Metagenome Family F049048

Basic Information
Family ID	F049048
Family Type	Metagenome
Number of Sequences	147
Average Sequence Length	41 residues
Representative Sequence	HRHSGVVLVSNFFLGLHVPRVKETPSLGFSGEGLLLSEV
Number of Associated Samples	68
Number of Associated Scaffolds	144

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	14.58 %
% of genes near scaffold ends (potentially truncated)	96.60 %
% of genes from short scaffolds (< 2000 bps)	97.96 %
Associated GOLD sequencing projects	68
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.31

Most Common Taxonomy
Group	Unclassified (100.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (88.435 % of family members)
Environment Ontology (ENVO)	Unclassified (91.837 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (91.837 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 26.87% β-sheet: 0.00% Coil/Unstructured: 73.13%
Feature Viewer

Powered by Feature Viewer

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	100.00 %

Scaffold	Taxonomy	Length	IMG/M Link
3300005718\|Ga0068866_11326784	Not Available	524	Open in IMG/M
3300005840\|Ga0068870_10591677	Not Available	753	Open in IMG/M
3300005840\|Ga0068870_10882302	Not Available	630	Open in IMG/M
3300006237\|Ga0097621_102354302	Not Available	510	Open in IMG/M
3300011119\|Ga0105246_10964175	Not Available	769	Open in IMG/M
3300013296\|Ga0157374_12322828	Not Available	563	Open in IMG/M
3300013297\|Ga0157378_11429173	Not Available	735	Open in IMG/M
3300013297\|Ga0157378_12436263	Not Available	575	Open in IMG/M
3300013297\|Ga0157378_12442853	Not Available	574	Open in IMG/M
3300013297\|Ga0157378_13187670	Not Available	509	Open in IMG/M
3300015267\|Ga0182122_1046003	Not Available	572	Open in IMG/M
3300015267\|Ga0182122_1062040	Not Available	525	Open in IMG/M
3300015268\|Ga0182154_1023588	Not Available	688	Open in IMG/M
3300015268\|Ga0182154_1025674	Not Available	673	Open in IMG/M
3300015268\|Ga0182154_1047292	Not Available	571	Open in IMG/M
3300015269\|Ga0182113_1020703	Not Available	792	Open in IMG/M
3300015269\|Ga0182113_1038035	Not Available	667	Open in IMG/M
3300015269\|Ga0182113_1067864	Not Available	562	Open in IMG/M
3300015269\|Ga0182113_1070835	Not Available	555	Open in IMG/M
3300015269\|Ga0182113_1080894	Not Available	533	Open in IMG/M
3300015274\|Ga0182188_1017788	Not Available	696	Open in IMG/M
3300015275\|Ga0182172_1061818	Not Available	537	Open in IMG/M
3300015277\|Ga0182128_1077217	Not Available	507	Open in IMG/M
3300015279\|Ga0182174_1027404	Not Available	700	Open in IMG/M
3300015281\|Ga0182160_1018975	Not Available	762	Open in IMG/M
3300015281\|Ga0182160_1021318	Not Available	739	Open in IMG/M
3300015282\|Ga0182124_1013678	Not Available	826	Open in IMG/M
3300015283\|Ga0182156_1043251	Not Available	620	Open in IMG/M
3300015286\|Ga0182176_1015496	Not Available	863	Open in IMG/M
3300015286\|Ga0182176_1040627	Not Available	637	Open in IMG/M
3300015286\|Ga0182176_1040627	Not Available	637	Open in IMG/M
3300015286\|Ga0182176_1052709	Not Available	587	Open in IMG/M
3300015286\|Ga0182176_1081806	Not Available	510	Open in IMG/M
3300015287\|Ga0182171_1029135	Not Available	692	Open in IMG/M
3300015287\|Ga0182171_1040755	Not Available	631	Open in IMG/M
3300015287\|Ga0182171_1050029	Not Available	596	Open in IMG/M
3300015287\|Ga0182171_1060812	Not Available	563	Open in IMG/M
3300015288\|Ga0182173_1049483	Not Available	593	Open in IMG/M
3300015288\|Ga0182173_1084699	Not Available	505	Open in IMG/M
3300015289\|Ga0182138_1014987	Not Available	830	Open in IMG/M
3300015289\|Ga0182138_1049482	Not Available	599	Open in IMG/M
3300015291\|Ga0182125_1037974	Not Available	658	Open in IMG/M
3300015292\|Ga0182141_1029642	Not Available	705	Open in IMG/M
3300015292\|Ga0182141_1034517	Not Available	675	Open in IMG/M
3300015295\|Ga0182175_1060762	Not Available	583	Open in IMG/M
3300015296\|Ga0182157_1020646	Not Available	804	Open in IMG/M
3300015296\|Ga0182157_1046877	Not Available	638	Open in IMG/M
3300015300\|Ga0182108_1106074	Not Available	503	Open in IMG/M
3300015302\|Ga0182143_1035845	Not Available	692	Open in IMG/M
3300015302\|Ga0182143_1073599	Not Available	561	Open in IMG/M
3300015303\|Ga0182123_1050602	Not Available	611	Open in IMG/M
3300015304\|Ga0182112_1021709	Not Available	799	Open in IMG/M
3300015304\|Ga0182112_1050770	Not Available	628	Open in IMG/M
3300015305\|Ga0182158_1054223	Not Available	613	Open in IMG/M
3300015308\|Ga0182142_1033430	Not Available	729	Open in IMG/M
3300015308\|Ga0182142_1052512	Not Available	640	Open in IMG/M
3300015308\|Ga0182142_1055480	Not Available	630	Open in IMG/M
3300015308\|Ga0182142_1081908	Not Available	560	Open in IMG/M
3300015314\|Ga0182140_1019536	Not Available	850	Open in IMG/M
3300015314\|Ga0182140_1077079	Not Available	572	Open in IMG/M
3300015314\|Ga0182140_1097505	Not Available	531	Open in IMG/M
3300015314\|Ga0182140_1107494	Not Available	515	Open in IMG/M
3300015321\|Ga0182127_1025050	Not Available	819	Open in IMG/M
3300015321\|Ga0182127_1108951	Not Available	525	Open in IMG/M
3300015322\|Ga0182110_1113455	Not Available	518	Open in IMG/M
3300015323\|Ga0182129_1040288	Not Available	690	Open in IMG/M
3300015341\|Ga0182187_1069105	Not Available	733	Open in IMG/M
3300015341\|Ga0182187_1104730	Not Available	635	Open in IMG/M
3300015341\|Ga0182187_1145403	Not Available	566	Open in IMG/M
3300015342\|Ga0182109_1117367	Not Available	641	Open in IMG/M
3300015343\|Ga0182155_1194428	Not Available	531	Open in IMG/M
3300015344\|Ga0182189_1065316	Not Available	797	Open in IMG/M
3300015344\|Ga0182189_1102490	Not Available	679	Open in IMG/M
3300015345\|Ga0182111_1224320	Not Available	520	Open in IMG/M
3300015346\|Ga0182139_1058937	Not Available	859	Open in IMG/M
3300015346\|Ga0182139_1065146	Not Available	829	Open in IMG/M
3300015346\|Ga0182139_1139962	Not Available	625	Open in IMG/M
3300015346\|Ga0182139_1192645	Not Available	553	Open in IMG/M
3300015347\|Ga0182177_1123519	Not Available	658	Open in IMG/M
3300015347\|Ga0182177_1240314	Not Available	509	Open in IMG/M
3300015351\|Ga0182161_1053851	Not Available	934	Open in IMG/M
3300015351\|Ga0182161_1153503	Not Available	628	Open in IMG/M
3300015351\|Ga0182161_1243390	Not Available	522	Open in IMG/M
3300015355\|Ga0182159_1343616	Not Available	507	Open in IMG/M
3300015361\|Ga0182145_1106908	Not Available	615	Open in IMG/M
3300015361\|Ga0182145_1121055	Not Available	590	Open in IMG/M
3300017407\|Ga0182220_1070637	Not Available	569	Open in IMG/M
3300017407\|Ga0182220_1084682	Not Available	540	Open in IMG/M
3300017407\|Ga0182220_1098191	Not Available	517	Open in IMG/M
3300017410\|Ga0182207_1050484	Not Available	760	Open in IMG/M
3300017410\|Ga0182207_1154372	Not Available	526	Open in IMG/M
3300017411\|Ga0182208_1057438	Not Available	647	Open in IMG/M
3300017411\|Ga0182208_1085896	Not Available	573	Open in IMG/M
3300017413\|Ga0182222_1050481	Not Available	614	Open in IMG/M
3300017415\|Ga0182202_1048427	Not Available	703	Open in IMG/M
3300017417\|Ga0182230_1090569	Not Available	559	Open in IMG/M
3300017420\|Ga0182228_1043278	Not Available	756	Open in IMG/M
3300017420\|Ga0182228_1057820	Not Available	675	Open in IMG/M
3300017420\|Ga0182228_1086825	Not Available	581	Open in IMG/M
3300017424\|Ga0182219_1076411	Not Available	608	Open in IMG/M
3300017424\|Ga0182219_1081108	Not Available	597	Open in IMG/M
3300017424\|Ga0182219_1087907	Not Available	582	Open in IMG/M
3300017424\|Ga0182219_1097825	Not Available	564	Open in IMG/M
3300017424\|Ga0182219_1133643	Not Available	510	Open in IMG/M
3300017425\|Ga0182224_1059895	Not Available	695	Open in IMG/M
3300017425\|Ga0182224_1111127	Not Available	573	Open in IMG/M
3300017425\|Ga0182224_1163464	Not Available	504	Open in IMG/M
3300017425\|Ga0182224_1167420	Not Available	500	Open in IMG/M
3300017427\|Ga0182190_1037184	Not Available	831	Open in IMG/M
3300017430\|Ga0182192_1036099	Not Available	858	Open in IMG/M
3300017430\|Ga0182192_1074072	Not Available	675	Open in IMG/M
3300017430\|Ga0182192_1082807	Not Available	650	Open in IMG/M
3300017433\|Ga0182206_1032651	Not Available	826	Open in IMG/M
3300017433\|Ga0182206_1090675	Not Available	603	Open in IMG/M
3300017436\|Ga0182209_1037618	Not Available	815	Open in IMG/M
3300017436\|Ga0182209_1046496	Not Available	764	Open in IMG/M
3300017436\|Ga0182209_1083268	Not Available	638	Open in IMG/M
3300017436\|Ga0182209_1083268	Not Available	638	Open in IMG/M
3300017436\|Ga0182209_1139454	Not Available	541	Open in IMG/M
3300017436\|Ga0182209_1173099	Not Available	502	Open in IMG/M
3300017438\|Ga0182191_1126647	Not Available	570	Open in IMG/M
3300017442\|Ga0182221_1054226	Not Available	716	Open in IMG/M
3300017442\|Ga0182221_1088878	Not Available	616	Open in IMG/M
3300017442\|Ga0182221_1119523	Not Available	562	Open in IMG/M
3300017443\|Ga0182193_1023138	Not Available	1010	Open in IMG/M
3300017443\|Ga0182193_1133651	Not Available	576	Open in IMG/M
3300017680\|Ga0182233_1031768	Not Available	931	Open in IMG/M
3300017682\|Ga0182229_1088763	Not Available	542	Open in IMG/M
3300017682\|Ga0182229_1101514	Not Available	512	Open in IMG/M
3300017684\|Ga0182225_1115196	Not Available	540	Open in IMG/M
3300017685\|Ga0182227_1060000	Not Available	688	Open in IMG/M
3300017685\|Ga0182227_1072007	Not Available	640	Open in IMG/M
3300017685\|Ga0182227_1107706	Not Available	549	Open in IMG/M
3300017685\|Ga0182227_1122558	Not Available	523	Open in IMG/M
3300017690\|Ga0182223_1021287	Not Available	811	Open in IMG/M
3300017690\|Ga0182223_1051460	Not Available	642	Open in IMG/M
3300017690\|Ga0182223_1051460	Not Available	642	Open in IMG/M
3300021060\|Ga0182232_1036426	Not Available	833	Open in IMG/M
3300021060\|Ga0182232_1041652	Not Available	772	Open in IMG/M
3300021060\|Ga0182232_1043569	Not Available	751	Open in IMG/M
3300021060\|Ga0182232_1085566	Not Available	511	Open in IMG/M
3300021060\|Ga0182232_1086858	Not Available	507	Open in IMG/M
3300026089\|Ga0207648_11853659	Not Available	565	Open in IMG/M
3300026861\|Ga0207503_1011945	Not Available	548	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	99.32%
Environmental	Environmental	0.68%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	99.32%
Terrestrial	Environmental → Terrestrial	0.68%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	91.84%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.08%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.72%
Soil	Environmental → Terrestrial → Soil	0.68%
Roots	Host-Associated → Plants → Roots	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	91.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.08%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.72%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	0.68%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	91.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.08%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.72%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.68%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.68%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	88.44%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.40%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	3.40%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.68%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026861	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-12 (SPAdes)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068866_113267842	3300005718	Miscanthus Rhizosphere	VVYRHSGVVLVLNFFLGLHVPRVKKTPSLGFSGEGLLLSE
Ga0068870_105916771	3300005840	Miscanthus Rhizosphere	VVLVSKLFSGLHVPRVKETPSLGFSEDGLLLSEV*
Ga0068870_108823021	3300005840	Miscanthus Rhizosphere	MVYRHSDIVLVLNVFLGLHVPRVKETPSLGFFGEGLLLSEV*
Ga0097621_1023543021	3300006237	Miscanthus Rhizosphere	INVSVVHWHFGVVLVSNFFLDLHVPHVNETPSLGFSEEGLLLSEV*
Ga0105246_109641751	3300011119	Miscanthus Rhizosphere	SGNVLVSKLFSGLHVPRVKETPSLGFSGEGWLLSEV*
Ga0157374_123228281	3300013296	Miscanthus Rhizosphere	LYTYVIKVSVVHRHSGVVLVSKLFSGLHVPHVKETPSLGFFGDGLLLSEV*
Ga0157378_114291731	3300013297	Miscanthus Rhizosphere	KVSVVHRHFGVVLVSNFFLGLHVPRVKETPSLGFSEEGLLLSEV*
Ga0157378_124362631	3300013297	Miscanthus Rhizosphere	HSGAILVSNFFLGLHMPWVKETPSLGFSGDGLLLSEV*
Ga0157378_124428531	3300013297	Miscanthus Rhizosphere	VIKVSVVYRHSGVVLVLNFFLGLHMPRVKKTPSLGFSGEGLLLSED*
Ga0157378_131876702	3300013297	Miscanthus Rhizosphere	HSGVVLVLNIFLGLHVPLVTETLSLGFFGEGLLLSKV*
Ga0182122_10460031	3300015267	Miscanthus Phyllosphere	KVSMVRTHSDVVLVSNFFLGLHVLCVKETPSLGFSKDGLLLSEV*
Ga0182122_10620401	3300015267	Miscanthus Phyllosphere	HSGIVLVSNFFSGLHVPRAKETPSLGFFGYGLLLSEV*
Ga0182154_10235881	3300015268	Miscanthus Phyllosphere	SVVHRHSDVVFISNFFLRLHGPRVKETPSLGFSGDGLLLYEV*
Ga0182154_10256741	3300015268	Miscanthus Phyllosphere	VIKVSVVHTHSGIVLVSNFFLGLHVSRVKETPNLEFFRDDLLPSEV*
Ga0182154_10472921	3300015268	Miscanthus Phyllosphere	VVHRHSGVVLVSKLFLSLHMPLVMEAPSLGFSGDGMLLSE
Ga0182113_10207031	3300015269	Miscanthus Phyllosphere	VVHTHSGVVLVSNFFLGLHVPRAKETPSLGFFGDSLLLSEV*
Ga0182113_10380351	3300015269	Miscanthus Phyllosphere	IKVYVVRTYSGVVFVPNLFFGLHVLRVKETLSLGFFGDGLLLSEV*
Ga0182113_10678641	3300015269	Miscanthus Phyllosphere	SHSGIVLVSNFFLGLHVPRVKETPSLGFSRDGLLLSDV*
Ga0182113_10708351	3300015269	Miscanthus Phyllosphere	VPRYSGVVFVSIFFYGLHVPRVKETPSLGFPGDGLLLSKV*
Ga0182113_10769301	3300015269	Miscanthus Phyllosphere	TKNIHSGVILLSKLFSGLHVPRVKETPSLGFFGDGLLLSEV*
Ga0182113_10808941	3300015269	Miscanthus Phyllosphere	VSVVHTLSGVVLVSNFFLGLHVPCVKETSSLGFSGDSFLLSEV*
Ga0182188_10177881	3300015274	Miscanthus Phyllosphere	VASVTNLFLGLHVPWVKETPSLRFSEDGLLLSEV*
Ga0182172_10618181	3300015275	Miscanthus Phyllosphere	MVHIHSGVILVSNFFLGLHVPHVKETPSLRFFGDGLLLS
Ga0182128_10772171	3300015277	Miscanthus Phyllosphere	MIHTHSDVVLVSNFFLGLHMPRVNETPSFGFFGDGLL
Ga0182174_10274041	3300015279	Miscanthus Phyllosphere	KVSVVDRHPDVVFVSNFFSSLHVPHVKETPSLGFFGDGLLFSEV*
Ga0182160_10189751	3300015281	Miscanthus Phyllosphere	VVYRHSGVVLVLNFFLGLHVPRVKKTPSLGFSGEGLLLS
Ga0182160_10213181	3300015281	Miscanthus Phyllosphere	FGVVLVSNVFLGLHVSRVMATPGFEFSVDGLLLSKV*
Ga0182124_10136781	3300015282	Miscanthus Phyllosphere	VSVVHWHSGVVLVSNFFLGLHIPRVKETTSLGFFEEGLLLSEV*
Ga0182156_10432511	3300015283	Miscanthus Phyllosphere	KVSIVHMHFDVASVTNLFLGLHVPWVKETPSLRFSEDGLLLSEV*
Ga0182176_10154961	3300015286	Miscanthus Phyllosphere	FGVVLVLNFFFGLHVSCVKETQSFGFSGYGLLLSEV*
Ga0182176_10406271	3300015286	Miscanthus Phyllosphere	VVHRHSGVILVSNFFLGLHVPRVKEALSLGFSEEDLLLSE
Ga0182176_10406272	3300015286	Miscanthus Phyllosphere	KVSVVHMHFDVALVSNFFSGLHVPWVKETPSLRFFEDGLLLSEV*
Ga0182176_10527091	3300015286	Miscanthus Phyllosphere	HRTMTIHIKVSLVRRNSGVVFVSYFFLDLHVSRVKETPSLGFFGDGLLLSEV*
Ga0182176_10818061	3300015286	Miscanthus Phyllosphere	HIGIKVSVVHMHFGIVLVSNFFLGLHVSRVKETSSLRFFGDGLLLSEV*
Ga0182171_10291351	3300015287	Miscanthus Phyllosphere	VHRHSSVVLVSNFFLDLHVPHVNETPSLGFFEEGLLLSEV*
Ga0182171_10407552	3300015287	Miscanthus Phyllosphere	VHMHSGVVLVSKFFSGLHMPRVKEPPSLGLFQDGLVLSAA*
Ga0182171_10500291	3300015287	Miscanthus Phyllosphere	VIKVFVVHRHSGVLLVSNFFLGLHMPRVKETPSLGFSGDGLLLYEV*
Ga0182171_10608121	3300015287	Miscanthus Phyllosphere	HRHSGVVLVSNFFLGLHVPRVKETPSLGFSGEGLLLSEV*
Ga0182173_10494831	3300015288	Miscanthus Phyllosphere	IMVSMVHMHSGVVLISNFFLGLHMPRVKETPSFRFLEDGLLLSEV*
Ga0182173_10846991	3300015288	Miscanthus Phyllosphere	VHRHSSVVLVSNFFLDLHVPHVNETPSLGFSEEGLLLSEV*
Ga0182138_10149871	3300015289	Miscanthus Phyllosphere	PVVHRHLYVIFFSNFFSSLHVPRVKETPSLGFSGDGLLLSEV*
Ga0182138_10494821	3300015289	Miscanthus Phyllosphere	VIKVSVVYRHSGVVLVLNIFLGLHVPLVTETLSLGFFGEGLLLSKV*
Ga0182125_10379741	3300015291	Miscanthus Phyllosphere	RYFGVVFILKILFALHVPRVKETTSLVFSRDGLLLSEV*
Ga0182141_10296421	3300015292	Miscanthus Phyllosphere	HSGVVLVSNFFLSLDVPRVKETPSLGFFGEGLLLSEV*
Ga0182141_10345171	3300015292	Miscanthus Phyllosphere	VLHRHSDIVFVSNFFLDLHMPRVKKTPSLGFSGDGLLLSE
Ga0182175_10607622	3300015295	Miscanthus Phyllosphere	MVHMHSGVVFVPNFFLGLHVPRVKETPSFGFSGDGLLLS
Ga0182157_10206461	3300015296	Miscanthus Phyllosphere	GVVLVSNFFLGLHVPRVKETPSLGFSGEGLLLSEV*
Ga0182157_10468771	3300015296	Miscanthus Phyllosphere	VHMHSGVVLVSNFFSGLHVPRVKETPSFGFFGDGLLLSEV*
Ga0182108_11060741	3300015300	Miscanthus Phyllosphere	VIKVSVVHMHSVVVLVSTFFLGLHMAREKETPSLGFSGDGLLLFEV*
Ga0182143_10358451	3300015302	Miscanthus Phyllosphere	MHSGVVLVSNFFSGLHMPRVKETPSFGFSGDGLLL
Ga0182143_10735991	3300015302	Miscanthus Phyllosphere	FSVVFISNFFLGLHVSRVKKTSSLGFFEDGLLLSEV*
Ga0182123_10506021	3300015303	Miscanthus Phyllosphere	HSGVVLVSNFFLGLHVPRVKETPSFGFFGDGLLLSEV*
Ga0182112_10217091	3300015304	Miscanthus Phyllosphere	MHSGVVLISNFFLGLHVSRVKETPSFGFSGDGLLLCEV*
Ga0182112_10507701	3300015304	Miscanthus Phyllosphere	IVLVSNFFLGLHVPCVKETPSLGFFGDDLLLCEV*
Ga0182158_10542231	3300015305	Miscanthus Phyllosphere	VVLVSNFFLGLHMPCVKETPSFGFSEDGLLLSEV*
Ga0182142_10334301	3300015308	Miscanthus Phyllosphere	VVFVSNFFLGLHVPHVKETPSLGFSRDGLLLSEV*
Ga0182142_10525121	3300015308	Miscanthus Phyllosphere	SMVHTHSGVILVSNFFLGLHVPRVNETPSLGFFGDGLLLSDV*
Ga0182142_10554801	3300015308	Miscanthus Phyllosphere	VHRHSDVVFISNFFLGLHVPHVKETPSLGFSGDGLLLSEV*
Ga0182142_10819081	3300015308	Miscanthus Phyllosphere	KVYVVHMHSGVVLVSNFFLGLHMPWVKETLSLGIFGVGLLLSEV*
Ga0182140_10195361	3300015314	Miscanthus Phyllosphere	MVYRHSSVVLVSNFFLGLHVPRVKKTPSLVFSGEGLLLSED*
Ga0182140_10770791	3300015314	Miscanthus Phyllosphere	SVVDMHSGLALVSNFFLALHVPWVKETPSLRFSKDGLLLSEV*
Ga0182140_10975051	3300015314	Miscanthus Phyllosphere	GVVFISNFFLGLHVTRVKKTSSLGFFGDGLLLSEV*
Ga0182140_11074941	3300015314	Miscanthus Phyllosphere	HSGVVFVSKLFSGLHVLRVKETPSLGFSRDGFLLSEV*
Ga0182127_10250501	3300015321	Miscanthus Phyllosphere	VHRHSGVVFISNFFLGLHVLCVKETSSLGFFRDGLLLSEV*
Ga0182127_11089511	3300015321	Miscanthus Phyllosphere	VIKVSVVHRHSSVVLVSKLFSGLHVPRVKETPSLVFFGDGLLLSEV*
Ga0182110_11134551	3300015322	Miscanthus Phyllosphere	MHFDVASVTNLFLGLHVPWVKETPSLRFSEDGLLL
Ga0182129_10402881	3300015323	Miscanthus Phyllosphere	TYVIKVSMVHTHSGVVVVSNFFLRLHVPCVKETPSSGFSRDGLQLYEL*
Ga0182187_10691051	3300015341	Miscanthus Phyllosphere	SMVYRHSSVVLVSNFFLGLHVPRVKKTPSLGFSGEGLLLSED*
Ga0182187_11047301	3300015341	Miscanthus Phyllosphere	VSVVHRHSGVVLVSKLFSGLHVPRVKETPSLGFFGDGLLLSEV*
Ga0182187_11454031	3300015341	Miscanthus Phyllosphere	VSVVLTHSGVVLVSNFFLGLHVPYVKETPSLGFFRDGLLLSEV*
Ga0182109_11173671	3300015342	Miscanthus Phyllosphere	CVVYRHSGVVLVLNFFLGLHVPRVKKTPSLGFSGEGLLLSED*
Ga0182155_11944281	3300015343	Miscanthus Phyllosphere	IMVSVVHRHSGVIFISNFFLGLHVPCVKETPSLGFSGDGLLLSEV*
Ga0182189_10653161	3300015344	Miscanthus Phyllosphere	SSVILVSNFFLDLHMTRVKEIPSLGFSRDGLLLSEV*
Ga0182189_11024901	3300015344	Miscanthus Phyllosphere	VIKVSVVHRHFGVVLISKLFLGLHVPRAKETPSLGFFGDGLLLF*
Ga0182111_12243201	3300015345	Miscanthus Phyllosphere	MHSGVVLGLNFFLGLHVPNVKETPSFGFFGDGLLLSEV*
Ga0182139_10589371	3300015346	Miscanthus Phyllosphere	VIKVSVVHMHSGVVLVSNFFLGLHMPRVKETPNLGFSGDGCYFLRFN*
Ga0182139_10651461	3300015346	Miscanthus Phyllosphere	KDYVVHRHSSVVLVSNFFLDLHVPHVNETPSLGFFEEGLLLSEV*
Ga0182139_11399621	3300015346	Miscanthus Phyllosphere	HFGVVLVSNFFLGLHVPRVNETLSLGFFGDGLLLSEV*
Ga0182139_11926451	3300015346	Miscanthus Phyllosphere	VSVVHRHSGVVLVLKLFSGLHVPRVKETPSLGFFRDGLVLSEV*
Ga0182177_11235191	3300015347	Miscanthus Phyllosphere	MVHTYSGVVLVSNFFLGFHVPWVKETPSLGFSENGLLLS
Ga0182177_12403141	3300015347	Miscanthus Phyllosphere	IHSGVALVSKLFSGLHVRQVKETPSLGFFGEGLPLSEV*
Ga0182161_10538511	3300015351	Miscanthus Phyllosphere	IKVSMVYRHSSVVLVSNFFLGLHVPRVKKTPSLVFSGEGLLLSED*
Ga0182161_11535031	3300015351	Miscanthus Phyllosphere	SGVVLISNFFLGLHVPRVKETRSSGFFGDGLLLSEV*
Ga0182161_12433901	3300015351	Miscanthus Phyllosphere	TYVIKVSVVHTHSSEILVSNFFLGLRVPRVKETPSLGFFGDGLLLSEV*
Ga0182159_13436161	3300015355	Miscanthus Phyllosphere	GVVLVSNFFLALHVPRVKETPSFGFFRDSLLLSEV*
Ga0182145_11069081	3300015361	Miscanthus Phyllosphere	SGLALVSNFFLALHVPWVKETPSLRFSKDGLLLSEV*
Ga0182145_11210551	3300015361	Miscanthus Phyllosphere	HSGVILVSNFFLGLHVPHVKETLSLGFFGEGLLLSEV*
Ga0182220_10706371	3300017407	Miscanthus Phyllosphere	VVHRHSGVVLVSNFFLGLHVPCVKETPSLGFSGEGLL
Ga0182220_10846822	3300017407	Miscanthus Phyllosphere	VVHMYSGVVLVSNFFLGLHMPRVKETPSLGFSGDGLLLSEVIKFLCDVTD
Ga0182220_10981911	3300017407	Miscanthus Phyllosphere	VIKVSMVHRHFGVVFILNFFSGLHMPRVKETPSLGFSGDGLLLLRFN
Ga0182207_10504841	3300017410	Miscanthus Phyllosphere	IKVSVVHTYSGVVLVSNFFLGLHVPRMKETPSLGFSEDDLLLSKV
Ga0182207_11543721	3300017410	Miscanthus Phyllosphere	YSGVIFVSIIFYGLHVPRVKETPSLGFPGDGLLLSEV
Ga0182208_10574381	3300017411	Miscanthus Phyllosphere	GVVLVSKLFSGLHVPCVKETPSLGFSRDGLLLSDV
Ga0182208_10858961	3300017411	Miscanthus Phyllosphere	VIKVSVIHRHFRVVFISNFFLGLHVLRVMGTQSLGFFGDGLLLSEV
Ga0182222_10504811	3300017413	Miscanthus Phyllosphere	SGVVLISNFFLGLHVPRVKETPSFGFFGDDLLLSEV
Ga0182202_10484271	3300017415	Miscanthus Phyllosphere	FLWFIRNSGVVLVSKFFLGLHVACVKESPSLGFFEDDLLLSKV
Ga0182230_10905691	3300017417	Miscanthus Phyllosphere	MVHTHSGVVVVSNFFLRLHVPCVKETPSSGFSRDGL
Ga0182230_11100661	3300017417	Miscanthus Phyllosphere	ICWTTTNIHSGVVLVLKLFSGLHVPRVKETPSLGFFGDGLLLSGV
Ga0182228_10432781	3300017420	Miscanthus Phyllosphere	SSVVLVSNFFLDLHVPHVNETPSLGFSEEGLLLSEV
Ga0182228_10578201	3300017420	Miscanthus Phyllosphere	VIKDSMVHIHSGVILVSKLFLGLHVPRVKETPSLGFSRDATF
Ga0182228_10868251	3300017420	Miscanthus Phyllosphere	VVHRHSGVVFVSNFFLGLHVPRVKETPSLGFFGDGL
Ga0182219_10764111	3300017424	Miscanthus Phyllosphere	VSVVHTHSGVVLVSNFLLDLHVPRVKETPSLDFFGDGLLLSEV
Ga0182219_10811081	3300017424	Miscanthus Phyllosphere	RHSGVVLVLNFFLGLHVPRVKKTPSLGFFGEGLLLSED
Ga0182219_10879071	3300017424	Miscanthus Phyllosphere	MVHMHSGAVLVLNFFLGFHMSRVKETPSLRFFGDGLLLSKV
Ga0182219_10978251	3300017424	Miscanthus Phyllosphere	HTYSGVILVLNFFLDLHVPRVKETPSLGFSGDGLLLYEL
Ga0182219_11336431	3300017424	Miscanthus Phyllosphere	IKVSVVHRHSGVVLVSNFFLGLCMPRVKETSSLGFFGDGLLLSEV
Ga0182224_10598951	3300017425	Miscanthus Phyllosphere	VVHRHSSVVLVSNFFLDLHVPHVNETPSLGFFEEGLLLSEV
Ga0182224_11111271	3300017425	Miscanthus Phyllosphere	VIKVSLVQRNSGVVFVSYFFLDLHVPRMKETPSSGFSRDGLLLSKV
Ga0182224_11634641	3300017425	Miscanthus Phyllosphere	QGFCGYRHSGVVFVSNFFLGLHGPRVKETPSLGFSGDGLLVYEV
Ga0182224_11674201	3300017425	Miscanthus Phyllosphere	KVSVVHRHSSVILVSNFFLDLHLPRVKETPSLGFSGDGLLLSKV
Ga0182190_10371841	3300017427	Miscanthus Phyllosphere	MVYRHSSVVLVSNFFLGLHVPCVKKTPSLGFSGEGLLLSED
Ga0182192_10360991	3300017430	Miscanthus Phyllosphere	VVYMHSGVVLVSNFFLGLHVPRVKETPSFGFSGDG
Ga0182192_10740721	3300017430	Miscanthus Phyllosphere	HSDVVLVSKFFLVLHVPRVKETPSLGFSGDSLLFSEV
Ga0182192_10828071	3300017430	Miscanthus Phyllosphere	VSVVHVHSDVVLVSNFFLGMHVPWVKETPMLRFSEDGLLLSEV
Ga0182206_10326511	3300017433	Miscanthus Phyllosphere	HFGVVLVSNFFLGLHVPRLKETPCLGFSEEGLLLSEV
Ga0182206_10906751	3300017433	Miscanthus Phyllosphere	VIKVSMVHMHSGVVLVSNFFLDLHVPRVKETPSFGFSRDGLLLSEV
Ga0182209_10376182	3300017436	Miscanthus Phyllosphere	VSVVHRHSGVVLVSNFFLGLHVPRVKEALSLGFSKEDLLLSEV
Ga0182209_10464961	3300017436	Miscanthus Phyllosphere	HRHFGVVLVSNFFLGLHVPRVKKTPSLGFSGDGLLLSEV
Ga0182209_10832681	3300017436	Miscanthus Phyllosphere	MHSGVVLVSNFFLSLHVPRVKKTPSFGFSEDGLLLFE
Ga0182209_10832682	3300017436	Miscanthus Phyllosphere	IKFYVVHMYFGVVLVSNFFLGLHMPQVKETPSLGFSGDGLLLSEV
Ga0182209_11394541	3300017436	Miscanthus Phyllosphere	YTQVINVSMVYRHSSVVLVSNFFLGLHIPRVKETPSLGFSRDGLPLSEV
Ga0182209_11730991	3300017436	Miscanthus Phyllosphere	SVVLVSNFFLGLHVSRVKETPSLGFFGDGLLLFEV
Ga0182191_11266471	3300017438	Miscanthus Phyllosphere	SGVVLVSNFFLGLHIPRVKETTSLGFFEEGLLLSEV
Ga0182221_10542261	3300017442	Miscanthus Phyllosphere	VINVSVVHWHSGVVLVSNFFLGLHVPRVKKTPSLGFSVEGLLLSEV
Ga0182221_10888782	3300017442	Miscanthus Phyllosphere	LKVSVVHMRSGVALVSNFFLGLHVPRVKETPSLGFSEDGLLLSAV
Ga0182221_11195231	3300017442	Miscanthus Phyllosphere	KVSVVYRHSDVVFVLNFFLGLHVTRVKETPSLRFSGDGLLLSKV
Ga0182193_10231381	3300017443	Miscanthus Phyllosphere	VHMHSGVVLVSNFFLGLHVPWVKETPSLRFPEDGFLLSEV
Ga0182193_11336511	3300017443	Miscanthus Phyllosphere	VVHRHFGVVLVSNFFLGLHVPRVKETPSLGFSEEGLLLSEV
Ga0182233_10317681	3300017680	Miscanthus Phyllosphere	VFVVHMHSGVRLVSKYFLGLHMPRVKETPSLGFSGDDLLLSEV
Ga0182233_10567901	3300017680	Miscanthus Phyllosphere	IALKIRATRNLHFNIALVSKLFSGLHVPRVKKTPSLGFSGDDLLFSNI
Ga0182229_10887631	3300017682	Miscanthus Phyllosphere	VSVVHMYSGVVLVSNFFLGLHVPYVKETLSLRFFGDGLLLSDV
Ga0182229_11015141	3300017682	Miscanthus Phyllosphere	GVVLVSNFFLGLHVPRVKETPSFGFSGDGLLLSKV
Ga0182225_11151961	3300017684	Miscanthus Phyllosphere	VHTHSGVVLVSHFFLGLHVPRVKETPSLGFSTDGLLLSKV
Ga0182227_10600001	3300017685	Miscanthus Phyllosphere	VHRYFDVVFVSNFLFGLHVPRVKETPSLGLSEDGLLLSKV
Ga0182227_10720071	3300017685	Miscanthus Phyllosphere	HSGVVFISNFFLGLHVPHVKETPSFGFFEDGLLLSEV
Ga0182227_11077061	3300017685	Miscanthus Phyllosphere	HSGVVLVSNFFLGLHVPRVNETPSLGFSEDGLLLSEV
Ga0182227_11225581	3300017685	Miscanthus Phyllosphere	IKVSVVHRHSGVVLVSNFFLGLHVPRVKEALSLGFSKEDLLLSEV
Ga0182223_10212871	3300017690	Miscanthus Phyllosphere	YFGVVFISNFLFGLHVPRVKETPSLVFFGDGLLLSKV
Ga0182223_10514601	3300017690	Miscanthus Phyllosphere	MHSGVVLVSNFFLGLHMPWEKETPSLGFSGDGLLLSEV
Ga0182223_10514602	3300017690	Miscanthus Phyllosphere	VVDRYSGVVLVLNFFLGLHVPHVKETPSLGFFRDGLLLSKKSQTWCFLH
Ga0182232_10364262	3300021060	Phyllosphere	VIKVSVVHRHSSVVLVSNFFLDLHVPHVNETPSLGFSEEGMLLSEV
Ga0182232_10416521	3300021060	Phyllosphere	MVYRHSSVVLVSNFFLGLHVPRVKKTPSLVFSGEGLLL
Ga0182232_10435691	3300021060	Phyllosphere	VIKVCVVYRHSGVVLVLNFFLGLHVPRVKKTPSLGFSGEGLLLSED
Ga0182232_10855661	3300021060	Phyllosphere	INVSVVHWHSGVVLVSNFFLGLHVPRVKEALSLGFSKEDLLLSEV
Ga0182232_10868581	3300021060	Phyllosphere	VIKVYSVYTHSGAILVSNFFLGLHVPRVKETSSLRFFGDGLLLSEV
Ga0207648_118536591	3300026089	Miscanthus Rhizosphere	VIKVSVVHRRSGVVLVSNFFLGLHVPRVKEALSLGFSKEDLLLSEV
Ga0207503_10119451	3300026861	Soil	MYSGVVLVSNFFLGLHMPRVKETPSLGFSEDGLLLSHI

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.31
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.31
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F049048

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign