Basic Information | |
---|---|
Family ID | F048939 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 147 |
Average Sequence Length | 46 residues |
Representative Sequence | MSQVQLNVEELKSFIKHMVKNNQHIQSEGKVPVAINIEGDAGL |
Number of Associated Samples | 124 |
Number of Associated Scaffolds | 147 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.36 % |
% of genes near scaffold ends (potentially truncated) | 81.63 % |
% of genes from short scaffolds (< 2000 bps) | 78.91 % |
Associated GOLD sequencing projects | 115 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.068 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.728 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.816 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (48.299 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.17% β-sheet: 0.00% Coil/Unstructured: 71.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 147 Family Scaffolds |
---|---|---|
PF09967 | DUF2201 | 57.82 |
PF13203 | DUF2201_N | 21.77 |
PF07453 | NUMOD1 | 9.52 |
PF01541 | GIY-YIG | 2.04 |
PF12705 | PDDEXK_1 | 1.36 |
PF13155 | Toprim_2 | 1.36 |
PF13479 | AAA_24 | 1.36 |
PF12843 | QSregVF_b | 0.68 |
PF01612 | DNA_pol_A_exo1 | 0.68 |
PF00856 | SET | 0.68 |
PF00722 | Glyco_hydro_16 | 0.68 |
COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
---|---|---|---|
COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.76 % |
Unclassified | root | N/A | 12.24 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000126|BS_KBB_SWE26_205mDRAFT_c1074452 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300000792|BS_KBA_SWE02_21mDRAFT_10097498 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300000929|NpDRAFT_10342557 | Not Available | 647 | Open in IMG/M |
3300000973|BBAY93_10005063 | All Organisms → Viruses → Predicted Viral | 3478 | Open in IMG/M |
3300002349|B570J29580_103692 | Not Available | 923 | Open in IMG/M |
3300002408|B570J29032_109831042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. gcode 4 | 1525 | Open in IMG/M |
3300002835|B570J40625_100359367 | All Organisms → Viruses → Predicted Viral | 1439 | Open in IMG/M |
3300003393|JGI25909J50240_1049573 | Not Available | 875 | Open in IMG/M |
3300003394|JGI25907J50239_1106583 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300003860|Ga0031658_1069484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 619 | Open in IMG/M |
3300004240|Ga0007787_10015108 | All Organisms → cellular organisms → Bacteria | 3165 | Open in IMG/M |
3300004240|Ga0007787_10133272 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
3300005488|Ga0074213_119498 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300005527|Ga0068876_10695541 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300005613|Ga0074649_1146570 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300005941|Ga0070743_10144315 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300006641|Ga0075471_10115325 | Not Available | 1436 | Open in IMG/M |
3300006641|Ga0075471_10638313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. gcode 4 | 521 | Open in IMG/M |
3300006738|Ga0098035_1110324 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300006802|Ga0070749_10158269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. gcode 4 | 1314 | Open in IMG/M |
3300006868|Ga0075481_10104113 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300006875|Ga0075473_10270079 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300007644|Ga0102902_1235677 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300007973|Ga0105746_1020782 | All Organisms → Viruses → Predicted Viral | 1947 | Open in IMG/M |
3300008108|Ga0114341_10297604 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300008108|Ga0114341_10411420 | Not Available | 650 | Open in IMG/M |
3300008111|Ga0114344_1178290 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300008114|Ga0114347_1005305 | All Organisms → cellular organisms → Bacteria | 9806 | Open in IMG/M |
3300008117|Ga0114351_1304714 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300008266|Ga0114363_1006395 | All Organisms → cellular organisms → Bacteria | 5918 | Open in IMG/M |
3300008267|Ga0114364_1005634 | All Organisms → cellular organisms → Bacteria | 6341 | Open in IMG/M |
3300008267|Ga0114364_1036930 | All Organisms → Viruses → Predicted Viral | 1858 | Open in IMG/M |
3300008448|Ga0114876_1099874 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
3300008450|Ga0114880_1007076 | All Organisms → cellular organisms → Bacteria | 5740 | Open in IMG/M |
3300009059|Ga0102830_1076745 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300009081|Ga0105098_10180798 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300009085|Ga0105103_10140922 | All Organisms → Viruses → Predicted Viral | 1270 | Open in IMG/M |
3300009085|Ga0105103_10823493 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300009131|Ga0115027_11160298 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300009152|Ga0114980_10196005 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300009158|Ga0114977_10467910 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300009165|Ga0105102_10114703 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300009165|Ga0105102_10599232 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300009512|Ga0115003_10493340 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300009529|Ga0114919_10637149 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300010153|Ga0098059_1378286 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300010158|Ga0114960_10442163 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300010299|Ga0129342_1142629 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300010354|Ga0129333_10534232 | Not Available | 1024 | Open in IMG/M |
3300010354|Ga0129333_11366657 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300010370|Ga0129336_10036765 | All Organisms → Viruses → Predicted Viral | 2952 | Open in IMG/M |
3300010885|Ga0133913_11082469 | All Organisms → Viruses → Predicted Viral | 2065 | Open in IMG/M |
3300010885|Ga0133913_11093324 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
3300011126|Ga0151654_1066295 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300012012|Ga0153799_1006333 | All Organisms → Viruses → Predicted Viral | 2840 | Open in IMG/M |
3300012013|Ga0153805_1001432 | Not Available | 4683 | Open in IMG/M |
3300012013|Ga0153805_1026382 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300012970|Ga0129338_1408854 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
3300013093|Ga0164296_1003639 | All Organisms → cellular organisms → Bacteria | 14452 | Open in IMG/M |
(restricted) 3300013129|Ga0172364_10871343 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10869074 | Not Available | 549 | Open in IMG/M |
3300013372|Ga0177922_10292037 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300013372|Ga0177922_11202382 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300014811|Ga0119960_1023118 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300015050|Ga0181338_1055767 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300017700|Ga0181339_1036489 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300017707|Ga0181363_1076053 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300017747|Ga0181352_1007145 | All Organisms → cellular organisms → Bacteria | 3711 | Open in IMG/M |
3300017747|Ga0181352_1136759 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300017747|Ga0181352_1169536 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300017754|Ga0181344_1191555 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300017761|Ga0181356_1245756 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300017766|Ga0181343_1142939 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300017778|Ga0181349_1202001 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300017780|Ga0181346_1325212 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300019751|Ga0194029_1042911 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300019783|Ga0181361_104162 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
3300019783|Ga0181361_110984 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300019784|Ga0181359_1133762 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300020214|Ga0194132_10198467 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
3300020513|Ga0208090_1001643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4161 | Open in IMG/M |
3300020556|Ga0208486_1023952 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300021079|Ga0194055_10000938 | All Organisms → cellular organisms → Bacteria | 23666 | Open in IMG/M |
3300022057|Ga0212025_1086002 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300022173|Ga0181337_1026070 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300022218|Ga0224502_10052629 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300023176|Ga0255772_10536055 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
(restricted) 3300024057|Ga0255051_10379807 | Not Available | 524 | Open in IMG/M |
3300024262|Ga0210003_1244941 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300024483|Ga0255224_1054684 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
(restricted) 3300024519|Ga0255046_10651136 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300024533|Ga0256299_1100817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. gcode 4 | 574 | Open in IMG/M |
3300025057|Ga0208018_132541 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300025093|Ga0208794_1000202 | Not Available | 48780 | Open in IMG/M |
3300025687|Ga0208019_1115404 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 802 | Open in IMG/M |
3300025732|Ga0208784_1022288 | All Organisms → Viruses → Predicted Viral | 2056 | Open in IMG/M |
3300025732|Ga0208784_1044084 | Not Available | 1387 | Open in IMG/M |
3300025872|Ga0208783_10104196 | Not Available | 1240 | Open in IMG/M |
3300027196|Ga0208438_1000278 | Not Available | 13711 | Open in IMG/M |
3300027468|Ga0209247_1003900 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
3300027468|Ga0209247_1054308 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1093439 | Not Available | 1477 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1171423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. gcode 4 | 906 | Open in IMG/M |
3300027772|Ga0209768_10033525 | All Organisms → cellular organisms → Bacteria | 2795 | Open in IMG/M |
3300027777|Ga0209829_10008053 | All Organisms → cellular organisms → Bacteria | 6896 | Open in IMG/M |
3300027785|Ga0209246_10054926 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300027785|Ga0209246_10329917 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300027797|Ga0209107_10089115 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
3300027804|Ga0209358_10026438 | All Organisms → Viruses → Predicted Viral | 3610 | Open in IMG/M |
3300027804|Ga0209358_10030482 | All Organisms → Viruses → Predicted Viral | 3319 | Open in IMG/M |
3300027808|Ga0209354_10218912 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300027816|Ga0209990_10446164 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300027899|Ga0209668_10036368 | All Organisms → cellular organisms → Bacteria | 2562 | Open in IMG/M |
3300027972|Ga0209079_10071060 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10354440 | Not Available | 732 | Open in IMG/M |
3300029306|Ga0135212_1010436 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300031746|Ga0315293_10079730 | All Organisms → cellular organisms → Bacteria | 2802 | Open in IMG/M |
3300031746|Ga0315293_10694723 | Not Available | 758 | Open in IMG/M |
3300031746|Ga0315293_11016132 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300031746|Ga0315293_11284751 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300031758|Ga0315907_10700455 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300031784|Ga0315899_10170741 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
3300031787|Ga0315900_10765703 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300031834|Ga0315290_10605874 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300031851|Ga0315320_10075286 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
3300031857|Ga0315909_10452443 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300031951|Ga0315904_10040472 | All Organisms → cellular organisms → Bacteria | 5309 | Open in IMG/M |
3300031951|Ga0315904_10485092 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
3300031963|Ga0315901_10732655 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300031999|Ga0315274_11833762 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300032046|Ga0315289_11331688 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300032050|Ga0315906_10682906 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300032092|Ga0315905_10553172 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300032116|Ga0315903_10454005 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
3300032116|Ga0315903_10928115 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300032173|Ga0315268_11567301 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300033521|Ga0316616_101841937 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300033557|Ga0316617_100135363 | All Organisms → Viruses → Predicted Viral | 1834 | Open in IMG/M |
3300033980|Ga0334981_0321576 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300034062|Ga0334995_0793098 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300034063|Ga0335000_0563310 | Not Available | 647 | Open in IMG/M |
3300034103|Ga0335030_0030728 | All Organisms → Viruses → Predicted Viral | 4098 | Open in IMG/M |
3300034104|Ga0335031_0000141 | All Organisms → cellular organisms → Bacteria | 62103 | Open in IMG/M |
3300034108|Ga0335050_0391085 | Not Available | 628 | Open in IMG/M |
3300034279|Ga0335052_0042174 | All Organisms → Viruses → Predicted Viral | 2832 | Open in IMG/M |
3300034284|Ga0335013_0090585 | All Organisms → Viruses → Predicted Viral | 2154 | Open in IMG/M |
3300034356|Ga0335048_0433022 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.73% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.52% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.48% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.48% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.12% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.44% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.08% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.08% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.40% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.72% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.04% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.04% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.04% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.04% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.36% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.36% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.36% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 1.36% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.36% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.36% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.68% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.68% |
Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.68% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.68% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.68% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.68% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.68% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.68% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.68% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.68% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.68% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.68% |
Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.68% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.68% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.68% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.68% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.68% |
Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.68% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.68% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000126 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5m | Environmental | Open in IMG/M |
3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
3300002349 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005488 | Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Methane enrichment | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011126 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021079 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m | Environmental | Open in IMG/M |
3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
3300022173 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.D.D | Environmental | Open in IMG/M |
3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
3300024057 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9 | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
3300024533 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025093 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027196 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes) | Environmental | Open in IMG/M |
3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
3300029306 | Marine harbor viral communities from the Indian Ocean - SCH3 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
BS_KBB_SWE26_205mDRAFT_10744521 | 3300000126 | Marine | MNTVQLNVEELKGFIRHMVKNNQHIQAEGKVPVAINIE |
BS_KBA_SWE02_21mDRAFT_100974981 | 3300000792 | Marine | MNQVQLNVDELKNFIKHMVANNQHIQADGKVPVAINIEGDAGLG |
NpDRAFT_103425572 | 3300000929 | Freshwater And Marine | MSQIQLNVDELKTFMNHMVTNNQYIQAQGKVPVTVNISGDAGLGKTSAIL |
BBAY93_100050635 | 3300000973 | Macroalgal Surface | MNQVKLNVDEMKVFIKHMVNNNKHIQETGKVPVAVNIEGEAGLGKTSAIMQ |
B570J29580_1036922 | 3300002349 | Freshwater | IRIIKKRSMSQVQLNVEELKDFIKHMVKNNQHIQSEGKVPVAVNIEGDAGLNSK* |
B570J29032_1098310423 | 3300002408 | Freshwater | MSQVQLNVEELKDFIKHMVKNNQHIQSEGKVPVAVNIEGDAGLNSK* |
B570J40625_1003593673 | 3300002835 | Freshwater | MSQVQLNVTELKDFIKHMVKNNQHIQSEGKVPVAINIEGDAG |
JGI25909J50240_10495732 | 3300003393 | Freshwater Lake | MSQVQLNVDELKGYLKHMVNNNQYIQAQGKVPVAVNIEGDAGLGKTSSLMQLKVMQVLVRLHL* |
JGI25907J50239_11065832 | 3300003394 | Freshwater Lake | MSQVQLNVDELKGYLKHMVNNNQYIQAQGKVPVAVNIEGDAGLGKTSSLMQLANE |
Ga0031658_10694842 | 3300003860 | Freshwater Lake Sediment | MSRKKVENSQVLLNVDELKDFIKHMVTNNQHIQKEGKVPVAINIEGDAGLNSK* |
Ga0007787_100151081 | 3300004240 | Freshwater Lake | MSQVQLNVDELKNFIKHMVKNNQHIQSEGKVPVAINIEGDA |
Ga0007787_101332721 | 3300004240 | Freshwater Lake | MSANVKLNVDELKTLIKYMVSNNQHIQEQGKNPVAINVESPAG |
Ga0074213_1194982 | 3300005488 | Sediment | MSQVQLNVEELKGCIKHMVNNNQHIQKEGKVPVAINIEGDAGLGKTSAIMLVR* |
Ga0068876_106955411 | 3300005527 | Freshwater Lake | MSQVQLNVDELKSFIKHMVKNNQHIQSEGKVPVAINIEGD |
Ga0074649_11465701 | 3300005613 | Saline Water And Sediment | MNNQVELNVNELKDFIKHIVNNNKKIQEQGKIPVAINVEGDAGLGKTSAI |
Ga0070743_101443152 | 3300005941 | Estuarine | MNTVQLNAEELKGFINHMVKNNQHIQAQGKVPVAVNIEGDAGLGKTSTILQL |
Ga0075471_101153253 | 3300006641 | Aqueous | MSQVQLNVEELKSFIKHMVNNNQHIQAQGKVPVAINIEGDAGLNSK* |
Ga0075471_106383132 | 3300006641 | Aqueous | MSQVQLNVEELKNFIKHMVKNNQHIQSEGKVPVAINIEGDAGLGKTSAIM |
Ga0098035_11103241 | 3300006738 | Marine | MSESTQLNVDELKGFLKHMVKNNQHIQNEGKIPVAV |
Ga0070749_101582693 | 3300006802 | Aqueous | EELKGFIRHMVANNQYIQSQGKVPVAINIEGDAGLNSK* |
Ga0075481_101041132 | 3300006868 | Aqueous | MNNVVKLNLAELKDFLRHIVKNNQYIQGEGKIPVAVNIE |
Ga0075473_102700792 | 3300006875 | Aqueous | MSQVQLNLDELKDFVKYMVTNNQHIQANGKVPVAVNIEGDAGLNSK* |
Ga0102902_12356771 | 3300007644 | Estuarine | MNTVQLNVDELKNFIRHMVKNNQYIQSEGKVPVAVNIEGDAG |
Ga0105746_10207824 | 3300007973 | Estuary Water | MSQVKLNIEELKSFMGHMISNNQHIQAQGKVPVAVNVEGDAGLGKTSSIKQLAKEQGMDV |
Ga0114341_102976042 | 3300008108 | Freshwater, Plankton | MNTVQLNAEELKGFIKHMVTNNQHIQAQGKVPVAVNIEGDAGLGKTSTILQLGK |
Ga0114341_104114202 | 3300008108 | Freshwater, Plankton | MNTVQLNAEELKGFIKHMVTNNQHIQAQGKVPVAVNIEGDAGLGKTS |
Ga0114344_11782902 | 3300008111 | Freshwater, Plankton | MNTVQLNVEELKGFIRHMVKNNQHIQAEGKVPVAINIEGDAGLGKTSAIMQWVKSLVWM* |
Ga0114347_100530516 | 3300008114 | Freshwater, Plankton | MSTVQLNVEELKGFIRHMVANNQYIQSQGKVPVAINIEGDAGLGK |
Ga0114351_13047141 | 3300008117 | Freshwater, Plankton | MSTVQLNVEELKGFIRHMVANNQYIQSQGKVPVAINIEGD |
Ga0114363_10063951 | 3300008266 | Freshwater, Plankton | MSQVQLNVEELKNFIKHMVKNNQHIQSEGKVPVAINIEGDAGLG |
Ga0114364_10056344 | 3300008267 | Freshwater, Plankton | MSRKAENKQVFLNVDEMKDFIKHMVKNNQHIQGQGKVPVAINIEGDAGLNSK* |
Ga0114364_10369303 | 3300008267 | Freshwater, Plankton | MSQVQLNLDELKDFVKYMVTNNQHIQSLGKVPVAVNIEGDAGLGKTSSVKQLATELNMDIIR |
Ga0114876_10998741 | 3300008448 | Freshwater Lake | MNTVQLNAEELKGFIKHMVTNNQHIQAQGKVPVAVNIEGDAGLGKTSTILQLGKELGM |
Ga0114880_10070761 | 3300008450 | Freshwater Lake | MNTVQLNVDELKGFIRHMVKNNQHIQSEGKVPVAINI |
Ga0102830_10767451 | 3300009059 | Estuarine | MNTVQLNAEELKGFINHMVKNNQHIQAQGKVPVAVNIEGDAGLGKTST |
Ga0105098_101807981 | 3300009081 | Freshwater Sediment | MSTVQLNVEELKGFIRHMVANNQYIQSQGKVPVAINIEGDAGLGKTSAIMQLGK |
Ga0105103_101409222 | 3300009085 | Freshwater Sediment | MSQVQLNVEELKSFIKHMVKNNQHIQTEGKVPVAINIEGDAGLGKTSAIM |
Ga0105103_108234931 | 3300009085 | Freshwater Sediment | MSQVQLNVDELKGYLKHMVSNNQYIQAEGKVPVAVNIEGDAGLGKTSSL |
Ga0115027_111602982 | 3300009131 | Wetland | MNQVQLNVEELKDFIKHMVANNQHIQAQGKVPVAINIEGDAGLNSK* |
Ga0114980_101960051 | 3300009152 | Freshwater Lake | MSKSVQLNLDEIKDFVKFMVKNNQHIQSQGKVPVAINIEGD |
Ga0114977_104679101 | 3300009158 | Freshwater Lake | MNQVQLNVEELKNFIKHMVSNNQHIQKDGKVPVAVNI |
Ga0105102_101147032 | 3300009165 | Freshwater Sediment | MSQVQLNVEELKSFIKHMVNNNQHIQAEGKVPVAINIEGD |
Ga0105102_105992322 | 3300009165 | Freshwater Sediment | MSQVQLNVEELKSFIKHMVKNNQHIQTEGKVPVAINI |
Ga0115003_104933401 | 3300009512 | Marine | MDCTQLSVDELKDFLKHVVNNNQHIQKEGKIPIAVNI |
Ga0114919_106371491 | 3300009529 | Deep Subsurface | MSQVQLNVEELKGFIKHMVNNNQHIQKEGKVPVAINIEGDAGLG |
Ga0098059_13782862 | 3300010153 | Marine | MSESTQLNVDELKDFLKHMVKNNQHIQNEGKVPVAVNI |
Ga0114960_104421631 | 3300010158 | Freshwater Lake | MSKKKIENSQVLLNVTEMKEFISHMVENNQYIQTQGKVPVAINIEGDAGLN |
Ga0129342_11426293 | 3300010299 | Freshwater To Marine Saline Gradient | MSDQTQLNVKELKDFIKHMVKNNQHIQAEGKVPVAINIEGDAGLGK |
Ga0129333_105342322 | 3300010354 | Freshwater To Marine Saline Gradient | MSQVKLNIEELKDFLKYMINNNQHIQNDGKVPVAINIEGDAGLNSK* |
Ga0129333_113666572 | 3300010354 | Freshwater To Marine Saline Gradient | MNQVQLNVEELKNFIKHMVKNNQHIQAEGKVPVAINIEGDAGLG |
Ga0129336_100367654 | 3300010370 | Freshwater To Marine Saline Gradient | MSQVKLNIEELKDFLKYMINNNQHIQNDGKVPVAINIEGD |
Ga0133913_110824691 | 3300010885 | Freshwater Lake | MSQVQLNLDELKDFVKYMVTNNQHIQANGKVPVAVNIEGDAGL |
Ga0133913_110933242 | 3300010885 | Freshwater Lake | MSKKKIENSQVLLNVTEMKEFISHMVENNQYIQTQGKVPVAINIEGDAGLNSK* |
Ga0151654_10662951 | 3300011126 | Marine | MSKITQLNVDELKGFLKHMVTNNQYIQKEGKVPVAIN |
Ga0153799_10063337 | 3300012012 | Freshwater | MNQVQLNVDELKNFIKHMVKNNQHIQKEGKVPVAINIEGDAG |
Ga0153805_10014323 | 3300012013 | Surface Ice | MSQVQLNVEELKGFIKHMVGNNQHIQKEGKVPVAINIEXXXXXXX |
Ga0153805_10263822 | 3300012013 | Surface Ice | MNQVQLNVDELKNFIKHMVKNNQHIQKEGKVPVAINIE |
Ga0129338_14088541 | 3300012970 | Aqueous | MSQVQLNVEELKGFIKHMVNNNQHIQAQGKVPVAINIE |
Ga0164296_100363911 | 3300013093 | Freshwater | MSKSVQLNLDEIKDFVKFMVKNNQHIQAQGKVPVAINIEGDAGLNSK* |
(restricted) Ga0172364_108713431 | 3300013129 | Sediment | MSQVQLNVEELKSFIKHMVDNNQHIQAQGKVPVAINIEGDAG |
(restricted) Ga0172375_108690741 | 3300013137 | Freshwater | MNNVVKLNLDELKAFLRHIVANNQHIQKEGKIPVAVNIEGEAGLGKTSSLLQLAEE |
Ga0177922_102920372 | 3300013372 | Freshwater | MSANQVNLNTDELKTFIGHIVKNNQHIQTEGKIPVAVNIEGEAGIGKTTTILQ |
Ga0177922_112023822 | 3300013372 | Freshwater | MSANQVNLNTDELKTFIGHIVKNNQHIQTEGKIPVAVNIEGEAGIGKTTT |
Ga0119960_10231181 | 3300014811 | Aquatic | MNQVQLNVEELKDFIKHMVGNNQHIQAQGKVPVATVMDRDWE |
Ga0181338_10557671 | 3300015050 | Freshwater Lake | MNQVQLNVEELKSFIKHMVGNNQHIQAEGKVPVAINIEGDAGLGKTSAIM |
Ga0181339_10364891 | 3300017700 | Freshwater Lake | MNQVQLNVEELKSFIKHMVGNNQHIQAEGKVPVAINIEGDAGL |
Ga0181363_10760531 | 3300017707 | Freshwater Lake | MSQVKLNVDELKGYLKHMVSNNQYLQAKGKIPVAVNIEGDAGLGKTSSLMQLASELNMS |
Ga0181352_10071451 | 3300017747 | Freshwater Lake | MSQVQLNLDELKDFVKYMVTNNQHIQANGKVPVAINVEGDAGLGKTSSVKQLAAELNMDIIRLNLAEFEEL |
Ga0181352_11367591 | 3300017747 | Freshwater Lake | MSQVQLNVEELKGFLKHIVNNNQYIQAEGKVPVAINVEGD |
Ga0181352_11695361 | 3300017747 | Freshwater Lake | MSQVQLNVEELKGFIKHMVNNNQHIQAQGKVPVAINI |
Ga0181344_11915552 | 3300017754 | Freshwater Lake | MNQVQLNVEELKDFIKHMVGNNQHIQAQGKVPVAINIEGDAGLGKT |
Ga0181356_12457561 | 3300017761 | Freshwater Lake | MSQVQLNVEELKGFIKHMVGNNQHIQKEGKVPVAINIEGDAGLGKTSAIMQ |
Ga0181343_11429391 | 3300017766 | Freshwater Lake | MSQVQLNVDELKSFMGHMVKNNQYIQSQGKIPVTVNISGDAGL |
Ga0181349_12020012 | 3300017778 | Freshwater Lake | MNQVQLNVEELKSFIKHMVGNNQHIQAEGKVPVAINIEG |
Ga0181346_13252121 | 3300017780 | Freshwater Lake | MSQVQLNVEELKGFIKHMVGNNQHIQKEGKVPVAINIEGDAGLGK |
Ga0194029_10429113 | 3300019751 | Freshwater | MSDQTQLNVGELKDFIKHMVKNNQHIQAEGKVPVAINIEGD |
Ga0181361_1041622 | 3300019783 | Freshwater Lake | MSQVQLNVEELKNFIKHMVNNNQIIQKDGKVPVAI |
Ga0181361_1109841 | 3300019783 | Freshwater Lake | MSQVQLNVEELKGFIKHMVGNNQHIQKEGKVPVAINIEGDA |
Ga0181359_11337622 | 3300019784 | Freshwater Lake | MNQVQLNVEELKSFIKHMVGNNQHIQAEGKVPVAINIEGDAGLGKTSAIMHLFLL |
Ga0194132_101984672 | 3300020214 | Freshwater Lake | MAQVQLNIEELKDFLGHMVTNNQYIQTQGKVPVAVNIEGDAGLGKTSSLMQLAAEMNMAVIK |
Ga0208090_10016433 | 3300020513 | Freshwater | MSQVQLNVEELKDFIKHMVKNNQHIQSEGKVPVAVNIEGDAGLNSK |
Ga0208486_10239522 | 3300020556 | Freshwater | MSQVQLNVEELKSFIKHMVKNNQHIQSEGKVPVAINIEGDAGL |
Ga0194055_100009381 | 3300021079 | Anoxic Zone Freshwater | MSQVQLNLDELKDFVKYMVTNNQHIQANGKVPVAVNIEGDAGLGKTSSVKQLASELNMDMIRLNLAEFEELGDL |
Ga0212025_10860021 | 3300022057 | Aqueous | MSTVQLNVDELKGFIRHMVKNNQHIQAEGKVPVAI |
Ga0181337_10260702 | 3300022173 | Freshwater Lake | MNQVQLNVEELKSFIKHMVGNNQHIQAEGKVPVAINID |
Ga0224502_100526292 | 3300022218 | Sediment | MSNQTQLNVEELKTFIKHMVNNNQHIQKEGKVPVAINIEGDAGLNSK |
Ga0255772_105360552 | 3300023176 | Salt Marsh | MSQVQLNTDELKSFLKHIVKNNQFLQTEGKIPVAVNIEGPAGIG |
(restricted) Ga0255051_103798072 | 3300024057 | Seawater | MSKITQLNVDELKGFLKHMVNNNQYIQKEGKVPVA |
Ga0210003_12449412 | 3300024262 | Deep Subsurface | MNTVQLNVEELKGFIRHMVKNNQHIQAEGKVPVAINIEGDAGLGKTSAI |
Ga0255224_10546841 | 3300024483 | Freshwater | MNTVQLNAEELKSFIKHMVTNNQHIQAQGKVPVAVNIEGDAGLGKTSTILQLGKEL |
(restricted) Ga0255046_106511361 | 3300024519 | Seawater | MNQLQLNVDEMKTFIKHMVSNNQYIQETGKVPVAINVEGEAG |
Ga0256299_11008172 | 3300024533 | Freshwater | MSQVQLNVNELKSFIKHMVKNNQHIQSEGKVPVAINIEGDAGLGKTSAI |
Ga0208018_1325411 | 3300025057 | Marine | MSDQTQLNVKELKDFIKHMVKNNQHIQAEGKVPVAINIEGDAGL |
Ga0208794_10002021 | 3300025093 | Marine | MSNSTQLNVDELKDFLKHMVKNNQHIQNEGKVPVAVNIEGDAGLGKTSA |
Ga0208019_11154043 | 3300025687 | Aqueous | MAQVKLNIDDLKNFMGHMVKNNQHIQAQGKVPVAVNIEGEAGLGKTSSILQLAKEMDMAV |
Ga0208784_10222884 | 3300025732 | Aqueous | MSQVQLNLDELKDFVKYMVTNNQHIQANGKVPVAVNIEGDAGLNSK |
Ga0208784_10440842 | 3300025732 | Aqueous | MSQVQLNVEELKSFIKHMVNNNQHIQAQGKVPVAINIEGDAGLNSK |
Ga0208783_101041963 | 3300025872 | Aqueous | EELKGFIRHMVANNQYIQSQGKVPVAINIEGDAGLNSK |
Ga0208438_100027823 | 3300027196 | Estuarine | MSQVKLNVDELKDFVKHIVSNNQFIQAQGKVPVTVNIAG |
Ga0209247_10039004 | 3300027468 | Freshwater Lake | MNQVQLNVEELKSFIKHMVGNNQHIQAEGKVPVAINIE |
Ga0209247_10543081 | 3300027468 | Freshwater Lake | MSQVQLNVEELKGFIKHMVGNNQHIQKEGKVPVAINIEG |
(restricted) Ga0247836_10934393 | 3300027728 | Freshwater | MNNVVKLNLDELKDFLRHIVVNNQHIQKEGKIPVAVNIEGEAGLNSK |
(restricted) Ga0247836_11714232 | 3300027728 | Freshwater | MSQVQLNVNELKDFIKHMVKNNQHIQSEGKVPVAINIEGDAGLNSK |
Ga0209768_100335256 | 3300027772 | Freshwater Lake | MSQVQLNVEELKDFIKHMVGNNQHIQAEGKVPVAINIASNKIPIGL |
Ga0209829_100080537 | 3300027777 | Freshwater Lake | MSKKKIENSQVLLNVTEMKEFISHMVENNQYIQTQGKIPVAINIEGDAGLNSK |
Ga0209246_100549263 | 3300027785 | Freshwater Lake | MSQVQLNVEELKDFIKHMVGNNQHIQAEGKVPVAINIE |
Ga0209246_103299171 | 3300027785 | Freshwater Lake | MSQVQLNVEELKNFIKHMVNNNQIIQKDGKVPVAINIEG |
Ga0209107_100891153 | 3300027797 | Freshwater And Sediment | MSQVQLNVEELKGFIKHMVGNNQHIQKEGKVPVAINIEGD |
Ga0209358_100264387 | 3300027804 | Freshwater Lake | MNTVQLNVDELKGFIRHMVKNNQHIQSEGKVPVAINIEG |
Ga0209358_100304828 | 3300027804 | Freshwater Lake | MSQVQLNVDELKNFIKHMVKNNQHIQSEGKVPVAINIEGDAG |
Ga0209354_102189121 | 3300027808 | Freshwater Lake | MSANQVNLNTDELKTFIGHIVKNNQHIQTEGKIPVA |
Ga0209990_104461642 | 3300027816 | Freshwater Lake | MAQVQLNIEELKDFLGHMVKNNQYIQTQGKVPVAVNIEGDAGLGK |
Ga0209668_100363683 | 3300027899 | Freshwater Lake Sediment | MSRKKVENSQVLLNVDELKDFIKHMVTNNQHIQKEGKVPVAINIEGDAGLNSK |
Ga0209079_100710602 | 3300027972 | Freshwater Sediment | MSQVQLNVEELKNFIKHMVKNNQHIQSEGKVPVAINIEGDAGL |
(restricted) Ga0247840_103544401 | 3300028581 | Freshwater | MNTVQLNVEELKGFIRHMVKNNQHIQTEGKVPVAINIEGDAGLNSK |
Ga0135212_10104362 | 3300029306 | Marine Harbor | MSTQLNVDELKDFLKHMVKNNQHIQNEGKVPVAVTLVIVTGK |
Ga0315293_100797303 | 3300031746 | Sediment | MSQVQLNLDELKDFVKYMVTNNQHIQSIGKVPVAINVEGDAGLNSK |
Ga0315293_106947231 | 3300031746 | Sediment | MNQVKLNVEELKNFIKHMINNNQHIQAEGKVPVAINVEGNAGLGKTLLYLR |
Ga0315293_110161321 | 3300031746 | Sediment | MNQVQLNVEELKSFIKHMVGNNQHIQAEGKVPVAINIEGDAGLGKTSA |
Ga0315293_112847512 | 3300031746 | Sediment | MNQVQLNVEELKSFIKHMVGNNQHIQKDGKVPVAINIEGDAGTLPSF |
Ga0315907_107004552 | 3300031758 | Freshwater | MNTVQLNAEELKGFIRHMVNNNQHIQAQGKVPVAVNIEGDAGLGKTSTILQLGKELGM |
Ga0315899_101707411 | 3300031784 | Freshwater | MNTVQLNVDELKGFIRHMVKNNQHIQSEGKVPVAI |
Ga0315900_107657032 | 3300031787 | Freshwater | MSQVQLNVEELKNFIKHMVKNNQHIQSEGKVPVAINIEG |
Ga0315290_106058742 | 3300031834 | Sediment | MSQVQLNVEELKGFIKHMVGNNQHIQKEGKIPVAINIEGD |
Ga0315320_100752861 | 3300031851 | Seawater | MSKITQLNVDELKGFLKHMVTNNQYIQKEGKVPVAINI |
Ga0315909_104524431 | 3300031857 | Freshwater | MAQVNVNTNELKTFVTHIVKNNQHIQAEGKIPVAVNIEGEA |
Ga0315904_1004047210 | 3300031951 | Freshwater | MSQVQLNVDELKNFIKHMVKNNQHIQSEGKVPVAINIE |
Ga0315904_104850922 | 3300031951 | Freshwater | MNTVQLNAEELKGFIRHMVNNNQHIQAQGKVPVAVNIEGDAGLGKTSTILQLG |
Ga0315901_107326551 | 3300031963 | Freshwater | MSQVQLNVDELKSFIKHMVKNNQHIQSEGKVPVAINIEGDAGL |
Ga0315274_118337622 | 3300031999 | Sediment | MSQVQLNVEELKSFIKHMVNNNQYIQAEGKVPVAINIEGDAGLGKTSA |
Ga0315289_113316881 | 3300032046 | Sediment | MSKSVQLNLDEIKDFVKFMVKNNQHIQSQGKIPVAINIEGDAGLGKTSSVKQLSKELNMDVIRLNLAEFEEL |
Ga0315906_106829062 | 3300032050 | Freshwater | MSQVQLNVDELKSFIKHMVKNNQHIQSEGKVPVAINIEGDAGLGKTSAI |
Ga0315905_105531722 | 3300032092 | Freshwater | MNQVQLNVDELKNFIKHMVKNNQHIQSEGKVPVAINIEGDAGLGKT |
Ga0315903_104540051 | 3300032116 | Freshwater | MNTVQLNAEELKGFIRHMVNNNQHIQAQGKVPVAVNIEGDAGLGKTSTILQLGKELGMDVVK |
Ga0315903_109281151 | 3300032116 | Freshwater | MSQVQLNIDELKSFLGHMVKNNQHIQTKGKVPVAVN |
Ga0315268_115673012 | 3300032173 | Sediment | MSQVQLNVEELKGFIKHMVDNNQHIQKEGKVPVAINIEG |
Ga0316616_1018419372 | 3300033521 | Soil | MNTVQLNAEELKGFIRHMVNNNQHIQAQGKVPVAVNIEGDAGLGKTSTILQLGKELGMDV |
Ga0316617_1001353634 | 3300033557 | Soil | MNTVQLNAEELKSFIKHMVNNNQHIQAQGKVPVAVNIEGDAGLGKTSTILQLG |
Ga0334981_0321576_3_110 | 3300033980 | Freshwater | MNQVQLNVNELKDFIKHMVNNNQHIQAEGKVPVAIN |
Ga0334995_0793098_3_125 | 3300034062 | Freshwater | MNTVQLNAEELKGFIKHMVTNNQHIQAQGKVPVAVNIEGDA |
Ga0335000_0563310_80_220 | 3300034063 | Freshwater | MNQVQLNVNELKDFIKHMVKNNQHIQSEGKVPVAVNIEGDAGLNSK |
Ga0335030_0030728_2_139 | 3300034103 | Freshwater | MSQVQLNVEELKGFLKHIVNNNQYIQAEGKVPVAINVEGDAGLGKT |
Ga0335031_0000141_58094_58234 | 3300034104 | Freshwater | MNQVQLNVNELKDFIKHMVSNNQHIQAEGKVPVAVNIEGDAGLNSK |
Ga0335050_0391085_492_626 | 3300034108 | Freshwater | QVQLNVEELKDFIKHMVKNNQHIQSEGKVPVAVNIEGDAGLNSK |
Ga0335052_0042174_2692_2832 | 3300034279 | Freshwater | MNQVQLNVNELKDFIKHMVSNNQHIQAEGKVPVAVNIEGDAGLGKTS |
Ga0335013_0090585_3_119 | 3300034284 | Freshwater | MNTVQLNVEELKGFIRHMVKNNQHIQAEGKVPVAINIEG |
Ga0335048_0433022_3_119 | 3300034356 | Freshwater | MSANQVNLNTDELKTFIGHIVKNNQHIQTEGKIPVAVNI |
⦗Top⦘ |