG/M
3300019280|Ga0182068_1633041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium897Open in IMG/M
3300019281|Ga0182077_1641854All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium504Open in IMG/M
3300019282|Ga0182075_1371663All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium587Open in IMG/M
3300019282|Ga0182075_1623837All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium910Open in IMG/M
3300019283|Ga0182058_1211950All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium535Open in IMG/M
3300019751|Ga0194029_1036348All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium789Open in IMG/M
3300020056|Ga0181574_10474932All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium708Open in IMG/M
3300020207|Ga0181570_10480117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium576Open in IMG/M
3300020410|Ga0211699_10223078All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium723Open in IMG/M
3300020420|Ga0211580_10319234All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium637Open in IMG/M
3300020424|Ga0211620_10000175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes29207Open in IMG/M
3300020442|Ga0211559_10159453All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1073Open in IMG/M
3300020442|Ga0211559_10341639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium695Open in IMG/M
3300021958|Ga0222718_10007172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium8737Open in IMG/M
3300021958|Ga0222718_10012526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium6189Open in IMG/M
3300021964|Ga0222719_10113420All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1964Open in IMG/M
3300022187|Ga0196899_1018996All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium2555Open in IMG/M
3300022187|Ga0196899_1027942All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium2004Open in IMG/M
3300022187|Ga0196899_1054413All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1299Open in IMG/M
3300022187|Ga0196899_1054599All Organisms → Viruses → Predicted Viral1296Open in IMG/M
3300022200|Ga0196901_1049083All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1582Open in IMG/M
3300022929|Ga0255752_10359305All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium591Open in IMG/M
3300023084|Ga0255778_10428868All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium562Open in IMG/M
3300023108|Ga0255784_10132664All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1378Open in IMG/M
3300023110|Ga0255743_10028920All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium3638Open in IMG/M
3300023178|Ga0255759_10315085All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium979Open in IMG/M
3300025072|Ga0208920_1013477All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1810Open in IMG/M
3300025078|Ga0208668_1002417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium4697Open in IMG/M
3300025109|Ga0208553_1025037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1561Open in IMG/M
3300025131|Ga0209128_1036627All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1929Open in IMG/M
3300025610|Ga0208149_1054314All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1029Open in IMG/M
3300025647|Ga0208160_1146316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium576Open in IMG/M
3300025653|Ga0208428_1132214All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium680Open in IMG/M
3300025671|Ga0208898_1008421All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium5368Open in IMG/M
3300025674|Ga0208162_1050730All Organisms → Viruses → Predicted Viral1395Open in IMG/M
3300025674|Ga0208162_1160258All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium607Open in IMG/M
3300025751|Ga0208150_1038128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1665Open in IMG/M
3300025751|Ga0208150_1038712All Organisms → Viruses → Predicted Viral1652Open in IMG/M
3300025751|Ga0208150_1239173All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium550Open in IMG/M
3300025769|Ga0208767_1026475All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium3080Open in IMG/M
3300025771|Ga0208427_1023146All Organisms → Viruses → Predicted Viral2415Open in IMG/M
3300025771|Ga0208427_1228995All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium579Open in IMG/M
3300025840|Ga0208917_1058878All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1497Open in IMG/M
3300025853|Ga0208645_1021888All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium3495Open in IMG/M
3300025890|Ga0209631_10001887All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes25801Open in IMG/M
3300032011|Ga0315316_10497762All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1022Open in IMG/M
3300032073|Ga0315315_10029893All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium5058Open in IMG/M
3300032136|Ga0316201_10537916All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1001Open in IMG/M
3300034374|Ga0348335_099403All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium920Open in IMG/M
3300034375|Ga0348336_014759All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium4387Open in IMG/M
3300034418|Ga0348337_007496All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium6807Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh38.78%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous36.73%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine5.44%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.76%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.04%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.04%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.36%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.36%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.36%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.36%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.68%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.68%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.68%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.68%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.68%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.68%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001948Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012EnvironmentalOpen in IMG/M
3300002040GS000c - Sargasso Station 3EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300002518Marine viral communities from the Pacific Ocean - ETNP_6_100EnvironmentalOpen in IMG/M
3300002519Marine viral communities from the Pacific Ocean - ETNP_2_300EnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006736Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016735Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016739Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016741Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016781Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016787Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071411AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019271Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101411XT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019280Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019281Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020056Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020207Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020420Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142)EnvironmentalOpen in IMG/M
3300020424Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023084Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaGEnvironmentalOpen in IMG/M
3300023108Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaGEnvironmentalOpen in IMG/M
3300023110Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaGEnvironmentalOpen in IMG/M
3300023178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaGEnvironmentalOpen in IMG/M
3300025072Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025078Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025109Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025131Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20158J14315_1020340513300001355Pelagic MarineMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRTPALQPLIEELLSELETRSREQLGIQ
GOS2228_102176233300001948MarineMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVETCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN*
GOScombined01_10427245133300002040MarineMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVETCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN*
JGI25133J35611_1011771413300002514MarineMPLVPDKLKSNFRIQCPGAEMNPELADVFFEMQPLTRHQMSNIYEKRIKNNKGVAKFLEDQWIASCIDWEGITDEKGSQIDCTDDTKREWFRNPAM
JGI25134J35505_1006332323300002518MarineKLSKTFKIPCPGAEMNPDLADVFFEMQPLTRHQLSSIYEKRIKNNKGVSKFLEDQWIQTCLDWEGITDESGSAIVCTDDTKREWFRNPAMQPLIEELLQELENRSREQLGIQEKN*
JGI25130J35507_102440623300002519MarineMPLVPDKLKSNFRIQCPGAEMNPELADVFFEMQPLTRHQMSNIYEKRIKNNKGVAKFLEDQWIASCIDWEGITDEKGSQIDCTDDTKREWFRNPAMQPLIEELLQELENKSREQLGIQEKN*
Ga0074648_1000282503300005512Saline Water And SedimentMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN*
Ga0075478_1021099813300006026AqueousMAFVPSKLQETFRIQCPGAEMNDELKDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSAIPCSDETKREWFRNPALQPLIEELLSELENRSREQLGIQEKN*
Ga0098033_100082943300006736MarineMPLVPGKLSKTFKIPCPGAEMNPDLADVFFEMQPLTRHQLSSIYEKRIKNNKGVSKFLEDQWIQTCLDWEGITDESGSAIVCTDDTKREWFRNPAMQPLIEELLQELENRSREQLGIQEKN*
Ga0070749_1000194523300006802AqueousMAFVPSKLQETFRIQCPGAEMNDDLKDVFFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEKN*
Ga0070749_1000465013300006802AqueousSLCRLSMQWGISLNLWGNFMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN*
Ga0070754_1001162963300006810AqueousVSPFDTMGHSNLIYGVTMAFTPSKLQETFRIQCPGAETNDELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSSIPCTDETKREWFRNPALQPLIEELLAELENKSRDQLGIQEKN*
Ga0070754_1001253333300006810AqueousMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN*
Ga0070754_1004103933300006810AqueousMAFVPSKLSETFRIQCPGAETNEELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSAIQCTDETKRDWFRNPALQPLIEELLAELENRSRDQLGIQEKN*
Ga0070754_1006964113300006810AqueousMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKREWFRNPALQPLIEELLSELETRSREQLGIQEKN*
Ga0070754_1015600413300006810AqueousMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEEIKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN*
Ga0070754_1037017523300006810AqueousFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEKN*
Ga0070754_1041811013300006810AqueousMAFVPSKLQETFRIQCPGAEMNDDLKDVFFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGVSIECNEENKRDWFRNPALQPLIEELLSELENRSRDQLGIQEKN*
Ga0070754_1048098513300006810AqueousMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYERRIKNNKGVSKFMEDQWVKTCVNWENVNDDKGKPIDCTEEAKREWFRNAALQPLIEELLAQLEAKSREQLGIQEKN*
Ga0075481_1007473923300006868AqueousVSPFDTMGHSNLIYGVTMAFTPSKLQETFRIQCPGAETNDELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKCCIGWENVVDDRGSSIPCTDETKREWFRNPALQPLIEELLAELENKSRDQLGIQEKN*
Ga0075477_1001404943300006869AqueousMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEKN*
Ga0075477_1030531013300006869AqueousVSPFDTMGHSNLIYGVTMAFTPSKLQETFRIQCPGAETNDELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSSIPCTDETKREWFRNPALQPLIEELLS
Ga0075479_1027459913300006870AqueousMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLEAKSREQLGIQEKN*
Ga0075475_1001496813300006874AqueousVSPFDTMGHSNLIYGVTMAFTPSKLQETFRIQCPGAETNDELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSSIPCTDETKREWFRNPA
Ga0075475_1015053613300006874AqueousMAFVPSKLQETFRIQCPGAEMNDDLKDVFFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGVSIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQE
Ga0075463_1002975333300007236AqueousMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN*
Ga0070745_100607933300007344AqueousMGHSNLIYGVTMAFTPSKLQETFRIQCPGAETNDELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSSIPCTDETKREWFRNPALQPLIEELLAELENKSRDQLGIQEKN*
Ga0070745_103605733300007344AqueousMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRNPALQPLIEELLSELETRSREQLGIQEKN*
Ga0070745_105123033300007344AqueousMQWGISLNLWGNFMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN*
Ga0070745_116383113300007344AqueousMAFVPSKLQETIRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEKN*
Ga0070753_111547633300007346AqueousMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLEAKSREQLGIQEKN*
Ga0099849_101996333300007539AqueousMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCANWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLEAKSREQLGIQEKN*
Ga0099849_125726723300007539AqueousMAFVPSKLQETFRIQCPGAEMNDGLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEKN*
Ga0070751_115043913300007640AqueousGKPMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYERRIKNNKGVSKFMEDQWVKTCVNWENVNDDKGKPIDCTEEAKREWFRNAALQPLIEELLAQLEAKSREQLGIQEKN*
Ga0099850_134000023300007960AqueousKPMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYERRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLEAKSREQLGIQEKN*
Ga0099850_136956923300007960AqueousMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGAAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQ
Ga0075480_1004221833300008012AqueousMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEEIKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN*
Ga0115651_106570723300008952MarineLGYQGDSFAIPFFLFNPKWGIIMPLVPDKLKSNFRIQCPGAEMNPELADVFFEMQPLTRHQMSNIYEKRIKNNKGVAKFLEDQWIASCVDWEGITDEKGSTIACTDDTKREWFRNPAMQPLIEELLQELENKSREQLGIQEKN*
Ga0102963_131156023300009001Pond WaterMAFVPSKLQETFRIQCPGAEMNDDLKDVFFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDDRGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEKN*
Ga0115566_1017492443300009071Pelagic MarineMQWGISLNLWGNFMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRTPALQPLIEELLSELETRSREQLGIQEKN*
Ga0114932_1014500713300009481Deep SubsurfaceMPLVPDKLKANFRIQCPGAEMNPELADVFFEMQPLTRHQMSSIYEKRIKNNKGVAKFLEDQWIASCIDWEGITDEKGSTIPCTDDTKREWFRNPAMQPL
Ga0114933_1030771413300009703Deep SubsurfaceLADVFFEMQPLTRHQMSSIYEKRIKNNKGVAKFLEDQWIASCIDWEGITDEKGSTIPCTDDTKREWFRNPAMQPLIEELLAELENKSREQLGIQEKN*
Ga0129345_110799913300010297Freshwater To Marine Saline GradientMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWLKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEKN*
Ga0129342_108607333300010299Freshwater To Marine Saline GradientLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN*
Ga0136656_103218433300010318Freshwater To Marine Saline GradientMAFVPSKLQETFRIQCPGAEMNDELKDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN*
Ga0129353_135754223300012525AqueousMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQL
Ga0163179_1005418533300012953SeawaterMAFVPSKLADSFRIQCPGAEMDPDLRDVYFTMRPLTKHEMSAIYERRIKNNKGVAKFMEDQWIRVCTDWENVTDDSGQPISCTEEIKREWFRNPALQPLIEELLSELERHSRNQLGIQEKN*
Ga0182057_137533223300016732Salt MarshRIQCPGAEMNDELKDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSAIPCSDETKREWFRNPALQPLIEELLSELENRSREQLGIQEKN
Ga0182074_100461223300016735Salt MarshMAFVPSKLQETFRIQCPGAETNDELKDVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSAIQCTDETKRDWFRNPALQPLIEELLAELENRSRDQLGIQEQ
Ga0182076_122364023300016739Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGAAIECNEENKRDWFRNPALQPLIEELLSELENRSRDQLGIQEK
Ga0182079_120888413300016741Salt MarshMAFVPSKLQETFRIQCPGAETNDELKDVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSAIQCTDETKRDWFRNPALQPLIEELLAELENRSRDQLGKCGG
Ga0182063_133831023300016781Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVFFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCLSWENVTDERGTEIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEK
Ga0182063_156551613300016781Salt MarshMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEEL
Ga0182080_136053013300016787Salt MarshMAFVPSKLQETFRIQCPGAETNDELKDVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSAIQCTDETKRDWFRNPALQPLIEELLAELENRSRDQ
Ga0181565_1007108333300017818Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWLKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEK
Ga0181565_1028541623300017818Salt MarshMQWGISLNLWGNFMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN
Ga0181565_1032804223300017818Salt MarshMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRNPALQPLIEELLSELETRSREQLGIQEK
Ga0181584_1026129623300017949Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGAAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEK
Ga0181577_1034134543300017951Salt MarshMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRRLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRNPALQPLIEELLSELETRS
Ga0181583_1015245023300017952Salt MarshMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN
Ga0181583_1017290413300017952Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEK
Ga0181571_1059652013300017957Salt MarshVSPFDTMGRSNLIYGVTMAFTPSKLQETFRIQCPGAETNDELAEVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSSIPCTDETKREWFRNPALQPLIEELLSELENKSRDQL
Ga0181571_1061990423300017957Salt MarshFLKVAPSLCRLSIQWGILLNLWGNFMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN
Ga0181589_1018813123300017964Salt MarshMDPELQDVYFTMKPLTRHEISALYERRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN
Ga0181585_1012923233300017969Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLSELENRSRDQLGIQEK
Ga0181576_1094204813300017985Salt MarshFLKVAPSLCRLSMQWGISLNLWGNFMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN
Ga0181569_1013153533300017986Salt MarshMAFVPSKLQETFRIQCPGAETNEELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSAIQCTDETKRDWFRNPALQPLIEELLAELENRSRDQLGIQEK
Ga0181569_1018854213300017986Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCLSWENVTDERGTEIECNEENKRDWFRNPALQPLIEELLN
Ga0181569_1052432313300017986Salt MarshPILVSPFDTMGRSNLIYGVTMAFTPSKLQETFRIQCPGAETNDELAEVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSSIPCTDETKREWFRNPALQPLIEELLSELENKSRDQLGIQEKN
Ga0181572_1032747713300018049Salt MarshWGISLNLWGNFMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN
Ga0181572_1074619723300018049Salt MarshMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCIRWENVVDERGSQISCTDEAKKEWFRNPALQPLIEELLSELESRSREQLGIQ
Ga0181553_1056306613300018416Salt MarshMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLETKSREQ
Ga0181553_1059524513300018416Salt MarshMAFVPSKLQETFRIQCPGAEMNDELKDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCIAWENVVDDKGSQLPCTDETKKEWFRNPALQPL
Ga0181567_1024141533300018418Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVFFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEK
Ga0181567_1086524123300018418Salt MarshMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRNPALQPLIE
Ga0181563_1022821623300018420Salt MarshMQWGISLNLWGNFMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRNPALQPLIEELLSELETRSREQLGIQEKN
Ga0181563_1053340913300018420Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWLKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLSELENRSRDQLGIQEK
Ga0181592_1004540433300018421Salt MarshMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLETKSREQLGIQEK
Ga0181592_1054711313300018421Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGAAIECNEENKRDWFRNPALQ
Ga0181566_1095659613300018426Salt MarshLNLWGNFMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRNPALQPLIEELLSELETRSREQLGIQEKN
Ga0181568_1001292233300018428Salt MarshMAFTPSKLQETFRIQCPGAETNDELAEVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSSIPCTDETKREWFRNPALQPLIEELLSELENKSRDQLGIQEK
Ga0181568_1130804613300018428Salt MarshRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRVSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN
Ga0193031_106730913300018765MarineMRPLTKHEMSAIYERRIKNNKGVAKFMEDQWIRVCTDWENVTDDSGQPISCTEEIKREWFRNPALQPLIEELLSELERHSRNQLGIQEKN
Ga0181564_1076082523300018876Salt MarshMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPL
Ga0193030_1005589323300018989MarineMAFVPSKLADSFRIQCPGAEMDPDLRDVYFTMRPLTKHEMSAIYERRIKNNKGVAKFMEDQWIRVCTDWENVTDDSGQPISCTEEIKREWFRNPALQPLIEELLSELERHSRNQLGIQEK
Ga0182064_103091213300019253Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVFFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCVSWENVTDERGAAIECNEENKRDWFRNPALQPLIEELLSELENRSRDQ
Ga0182066_151604013300019262Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGTEIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEK
Ga0182061_148453523300019266Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWLKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNE
Ga0182065_134741713300019271Salt MarshMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRNPAL
Ga0182059_112382423300019272Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCLSWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEK
Ga0182059_125798023300019272Salt MarshMQWGISLNLWGNFMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSAIPCSDETKREWFRNPALQPLIEELLSELENRSREQLGIQEKN
Ga0182073_112543733300019274Salt MarshMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLETK
Ga0182068_135325823300019280Salt MarshMAFVPSKLQETFRIQCPGAETNDELKDVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSAIQCTDETKRDWFRNPALQPLIEELLAELENRSRDQLGIQEK
Ga0182068_146022013300019280Salt MarshMAFVPSKLQETFRIQCPGAEMNDELKDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEK
Ga0182068_163304113300019280Salt MarshMDPELQDVYFTMKPLTRHEISALYERRIKNNKGVSKFMEDQWVKTCVNWENVNDDKGKPIDCTEEAKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN
Ga0182077_164185423300019281Salt MarshMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEK
Ga0182075_137166313300019282Salt MarshMAFVPSKLQETFRIQCPGAETNDELKDVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSAIQCTDETKRDWFRNPALQPLIEEL
Ga0182075_162383713300019282Salt MarshMAFVPSKLQETFRIQCPGAEMNDELKDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSAIPCSDETKREWFRNPALQPLIEELLS
Ga0182058_121195013300019283Salt MarshMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRNPALQPLIEELLSELETRSREQLGIQEK
Ga0194029_103634813300019751FreshwaterMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEISSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRNPALQPLIEELLSELETRSREQLGIQEK
Ga0181574_1047493223300020056Salt MarshVSPFDTMGRSNLIYGVTMAFTPSKLQETFRIQCPGAETNDELAEVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSSIPCTDETKREWFRNPALQPLIEELLSELENKSRDQLGIQEKN
Ga0181570_1048011723300020207Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVFFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWLKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEK
Ga0211699_1022307823300020410MarineMAFVPSKLQETFRIQCPGAETNEELAEVYFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWEKVVDDNGRHIECTEETKREWFRNPALQPLIEELLNELENRSRDQLGIQEK
Ga0211580_1031923413300020420MarineMPLVPGKLSKTFKIPCPGAEMNPELEDVFFEMQPLTRHQLSSIYEKRIKNNKGVSKFLEDQWIQTCMDWEGITDETGAPISCTEDTKREWFRNPAMQPLIEELLTELENKSREQLGIQEK
Ga0211620_1000017533300020424MarineMSFVPSKLQETFLIQCPGAETNKELEDVYFEMRPLTRHEMSRIYERRVKNNKGISNFLEDQWVRCCVGWSNVVDESGVTVECTEEVKKEWFRNPALQPLIEELLAELENKSREQLGIQEK
Ga0211559_1015945323300020442MarineMPLVPGKLSSTFKIPCPGAEMNPDLNDVFFEMQPLTRHQLSSIYEKRIKNNKGVSKFLEDQWIQTCLDWEGITDETGAPISCTDETKRDWFRNPAMQPLIEELLQELENRSREQLGIQEK
Ga0211559_1034163913300020442MarineMAFVPSKLSETFRIQCPGAETNEELAEVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCISWENVVDDRGSVIQCTDETKREWFRNPALQPLIEELLAELENRSRDQLGIQEK
Ga0222718_1000717233300021958Estuarine WaterMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKAIDCTEETKREWFRNAALQPLIEELLAQLETKSREQLGIQEK
Ga0222718_1001252663300021958Estuarine WaterMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCSDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEK
Ga0222719_1011342023300021964Estuarine WaterVSPFDTMGHSNLIYGVTMAFTPSKLQETFRIQCPGAETNDELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKCCIGWENVVDDRGSSIPCTDETKREWFRNPALQPLIEELLAELENKSRDQLGIQEKN
Ga0196899_101899643300022187AqueousMAFVPSKLQETFRIQCPGAEMNDELKDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSAIPCSDETKREWFRNPALQPLIEELLSELENRSREQLGIQEK
Ga0196899_102794213300022187AqueousMAFVPSKLQETFRIQCPGAEMNDDLKDVFFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGVSIECNEENKRDWFRNPALQPLIEELLNEL
Ga0196899_105441313300022187AqueousVSPFDTMGHSNLIYGVTMAFTPSKLQETFRIQCPGAETNDELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSSIPCTDETKREWFRNPALQPLIEELLAELENKSRDQLGIQEKN
Ga0196899_105459913300022187AqueousMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEEIKREWFRNAALQPLIEELLAQLETKSREQLG
Ga0196901_104908323300022200AqueousMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLEAKSREQLGIQEKN
Ga0255752_1035930523300022929Salt MarshMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRNPALQP
Ga0255778_1042886813300023084Salt MarshIQCPGAETNDELKDVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSAIQCTDETKRDWFRNPALQPLIEELLAELENRSRDQLGIQEKN
Ga0255784_1013266433300023108Salt MarshMAFVPSKLQETFRIQCPGAEMNDDLKDVFFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGTEIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEK
Ga0255743_1002892013300023110Salt MarshMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCLSWENVTDERGTEIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEKN
Ga0255759_1031508523300023178Salt MarshVAPSLCRLSIQWGILLNLWGNFMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRNPALQPLIEELLSELETRSREQLGIQEKN
Ga0208920_101347733300025072MarineMPLVPDKLKSNFRIQCPGAEMNPELADVFFEMQPLTRHQMSNIYEKRIKNNKGVAKFLEDQWIASCIDWEGITDEKGSQIDCTDDTKREWFRNPAMQPLIEELLQELENKSREQLGIQEK
Ga0208668_100241733300025078MarineMPLVPGKLSKTFKIPCPGAEMNPDLADVFFEMQPLTRHQLSSIYEKRIKNNKGVSKFLEDQWIQTCLDWEGITDESGSAIVCTDDTKREWFRNPAMQPLIEELLQELENRSREQLGIQEK
Ga0208553_102503723300025109MarineMPLVPGKLSKTFKIPCPGAEMNPDLADVFFEMQPLTRHQLSSIYEKRIKNNKGVSKFLEDQWIQTCLDWEGITDESGSAIVCTDDTKREWFRNPAMQPLIEELLQELENKSREQLGIQEK
Ga0209128_103662713300025131MarineKLSKTFKIPCPGAEMNPDLADVFFEMQPLTRHQLSSIYEKRIKNNKGVSKFLEDQWIQTCLDWEGITDESGSAIVCTDDTKREWFRNPAMQPLIEELLQELENRSREQLGIQEKN
Ga0208149_105431433300025610AqueousGKPMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEEIKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN
Ga0208160_114631613300025647AqueousMAFVPSKLSETFRIQCPGAETNEELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSAIQCTDETKRDWFRNPALQPLIEELLAELENRSRDQLGIQEK
Ga0208428_113221413300025653AqueousEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN
Ga0208795_109355123300025655AqueousPLTRHEISALYERRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN
Ga0208898_100842133300025671AqueousAFVPSKLQETFRIQCPGAEMNDDLKDVYFEMRPLTRHEVSGIYEKRVKNNKGISKFLEDQWIKCCISWENVTDERGTAIECNEENKRDWFRNPALQPLIEELLNELENRSRDQLGIQEKN
Ga0208162_105073013300025674AqueousMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLEAKS
Ga0208162_116025813300025674AqueousLCRLSMQWGISLNLWGNFMAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN
Ga0208150_103812833300025751AqueousFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN
Ga0208150_103871233300025751AqueousMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEEIKREWFRNAALQPLIEELLAQLETKSREQLGIQEKN
Ga0208150_123917313300025751AqueousPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKREWFRNPALQPLIEELLSELETRSREQLGIQEKN
Ga0208767_102647533300025769AqueousMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEEIKREWFRNAALQPLIEELLAQLETKSREQLGIQEK
Ga0208427_102314633300025771AqueousMAFVPSKLSDSFRIQCPGAEMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEETKREWFRNAALQPLIEELLAQLEAKSREQLGIQEK
Ga0208427_122899523300025771AqueousAFVPSKLQETFRIQCPGAEMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN
Ga0208917_105887833300025840AqueousMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKREWFRNPALQPLIEELLSELETRSREQLGIQEK
Ga0208645_102188813300025853AqueousDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN
Ga0209631_1000188733300025890Pelagic MarineMAFVPSKLQETFRIQCPGAEMNPDLQDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDERGSQISCTDEAKKEWFRTPALQPLIEELLSELETRSREQLGIQEK
Ga0315316_1049776223300032011SeawaterMPLVPDKLKSNFRIQCPGAEMNKELADVFFEMQPLTRHQMSSIYEKRIKNNKGVAKFLEDQWIASCQDWEGITDEKGSTIPCTDDTKRDWFRNPAMQPLIEELLAELENKSREQLGIQEK
Ga0315315_1002989343300032073SeawaterMAFAPSKLQETFRIQCPGAEMNDELKDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCIGWENVVDERGSTLECTDETKKDWFRNPALQPLIEELLAELETRSREQLGIQEK
Ga0316201_1053791613300032136Worm BurrowMDPELQDVYFTMKPLTRHEISALYEKRIKNNKGVSKFMEDQWVKTCVNWENVTDDKGKPIDCTEEIKREWFRNAALQPLIEELLAQLEAKSREQLGIQEKN
Ga0348335_099403_25_3903300034374AqueousMAFTPSKLQETFRIQCPGAETNDELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSSIPCTDETKREWFRNPALQPLIEELLAELENKSRDQLGIQEK
Ga0348336_014759_3_3083300034375AqueousMNSELEDVYFEMRPLTRHEVSSIYEKRVKNNKGISKFLEEQWLKSCISWENVVDDRGSQIPCTDETKREWFRNPALQPLIEELLAELETRSRDQLGIQEKN
Ga0348336_051408_1_3033300034375AqueousMGHSNLIYGVTMAFTPSKLQETFRIQCPGAETNDELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSSIPCTDETKREW
Ga0348337_007496_5008_54063300034418AqueousMGHSNLIYGVTMAFTPSKLQETFRIQCPGAETNDELADVFFEMRPLTRHEISGIYEKRVKNNKGISKFLEDQWLKSCIGWENVVDDRGSSIPCTDETKREWFRNPALQPLIEELLAELENKSRDQLGIQEKN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.