Basic Information | |
---|---|
Family ID | F049114 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 147 |
Average Sequence Length | 43 residues |
Representative Sequence | MKKLKPHTVDWAQIERFLASADKKLASAHKILAFDEEACLQ |
Number of Associated Samples | 133 |
Number of Associated Scaffolds | 147 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 46.26 % |
% of genes near scaffold ends (potentially truncated) | 76.87 % |
% of genes from short scaffolds (< 2000 bps) | 87.07 % |
Associated GOLD sequencing projects | 129 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.639 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.605 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.014 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.660 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 147 Family Scaffolds |
---|---|---|
PF01909 | NTP_transf_2 | 72.11 |
PF13463 | HTH_27 | 6.12 |
PF00206 | Lyase_1 | 0.68 |
PF13432 | TPR_16 | 0.68 |
PF05593 | RHS_repeat | 0.68 |
PF13276 | HTH_21 | 0.68 |
PF03781 | FGE-sulfatase | 0.68 |
PF00982 | Glyco_transf_20 | 0.68 |
PF00872 | Transposase_mut | 0.68 |
PF07651 | ANTH | 0.68 |
PF02661 | Fic | 0.68 |
PF00589 | Phage_integrase | 0.68 |
PF11455 | MazE-like | 0.68 |
PF01619 | Pro_dh | 0.68 |
PF02803 | Thiolase_C | 0.68 |
PF09095 | AmyA-gluTrfs_C | 0.68 |
PF00069 | Pkinase | 0.68 |
PF02518 | HATPase_c | 0.68 |
PF08240 | ADH_N | 0.68 |
PF02861 | Clp_N | 0.68 |
PF03466 | LysR_substrate | 0.68 |
PF12833 | HTH_18 | 0.68 |
PF00226 | DnaJ | 0.68 |
COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.72 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.68 |
COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.68 |
COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 0.68 |
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.68 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.64 % |
Unclassified | root | N/A | 1.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10061115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1942 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101816851 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300002560|JGI25383J37093_10188342 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300002914|JGI25617J43924_10088620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1116 | Open in IMG/M |
3300004082|Ga0062384_100426054 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300004092|Ga0062389_102441519 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300005167|Ga0066672_10427770 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300005167|Ga0066672_10478854 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300005171|Ga0066677_10406237 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300005447|Ga0066689_10596305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
3300005518|Ga0070699_101530352 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300005554|Ga0066661_10467328 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300005556|Ga0066707_10945814 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005575|Ga0066702_10206257 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300006028|Ga0070717_11780913 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300006176|Ga0070765_100767926 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300006800|Ga0066660_10031862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3251 | Open in IMG/M |
3300006806|Ga0079220_10091508 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
3300006893|Ga0073928_10000316 | All Organisms → cellular organisms → Bacteria | 115553 | Open in IMG/M |
3300009088|Ga0099830_11860706 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300009523|Ga0116221_1554802 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300009547|Ga0116136_1192886 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300009631|Ga0116115_1111667 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300009634|Ga0116124_1153564 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300009641|Ga0116120_1206644 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300009643|Ga0116110_1303247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300009762|Ga0116130_1166815 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300010159|Ga0099796_10252630 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300010339|Ga0074046_10006844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8900 | Open in IMG/M |
3300010343|Ga0074044_10652386 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300010360|Ga0126372_12088972 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300010376|Ga0126381_100995432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
3300010379|Ga0136449_102082388 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300011120|Ga0150983_11569962 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300012010|Ga0120118_1015627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2110 | Open in IMG/M |
3300012189|Ga0137388_11206041 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300012198|Ga0137364_10026338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3656 | Open in IMG/M |
3300012199|Ga0137383_10644857 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300012200|Ga0137382_10139051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1638 | Open in IMG/M |
3300012203|Ga0137399_10681668 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300012205|Ga0137362_10370978 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
3300012207|Ga0137381_10401837 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300012211|Ga0137377_10515452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
3300012211|Ga0137377_10782021 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300012357|Ga0137384_10453418 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300012362|Ga0137361_10418364 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300012917|Ga0137395_10988426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300012918|Ga0137396_10785682 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300012922|Ga0137394_10839849 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300014151|Ga0181539_1250438 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300014152|Ga0181533_1027676 | All Organisms → cellular organisms → Bacteria | 3382 | Open in IMG/M |
3300014153|Ga0181527_1335837 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300014153|Ga0181527_1424287 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300014158|Ga0181521_10543425 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300014495|Ga0182015_10145622 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
3300014498|Ga0182019_10756894 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300014657|Ga0181522_10709651 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300015242|Ga0137412_10452434 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300015242|Ga0137412_10836493 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300016730|Ga0181515_1397812 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300017823|Ga0187818_10369749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300017925|Ga0187856_1339165 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300017929|Ga0187849_1335490 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300017934|Ga0187803_10053114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1599 | Open in IMG/M |
3300017934|Ga0187803_10411244 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300017943|Ga0187819_10266992 | Not Available | 999 | Open in IMG/M |
3300017972|Ga0187781_10425084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
3300017972|Ga0187781_10834568 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300017975|Ga0187782_10874980 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300018003|Ga0187876_1040898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1977 | Open in IMG/M |
3300018005|Ga0187878_1041948 | All Organisms → cellular organisms → Bacteria | 2126 | Open in IMG/M |
3300018019|Ga0187874_10450187 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300018020|Ga0187861_10161354 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300018023|Ga0187889_10493438 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300018024|Ga0187881_10473848 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300018047|Ga0187859_10149689 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
3300018062|Ga0187784_10515428 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300018062|Ga0187784_10703205 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300018085|Ga0187772_11440108 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300018086|Ga0187769_11109955 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300018088|Ga0187771_11679406 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300018090|Ga0187770_10090524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2269 | Open in IMG/M |
3300018090|Ga0187770_10672462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
3300018090|Ga0187770_11576354 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300019082|Ga0187852_1046903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2023 | Open in IMG/M |
3300019082|Ga0187852_1093183 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300019275|Ga0187798_1522945 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300021088|Ga0210404_10910767 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300021168|Ga0210406_10007700 | All Organisms → cellular organisms → Bacteria | 10885 | Open in IMG/M |
3300021178|Ga0210408_10901236 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300021388|Ga0213875_10136438 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300021420|Ga0210394_10255320 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
3300021432|Ga0210384_10798892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
3300022515|Ga0224546_1001199 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300022557|Ga0212123_10001709 | All Organisms → cellular organisms → Bacteria | 58905 | Open in IMG/M |
3300022840|Ga0224549_1025739 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300022881|Ga0224545_1062777 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300023090|Ga0224558_1197708 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300025322|Ga0209641_10245349 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300025409|Ga0208321_1027068 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300025459|Ga0208689_1049939 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300025507|Ga0208188_1089735 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300025915|Ga0207693_10333321 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300026309|Ga0209055_1179284 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300026335|Ga0209804_1069580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1672 | Open in IMG/M |
3300026361|Ga0257176_1078673 | Not Available | 537 | Open in IMG/M |
3300026467|Ga0257154_1035869 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300026467|Ga0257154_1085798 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300026540|Ga0209376_1107140 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300027625|Ga0208044_1142865 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300027729|Ga0209248_10156523 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300027812|Ga0209656_10036156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2884 | Open in IMG/M |
3300027825|Ga0209039_10007843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6745 | Open in IMG/M |
3300027829|Ga0209773_10068987 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
3300027879|Ga0209169_10324622 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300027903|Ga0209488_11231564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300027908|Ga0209006_11537869 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300027915|Ga0209069_10623381 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300028047|Ga0209526_10536420 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300028536|Ga0137415_10171377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2000 | Open in IMG/M |
3300028747|Ga0302219_10090466 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
3300028806|Ga0302221_10156192 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300028871|Ga0302230_10104134 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300029943|Ga0311340_11129370 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300029954|Ga0311331_11438204 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300030007|Ga0311338_10051125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5503 | Open in IMG/M |
3300030518|Ga0302275_10455981 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300030707|Ga0310038_10195910 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300030737|Ga0302310_10076275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2117 | Open in IMG/M |
3300030746|Ga0302312_10137596 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300031238|Ga0265332_10257878 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300031672|Ga0307373_10096445 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
3300031708|Ga0310686_106266520 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300031708|Ga0310686_106524999 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300031708|Ga0310686_109582105 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300031708|Ga0310686_114190078 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300031718|Ga0307474_10011176 | All Organisms → cellular organisms → Bacteria | 6502 | Open in IMG/M |
3300031837|Ga0302315_10370538 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300032059|Ga0318533_11378212 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300032069|Ga0315282_10112756 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
3300032076|Ga0306924_11348467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
3300032160|Ga0311301_11889837 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300032180|Ga0307471_100941179 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
3300032261|Ga0306920_102921704 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300033134|Ga0335073_11049833 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300034091|Ga0326724_0439976 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300034282|Ga0370492_0203200 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.61% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.16% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.80% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.12% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.44% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.08% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.08% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.08% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.72% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.72% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.04% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.36% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.36% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.36% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.36% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.36% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.36% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.68% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.68% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.68% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.68% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.68% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.68% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.68% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.68% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.68% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025409 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes) | Environmental | Open in IMG/M |
3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_100611151 | 3300000567 | Peatlands Soil | MKKLRPHRIDWAQIERFLQSAEKKLTSAHKILAFDEEACL |
JGIcombinedJ26739_1018168512 | 3300002245 | Forest Soil | VKKLKPHKVXWAQSERFFLSADKKLASAXKILAFD* |
JGI25383J37093_101883422 | 3300002560 | Grasslands Soil | MKKLKPQKVDWAQIERFLQSAEKKLASARKILAFDEEACLQQ |
JGI25617J43924_100886202 | 3300002914 | Grasslands Soil | VKKLKPQKVDWAQIERFLQSAEKKLATAHKILAFDEEASLQQ |
Ga0062384_1004260541 | 3300004082 | Bog Forest Soil | MKKLKPHNVDWAQIDRFLASADKKLASAHKILAFDEEACLQQAYEA |
Ga0062389_1024415192 | 3300004092 | Bog Forest Soil | VKKLKLHKVDWAQIDRFLASADKKLASAHKILAFDEEACLQQAYAAMLQASL |
Ga0066672_104277701 | 3300005167 | Soil | MKKLKPHKVDWGQIDRFLASADKKLASAHKILALDNPRPMHTA* |
Ga0066672_104788543 | 3300005167 | Soil | VKKLKPHRVDWVQIKRFLQSAERKLASAHKILLFDEEAFLQQAYEAMLKAVEA |
Ga0066677_104062372 | 3300005171 | Soil | VKKLKPQKVDWAQIERFLQSAEKKLASAQKILAFDEEACLQQ |
Ga0066689_105963051 | 3300005447 | Soil | VKKLKPQKVDWAQIERFLQSAERKLASAHKILAFDEEACLQQAYEAML |
Ga0070699_1015303522 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLKPHAVDWAQIDRFLASADKKLASARKILAFDEEACLQ |
Ga0066661_104673282 | 3300005554 | Soil | VKKLKPQKVDWAQIERFLQSGEKELASAHKILAFDEEACL* |
Ga0066707_109458142 | 3300005556 | Soil | VKKLKPQKVDWAQIERFLQSAEKKLASAHKILAFDEEACLQQAYE |
Ga0066702_102062573 | 3300005575 | Soil | MKKLKPHTVNWAQIDRFLVSAEKKLASAQKILAFDEE |
Ga0070717_117809132 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKLKPHAVDWAQIDRFLVSADKKLTSAHRILAFDEEACLQ |
Ga0070765_1007679262 | 3300006176 | Soil | MKKLKPHTVDWAQIERFLASADKKLASAHKILAFDEEACLQQAYEAM |
Ga0066660_100318624 | 3300006800 | Soil | MNKLKPQKVDWPQIERFLQSAEKKLASANKILAFDEEASLRSDAQSLT |
Ga0079220_100915083 | 3300006806 | Agricultural Soil | MKKFKPHAVDWAQIERFLASADKKLASARKIIAFDEEACLQQA* |
Ga0073928_1000031697 | 3300006893 | Iron-Sulfur Acid Spring | MKKLKPHAVDWAQIDRFLASADKKLVSARKILAFDEEACLQ* |
Ga0099830_118607061 | 3300009088 | Vadose Zone Soil | MTKLKPQKVEWKQIERFLDSADQKLAAAGKILAIDEEVC |
Ga0116221_15548022 | 3300009523 | Peatlands Soil | MKKLKAHTVDWAQIERFLTSADKKLASAHKILAFDEEACLQQAYEA |
Ga0116136_11928861 | 3300009547 | Peatland | MKKLKPHVVDWAQIDRFLASADKKLASARKILAFDEEACLQQA |
Ga0116115_11116672 | 3300009631 | Peatland | MKKLKPHAADWPQIDRFLASADKKLVSARKILAFDEEACLQQAYEAML |
Ga0116124_11535642 | 3300009634 | Peatland | MKKVKPHAVDWAQIERFLTSADKKLASAHKILAFDEEACLQQAYEAMLK |
Ga0116120_12066441 | 3300009641 | Peatland | MKKSKPHTTDWPQIDRFLQSAEKRLSSARKILEFD |
Ga0116110_13032471 | 3300009643 | Peatland | MKKSKPHTTDWPQIDRFLQSAEKRLSSARKILEFDEEACLQQAYEAMLRASLAFMFS |
Ga0116130_11668151 | 3300009762 | Peatland | MKKSKPHTTDWPQIDRFLQSAEKRLSSARKILEFDEEACL |
Ga0099796_102526301 | 3300010159 | Vadose Zone Soil | MKKLKPHTVDWAQIERFLASADKKLALAHKILAFDEEA |
Ga0074046_100068445 | 3300010339 | Bog Forest Soil | VKKLKPQKIDWAQIERFLQNAEKKLASAHKILAFDEEACLQQA* |
Ga0074044_106523861 | 3300010343 | Bog Forest Soil | MKKVKPHVVDWAQIERFLTSADKKLASAHKILAFDEEAC |
Ga0126372_120889721 | 3300010360 | Tropical Forest Soil | MKKLKSHTADWAQIERFLASADKKLASAHKILVIDEEACLQQAYEAKASLGFMFSHGFRV |
Ga0126381_1009954323 | 3300010376 | Tropical Forest Soil | VKKLRPQQVDWAQIERFLQSAEKKLASAHKILAFDEEA |
Ga0136449_1020823881 | 3300010379 | Peatlands Soil | MKKLRPHKLDWAQIERFLASADRKLATAHKVLAFDEEACLQQDYEAMLRAALGFMFSHGSRARSQPGHHIAII* |
Ga0150983_115699622 | 3300011120 | Forest Soil | MKKVKPHTVDWAQIERFLTSADKKLASAHKILAFDEEACLQQAYEAMLK |
Ga0120118_10156274 | 3300012010 | Permafrost | MKKLNPHIVDWAQIDRFLTSADKKLASAHKILALDEEACLR |
Ga0137388_112060411 | 3300012189 | Vadose Zone Soil | MTKLKPQKVEWKQIERFLDSADQKLAAAGKILAIDEEVCLQQAYEAMLRSSIG |
Ga0137364_100263385 | 3300012198 | Vadose Zone Soil | MKKLKPHTVDWGQIEHFLTSADEKLASAHRILAFDEFVA* |
Ga0137383_106448571 | 3300012199 | Vadose Zone Soil | MKKLKPHTVDWAQIERFLASADKKLASAHKILAFDEEACLQQAYEAMLKASLGF |
Ga0137382_101390511 | 3300012200 | Vadose Zone Soil | MKNLKPHKVDWAQIERFLASADKKLASAHKILAFDEEACLQQAYEAMLKASL |
Ga0137399_106816682 | 3300012203 | Vadose Zone Soil | MKKFNPHNVDWAQIGRFLASADKKLASAHKILAFDEEACL* |
Ga0137362_103709781 | 3300012205 | Vadose Zone Soil | MKKLKPHKVDWGQIDRFLTSADKKLASAHKILAFDEE |
Ga0137381_104018371 | 3300012207 | Vadose Zone Soil | VKKLKPHAVDWAQIDRFLASADKKLASAHKILAFDEEACLQ |
Ga0137377_105154521 | 3300012211 | Vadose Zone Soil | MKNLKPHKVDWAQIERFLASADKKLASAHKILAFDEEACLQQA |
Ga0137377_107820212 | 3300012211 | Vadose Zone Soil | MKKLKPHAVDWAQIDRFLASANKKLASARKILAFDEEACLQ |
Ga0137384_104534183 | 3300012357 | Vadose Zone Soil | MKKLRPQGVDWAQIERFQQSAEKKLASARKILAFDEETSLQ |
Ga0137361_104183643 | 3300012362 | Vadose Zone Soil | MKKLKPHTVDWVQIDRFLASADKKLASARKILVFDEEACLQQAYE |
Ga0137395_109884262 | 3300012917 | Vadose Zone Soil | VRRKKLKPHNVNWAQIDRFIASADKKLAFDEEAYT* |
Ga0137396_107856822 | 3300012918 | Vadose Zone Soil | MKKLKSHKVDWAQIERFLSSADKKLASAQKIPAFDEEACLQLAYERC* |
Ga0137394_108398492 | 3300012922 | Vadose Zone Soil | MKKLKRHAVEWAQIDRFLASADKKLVSANKILAFDEEACL |
Ga0181539_12504381 | 3300014151 | Bog | MRNLKPHRVDWAQIDRFLASAEKKLASARKILAFDEETCLLNPES* |
Ga0181533_10276761 | 3300014152 | Bog | MKKSKPHTTDWPQIDRFLLSAERRLSSARKILEFDEEACLQQAYEAMLRASLAFM |
Ga0181527_13358371 | 3300014153 | Bog | MKKLKPHKVEWAQIDRFLAGAEKKLASAHKILAFDEEACLQQAYEAMLKASL |
Ga0181527_14242871 | 3300014153 | Bog | MKKLKPHTVDWAQIERFLTSADKKLASAHKILAFDEEACLQPQESPKSGQ* |
Ga0181521_105434251 | 3300014158 | Bog | MKKLKPHVVDWAQIERFLTSADKKLSSARKILAFHEEACLQQAYEAMLK |
Ga0182015_101456224 | 3300014495 | Palsa | VPHEETKNTQSFDWTQIERFLASADKKLASAHKILVFDEEASLQQA |
Ga0182019_107568942 | 3300014498 | Fen | MKKSKPHTTDWPQIGRFLQSAEKRLSSARKILEFDEEACL |
Ga0181522_107096511 | 3300014657 | Bog | MKKLKPHAVDWGQIDRFLASADKKLASARKILAFDEEACLQQ |
Ga0137412_104524343 | 3300015242 | Vadose Zone Soil | MKKLKPHAVDRAQIDRFLASADKKLASANKILAF* |
Ga0137412_108364931 | 3300015242 | Vadose Zone Soil | MKKLKAHTLDWAQIERFLAGADKKLASARKILAFDQE |
Ga0181515_13978122 | 3300016730 | Peatland | MKKLKPHNVDRAQIERFLASAERKLDSAHKILAFDDEACHQ |
Ga0187818_103697491 | 3300017823 | Freshwater Sediment | VKKLKPQKIDWAQIERFLQSAEKKLASAHKILSFDEEACLQQAYKRC |
Ga0187856_13391651 | 3300017925 | Peatland | MKKLRPHKLDWAQIERFLASADRKLATAHKILAFDEEA |
Ga0187849_13354902 | 3300017929 | Peatland | LKPRKLHWAQIEPFPASADRWLASAHKILAFDEKACLQ |
Ga0187803_100531143 | 3300017934 | Freshwater Sediment | MKKLKPHKIDWTQIERFLASADKKLASARKILAFDEEACL |
Ga0187803_104112442 | 3300017934 | Freshwater Sediment | VKKLKRQRVDWGQIDRFLQSAEKKLASAHKILAFDE |
Ga0187819_102669922 | 3300017943 | Freshwater Sediment | VKKLKPQKVDWAQIERFLQSAEKKLASAHKILSFDEEACLQQAYKRC |
Ga0187781_104250842 | 3300017972 | Tropical Peatland | MKKLKPHKVDWEQIERFLTSAERKLALAHKILALDEEACLQQAYEAMLRASLGYMFSHGFRA |
Ga0187781_108345682 | 3300017972 | Tropical Peatland | MKKLKPHTVDWQQIERFLASADKKLASAHRILDFDEE |
Ga0187782_108749802 | 3300017975 | Tropical Peatland | MKKLKPQTVDWAQIERFLTRAQRKLASAHKILAFDE |
Ga0187876_10408984 | 3300018003 | Peatland | MKKSKPHTTDWPQIGRFLQSAEKRLPSARKILEFDEEACLQQAYEAMLRASLAFMFSH |
Ga0187878_10419484 | 3300018005 | Peatland | MKKSKPHTTDWPQIGRFLQSAEKRLSSARKILELDEEACLQQ |
Ga0187874_104501872 | 3300018019 | Peatland | MKKLKSHTVDWAQIERFVASAEKKLTSAHKILAFDEEACLQQAY |
Ga0187861_101613541 | 3300018020 | Peatland | MNKLKPHNVDWAQIERFLASADRKLASAHKILAFD |
Ga0187889_104934382 | 3300018023 | Peatland | MKKLKPHAVDWAQIDRFLASADKKLASAHKILAFDEEACL |
Ga0187881_104738481 | 3300018024 | Peatland | MRNLKPHRVDWAQIDRFLASAEKKLASARKILAFDEETCLLNPES |
Ga0187859_101496891 | 3300018047 | Peatland | MKKLKPHSVDWAQIERFLTSADKKLASAHKILAFDEEACL |
Ga0187784_105154282 | 3300018062 | Tropical Peatland | MKKLKPQRVDWEQIDRFLQSAEKKLVSARKILAFDEEACLQNTSPWFAES |
Ga0187784_107032052 | 3300018062 | Tropical Peatland | MKKLRLHTIDWAQIQRFLESAEKKLPSAHKILAFDEEACLQQA |
Ga0187772_114401082 | 3300018085 | Tropical Peatland | MKKLAPHKVDWAQIERFLASADRKLASARKILAFDEE |
Ga0187769_111099551 | 3300018086 | Tropical Peatland | MQMKKLKPHAVDWAQIERFLASADKKLASARKILAFDEEACLQQ |
Ga0187771_116794061 | 3300018088 | Tropical Peatland | VKKLRPQRIDWAQIDRFLQSAEKKLASAHKILAFDEEACL |
Ga0187770_100905245 | 3300018090 | Tropical Peatland | VKKLKPQRVDWEQIERFLQSAEKKLASAHKILAFDEEACL |
Ga0187770_106724623 | 3300018090 | Tropical Peatland | VKKLKPQRADWGQIDRFLQSAEKKLVSARKILAFDEEA |
Ga0187770_115763542 | 3300018090 | Tropical Peatland | MKKLKPQTVDWAQVERFLARAQRKLASAHKILAFDEKACLQQAYESMLRAALGFMFSHGFRA |
Ga0187852_10469034 | 3300019082 | Peatland | MKKLKPHAVDWAQIDRFLASADKKLASARKILAFD |
Ga0187852_10931831 | 3300019082 | Peatland | MKKSKPHTTDWPQIDRFLQSAEKRLSSARKILEFDEEACLQQAYEAMLRASLAFM |
Ga0187798_15229451 | 3300019275 | Peatland | MKKLKPHKVDWEQIERFLTSAERKLASGHKILAFDEEACLQQAY |
Ga0210404_109107672 | 3300021088 | Soil | MKKLKPHAVDWAQIDRFLASADKKLASARKILAFDEEACLQQAY |
Ga0210406_1000770010 | 3300021168 | Soil | MKKFKPHTVDWAQIERFLSSADKKLASAHKILAFDEEANRCSKPL |
Ga0210408_109012362 | 3300021178 | Soil | VKKLRAQRVDWGQIERFLLSAEKKLASAKMILAFDEEACLQQAYEAMLK |
Ga0213875_101364383 | 3300021388 | Plant Roots | VNKKLKLHTVDWAQIERFLASADKKLASAHKILRFDEEACLQQAYEAMLKASLGLCS |
Ga0210394_102553201 | 3300021420 | Soil | MKKLRPQRVDWGQIERFLQSAEKKLTSAHKILAFDEEACLQQAYEAMFK |
Ga0210384_107988922 | 3300021432 | Soil | VKKLKPHKVDWAQIERFLLSADKKLASAHKIQAYEAMLKASLGFMF |
Ga0224546_10011992 | 3300022515 | Soil | MKKLKAHAVDWAQIDRFLASADKKLASARKILAFDEEACLNKLTKQC |
Ga0212123_1000170923 | 3300022557 | Iron-Sulfur Acid Spring | MKKLKPHAVDWAQIDRFLASADKKLVSARKILAFDEEACLQ |
Ga0224549_10257392 | 3300022840 | Soil | MKKLKSNTVDWAQIDRFVASAEKKLTSAHKILACDEEACLQQV |
Ga0224545_10627771 | 3300022881 | Soil | MKKLKPHAVDWAQIDRFLASADKKLASARKILAFDEEACLQQAYEAM |
Ga0224558_11977081 | 3300023090 | Soil | MKKVKPHTVDWAQIERFLTSADKKLASAHKILAFDEEACLQQAYEAM |
Ga0209641_102453492 | 3300025322 | Soil | MRKLKPHKVDWAQIDRFLVSAEKKLATAHRILAFDEEAALQQA |
Ga0208321_10270683 | 3300025409 | Peatland | MKKLRPHAVDWAQIDRFLASADKKLASAHKILAFDEE |
Ga0208689_10499391 | 3300025459 | Peatland | MKKLKPHKVDWAQIERFLTSGDRKLASAHKILTIDEEAC |
Ga0208188_10897352 | 3300025507 | Peatland | MKKLKPHTVDGAQIERFLTGTDKKLASARKILAFDEEA |
Ga0207693_103333212 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKVKPHTVDWAQIERFLTSTDKKLASAHKILAFDEEA |
Ga0209055_11792841 | 3300026309 | Soil | VKKLKPQKVDWAQIERFLQSAEKKLASAQKILAFDEEACLQQAYEAML |
Ga0209804_10695802 | 3300026335 | Soil | VKKLKPQKVDWAQIERFLQSGEKELASAHKILAFDEEACL |
Ga0257176_10786732 | 3300026361 | Soil | MKKLKPHAVDWAQIDRFLASADKKLASARKILAFDEEALRV |
Ga0257154_10358691 | 3300026467 | Soil | MKKLKPHKVDWAQIDRFLASADKKLASAHKIPAFDEEACLQQA |
Ga0257154_10857981 | 3300026467 | Soil | MKKLKPHAVDWAQIERFLTSADKKLASAHKILAFDE |
Ga0209376_11071403 | 3300026540 | Soil | VKKLKPQKVDWAQIERFLQSAEKKLASAQKILAFDE |
Ga0208044_11428651 | 3300027625 | Peatlands Soil | MKKLKPHSVDWAQIERFLASADKKLASARKILAFDEEACLQQ |
Ga0209248_101565231 | 3300027729 | Bog Forest Soil | MKKLKPHTVDWAQIERFLASADKKLASAHKILAFDEEACLQ |
Ga0209656_100361562 | 3300027812 | Bog Forest Soil | VKKLKPQKIDWAQIERFLQNAEKKLASAHKILAFDEEACLQQA |
Ga0209039_100078438 | 3300027825 | Bog Forest Soil | HAVDWAQIERFLASADKKLASARKILAFDEEACVQ |
Ga0209773_100689871 | 3300027829 | Bog Forest Soil | MKKLKAHAVDWAQIDRFLASADKKLASARKILAFDEEACLQQAYE |
Ga0209169_103246221 | 3300027879 | Soil | MKKLKPHRVDWAQIDRFLASAEKKLASARKILAFDEEACLQQAYES |
Ga0209488_112315642 | 3300027903 | Vadose Zone Soil | MKKLKPHKVDWAQIERFLASADKKLASAHKILAFDEEACLQQAYEAMLK |
Ga0209006_115378692 | 3300027908 | Forest Soil | MKKLKQHAVDWAQIDRFLTSADKKLASARKIIAFD |
Ga0209069_106233812 | 3300027915 | Watersheds | MKKLKAHAVDWAQIDRFLASADKKLASARTILAFDEE |
Ga0209526_105364202 | 3300028047 | Forest Soil | VKKLKPHKVDWAQIERFLLSADKKLASAHKILAFD |
Ga0137415_101713773 | 3300028536 | Vadose Zone Soil | MKKFNPHNVDWAQIGRFLASADKKLASAHKILAFDEEACL |
Ga0302219_100904662 | 3300028747 | Palsa | MKKLKPHTVDWAQIERFLASADKKLASARKILAFDEEACLQ |
Ga0302221_101561922 | 3300028806 | Palsa | MKKVKPHPVDWAQIERFLTSADKKLASARKILAFDE |
Ga0302230_101041342 | 3300028871 | Palsa | MKKLKPHTVDWAQIERFLASADKKLASARKILAFDEEACLQQAYEA |
Ga0311340_111293701 | 3300029943 | Palsa | MKKLKPHAVNWAQIDRFLVSADKKLASARKILAFDEEACLQQ |
Ga0311331_114382042 | 3300029954 | Bog | MKKLKPHVVDWAQIERFLTSAEKKLSSARKILAFDEEA |
Ga0311338_100511258 | 3300030007 | Palsa | MKKLKPHTVDWAQIERFLASADKKLASARKILAFD |
Ga0302275_104559811 | 3300030518 | Bog | MKKLKPHAVDWAQIDRFLASADKKLASAHKILAFDEEACLQQAYEAMLKASLGF |
Ga0310038_101959102 | 3300030707 | Peatlands Soil | MKKLKPHSVDWAQIERFLASADKKLASARKILAFDEEACL |
Ga0302310_100762753 | 3300030737 | Palsa | MKKLKAHAVDWAQIDRFLASADKKLASARKILAFDEEACL |
Ga0302312_101375961 | 3300030746 | Palsa | MKKLKAHAVDWAQIDRFLASADKKLASARKILAFDEEACLNKL |
Ga0265332_102578781 | 3300031238 | Rhizosphere | MKKLKTHKVDWTQIERFLASADKKLASAHKILVFDEEASLQ |
Ga0307373_100964452 | 3300031672 | Soil | VKKFKSQKVDWAQIERFLQSSEKKLASAHKIHSSRST |
Ga0310686_1062665202 | 3300031708 | Soil | MTKSKKSKPHTTDWPQIDRFLQSAEKRLSSARKILEFDEEACLQQAYEAML |
Ga0310686_1065249991 | 3300031708 | Soil | MKKLKPHRVDGAQIERFLQSAEKKLASAHKILAFDEEASLQQAYEA |
Ga0310686_1095821052 | 3300031708 | Soil | MKKLKPHTIDWAQIERFVASAEKKLTSAHKILAFDEEACL |
Ga0310686_1141900781 | 3300031708 | Soil | MKKLKSPAVDWAQGDHFLASAGKKLASACKILAFDEEAC |
Ga0307474_100111765 | 3300031718 | Hardwood Forest Soil | MKKLKPHITDWAQIERFLASADEKLASARRILFGIQ |
Ga0302315_103705382 | 3300031837 | Palsa | MKKLKPHTVDWAQIERFLASADKKLASARKILAFDEEACLQQAYEAMLK |
Ga0318533_113782121 | 3300032059 | Soil | MSTIKPHTVDWVQIDRFLQSADKKLASAHKILALDEEASLEQAYEAMLK |
Ga0315282_101127563 | 3300032069 | Sediment | MRNFKPHKVDWAQIDRFLAGAEKKFASAHKIPAFDERLVFS |
Ga0306924_113484672 | 3300032076 | Soil | MSTIKPHTVDWVQIDRFLQSADKKLASAHKILALDEEASLEQ |
Ga0311301_118898371 | 3300032160 | Peatlands Soil | MKKLKPHVADWAQIERFLASADKKLASARKILAFDEEACLQQAYE |
Ga0307471_1009411793 | 3300032180 | Hardwood Forest Soil | MKKLKPHTIDWAQIDRFLAVADKKLASARKVLAFDEEACLQQ |
Ga0306920_1029217041 | 3300032261 | Soil | VKKLRPQQVDWAQIARFLQSADKKLASAHKILAFDEEACLQQAYEA |
Ga0335073_110498331 | 3300033134 | Soil | MSTVRPHTVDWPQIHRFLASAEKKLVSAEKILVIDEEASLEQAYGAMLRASLAFMFSHGVRPRSQP |
Ga0326724_0439976_3_107 | 3300034091 | Peat Soil | MKKLKPHKVDWAQIERFLASAERKLASAHKILAFD |
Ga0370492_0203200_15_227 | 3300034282 | Untreated Peat Soil | MKKSKPHATDWPQIGRFLQSAEKRLSSARTILEFDEEACLQQAYEAMLRASLTLMFSHSVRPRISAAITS |
⦗Top⦘ |