NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049772

Metagenome / Metatranscriptome Family F049772

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049772
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 53 residues
Representative Sequence MRHLVGVMLAIVMAAAVFFAASWGYLKLLIGPAGLGRLPAGGGSLLHNHAVLEG
Number of Associated Samples 136
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 95.89 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.52 %
Associated GOLD sequencing projects 128
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.507 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.657 % of family members)
Environment Ontology (ENVO) Unclassified
(19.863 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.370 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.24%    β-sheet: 0.00%    Coil/Unstructured: 59.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF00535Glycos_transf_2 15.75
PF03176MMPL 14.38
PF12802MarR_2 1.37
PF13671AAA_33 0.68
PF00392GntR 0.68
PF00069Pkinase 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 14.38
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 14.38
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.51 %
UnclassifiedrootN/A18.49 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10083139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1328Open in IMG/M
3300002075|JGI24738J21930_10122830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii565Open in IMG/M
3300003505|JGIcombinedJ51221_10409921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii550Open in IMG/M
3300004156|Ga0062589_102089638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii577Open in IMG/M
3300004635|Ga0062388_101142599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium767Open in IMG/M
3300004635|Ga0062388_101727814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium640Open in IMG/M
3300005186|Ga0066676_10963665Not Available569Open in IMG/M
3300005353|Ga0070669_100409338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1111Open in IMG/M
3300005436|Ga0070713_101167535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium745Open in IMG/M
3300005445|Ga0070708_100007671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8645Open in IMG/M
3300005445|Ga0070708_101515387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii625Open in IMG/M
3300005468|Ga0070707_101692244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii600Open in IMG/M
3300005526|Ga0073909_10378471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii662Open in IMG/M
3300005537|Ga0070730_10549542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia739Open in IMG/M
3300005540|Ga0066697_10254052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1041Open in IMG/M
3300005542|Ga0070732_10699748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii617Open in IMG/M
3300005610|Ga0070763_10193467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1082Open in IMG/M
3300006052|Ga0075029_100169882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1349Open in IMG/M
3300006058|Ga0075432_10313930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii654Open in IMG/M
3300006176|Ga0070765_101516570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia631Open in IMG/M
3300006358|Ga0068871_101501273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium637Open in IMG/M
3300006806|Ga0079220_11710073Not Available550Open in IMG/M
3300006954|Ga0079219_10128313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1309Open in IMG/M
3300009011|Ga0105251_10077089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1546Open in IMG/M
3300009093|Ga0105240_11755716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii647Open in IMG/M
3300009162|Ga0075423_10280959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1744Open in IMG/M
3300009174|Ga0105241_12339181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium532Open in IMG/M
3300009522|Ga0116218_1425015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium593Open in IMG/M
3300009523|Ga0116221_1107435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1231Open in IMG/M
3300009683|Ga0116224_10291908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium776Open in IMG/M
3300009700|Ga0116217_10273333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1092Open in IMG/M
3300009700|Ga0116217_10353833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium937Open in IMG/M
3300009824|Ga0116219_10365821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium807Open in IMG/M
3300010043|Ga0126380_12048227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium525Open in IMG/M
3300010159|Ga0099796_10354004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii634Open in IMG/M
3300010320|Ga0134109_10404547Not Available546Open in IMG/M
3300010379|Ga0136449_100800619All Organisms → cellular organisms → Bacteria → Terrabacteria group1557Open in IMG/M
3300010379|Ga0136449_103398212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium609Open in IMG/M
3300012096|Ga0137389_11017176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium710Open in IMG/M
3300012198|Ga0137364_10091769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2121Open in IMG/M
3300012201|Ga0137365_10682253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium751Open in IMG/M
3300012206|Ga0137380_10692537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium885Open in IMG/M
3300012351|Ga0137386_10376276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1022Open in IMG/M
3300012491|Ga0157329_1016479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii649Open in IMG/M
3300012915|Ga0157302_10532104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii514Open in IMG/M
3300012957|Ga0164303_11178655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium559Open in IMG/M
3300012985|Ga0164308_10433175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1084Open in IMG/M
3300014501|Ga0182024_12388812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii573Open in IMG/M
3300015373|Ga0132257_103969767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium538Open in IMG/M
3300016270|Ga0182036_10524120Not Available941Open in IMG/M
3300016270|Ga0182036_11299375Not Available607Open in IMG/M
3300016387|Ga0182040_10168622Not Available1580Open in IMG/M
3300017823|Ga0187818_10065721All Organisms → cellular organisms → Bacteria → Terrabacteria group1562Open in IMG/M
3300017823|Ga0187818_10274618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium739Open in IMG/M
3300017927|Ga0187824_10375173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii515Open in IMG/M
3300017932|Ga0187814_10309151Not Available606Open in IMG/M
3300017942|Ga0187808_10095985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1286Open in IMG/M
3300017970|Ga0187783_10180464All Organisms → cellular organisms → Bacteria → Terrabacteria group1554Open in IMG/M
3300017993|Ga0187823_10022416All Organisms → cellular organisms → Bacteria → Terrabacteria group1599Open in IMG/M
3300017994|Ga0187822_10135703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii780Open in IMG/M
3300018007|Ga0187805_10497575Not Available571Open in IMG/M
3300018044|Ga0187890_10714617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium566Open in IMG/M
3300018057|Ga0187858_10559955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii693Open in IMG/M
3300018058|Ga0187766_10672077Not Available713Open in IMG/M
3300018085|Ga0187772_11237882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300018090|Ga0187770_11458935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii557Open in IMG/M
3300019890|Ga0193728_1198788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium843Open in IMG/M
3300021170|Ga0210400_10675845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii850Open in IMG/M
3300021374|Ga0213881_10162078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium981Open in IMG/M
3300021388|Ga0213875_10134095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1158Open in IMG/M
3300021402|Ga0210385_10026536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3718Open in IMG/M
3300021403|Ga0210397_11566969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii511Open in IMG/M
3300021404|Ga0210389_10587935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium875Open in IMG/M
3300021418|Ga0193695_1089800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii663Open in IMG/M
3300021474|Ga0210390_11274131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium590Open in IMG/M
3300021477|Ga0210398_11154204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii613Open in IMG/M
3300021478|Ga0210402_10213486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1775Open in IMG/M
3300021479|Ga0210410_11103973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii683Open in IMG/M
3300021560|Ga0126371_13326137Not Available543Open in IMG/M
3300022716|Ga0242673_1004894All Organisms → cellular organisms → Bacteria → Terrabacteria group1485Open in IMG/M
3300024178|Ga0247694_1032850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii583Open in IMG/M
3300024182|Ga0247669_1094206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium507Open in IMG/M
3300024310|Ga0247681_1067736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii561Open in IMG/M
3300025906|Ga0207699_10419490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium956Open in IMG/M
3300025916|Ga0207663_10103233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1920Open in IMG/M
3300025917|Ga0207660_10110784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae2065Open in IMG/M
3300025922|Ga0207646_11228518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii656Open in IMG/M
3300025923|Ga0207681_10228631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1443Open in IMG/M
3300026998|Ga0208369_1008064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300026999|Ga0207949_1017717Not Available650Open in IMG/M
3300027080|Ga0208237_1047363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii642Open in IMG/M
3300027575|Ga0209525_1018697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1696Open in IMG/M
3300027604|Ga0208324_1116013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium742Open in IMG/M
3300027729|Ga0209248_10074937All Organisms → cellular organisms → Bacteria → Acidobacteria1027Open in IMG/M
3300027775|Ga0209177_10162185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium768Open in IMG/M
3300027869|Ga0209579_10474816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii679Open in IMG/M
3300027884|Ga0209275_10047865Not Available2043Open in IMG/M
3300027884|Ga0209275_10051861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1976Open in IMG/M
3300027894|Ga0209068_10312745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium884Open in IMG/M
3300027895|Ga0209624_10385457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium934Open in IMG/M
3300027911|Ga0209698_11007917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii621Open in IMG/M
3300027965|Ga0209062_1225069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium671Open in IMG/M
3300028047|Ga0209526_10966439Not Available512Open in IMG/M
3300028146|Ga0247682_1035522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium889Open in IMG/M
3300028806|Ga0302221_10266143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium748Open in IMG/M
3300028879|Ga0302229_10388617Not Available621Open in IMG/M
3300028906|Ga0308309_10440288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1122Open in IMG/M
3300030057|Ga0302176_10290094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium657Open in IMG/M
3300030494|Ga0310037_10193312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium905Open in IMG/M
3300030524|Ga0311357_11813678Not Available507Open in IMG/M
3300030706|Ga0310039_10404185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium502Open in IMG/M
3300030707|Ga0310038_10163026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1096Open in IMG/M
3300031236|Ga0302324_100099512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4934Open in IMG/M
3300031525|Ga0302326_11803737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria801Open in IMG/M
3300031525|Ga0302326_13545173Not Available517Open in IMG/M
3300031544|Ga0318534_10256368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1009Open in IMG/M
3300031549|Ga0318571_10346413Not Available569Open in IMG/M
3300031561|Ga0318528_10783044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii510Open in IMG/M
3300031564|Ga0318573_10752909Not Available523Open in IMG/M
3300031640|Ga0318555_10460376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium689Open in IMG/M
3300031668|Ga0318542_10233531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium933Open in IMG/M
3300031679|Ga0318561_10128089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1353Open in IMG/M
3300031679|Ga0318561_10328191Not Available838Open in IMG/M
3300031682|Ga0318560_10825590Not Available500Open in IMG/M
3300031708|Ga0310686_101332741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii671Open in IMG/M
3300031708|Ga0310686_103726484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4043Open in IMG/M
3300031719|Ga0306917_10078217Not Available2314Open in IMG/M
3300031751|Ga0318494_10631706Not Available626Open in IMG/M
3300031770|Ga0318521_10806816Not Available572Open in IMG/M
3300031777|Ga0318543_10159745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium993Open in IMG/M
3300031778|Ga0318498_10324028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium690Open in IMG/M
3300031781|Ga0318547_10640304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium660Open in IMG/M
3300031782|Ga0318552_10114894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1337Open in IMG/M
3300031798|Ga0318523_10404598Not Available678Open in IMG/M
3300031799|Ga0318565_10501868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium586Open in IMG/M
3300031845|Ga0318511_10289664Not Available739Open in IMG/M
3300031880|Ga0318544_10265082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300031910|Ga0306923_12332692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium533Open in IMG/M
3300032008|Ga0318562_10522757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300032043|Ga0318556_10475400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium654Open in IMG/M
3300032067|Ga0318524_10126873Not Available1279Open in IMG/M
3300032068|Ga0318553_10203288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1032Open in IMG/M
3300032160|Ga0311301_10475006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1868Open in IMG/M
3300032174|Ga0307470_10241464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1186Open in IMG/M
3300032261|Ga0306920_102619891Not Available691Open in IMG/M
3300033818|Ga0334804_053767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1158Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.66%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.48%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.79%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.11%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.42%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.74%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.05%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.05%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.05%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.37%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.37%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.37%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.68%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.68%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.68%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.68%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.68%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.68%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4Host-AssociatedOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012491Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610Host-AssociatedOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024178Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35EnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026998Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes)EnvironmentalOpen in IMG/M
3300026999Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes)EnvironmentalOpen in IMG/M
3300027080Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027965Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028146Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1008313913300001867Forest SoilMRHLVGVMLAIVMAAALYFAASWGYLKLLIGPAGVGRLPAGGGSLL
JGI24738J21930_1012283023300002075Corn RhizosphereMRHLVGVMLAIIMAAALFFAASWGYLKLLIGPTGVVRLPAGGGSLLH
JGIcombinedJ51221_1040992113300003505Forest SoilMSEMRHLVGVMLAIVMAAALFFAASWGYLKLLIGPAGLGRLPAGGGTLLHDHAVLEGF
Ga0062589_10208963813300004156SoilMRHLVGVMLAIIMAAALFFAASWGYLKLLIGPTGVGRLPAGGGSLLHNHAVLEGFGAMLG
Ga0062388_10114259923300004635Bog Forest SoilMRHLLGVVLAIVLAAVIFFAASWGYLKLLIGPARLGALAAGGGSLLRDHA
Ga0062388_10172781423300004635Bog Forest SoilMRHLLGVVLAIVLAAAVFFAASWGYLKLLIGPAGPGTLPGGGGSLLHNHAVLEGFGALL
Ga0066676_1096366523300005186SoilMRHLVGVMLAIVMAAAVYFAASWGYLKLLIGPAGLGRLPGGGGSLLHNHAVLEGF
Ga0070669_10040933823300005353Switchgrass RhizosphereMRHLVGVMLAIVMAAAVFFAASWGYLKLLIGPAGLGRLPAGGGSLLHNH
Ga0070713_10116753513300005436Corn, Switchgrass And Miscanthus RhizosphereMRHLMGVVLAIVLAAAVFFAASWGYLKLLIGPAGPGSGSLPAAGGSLLHNHAV
Ga0070708_100007671153300005445Corn, Switchgrass And Miscanthus RhizosphereMRHLVGVVLAIVLAAAVFFAASWGYLKLLIAPSALGTLPGGGGSLLHNHAVLEGFGALLGVG
Ga0070708_10151538713300005445Corn, Switchgrass And Miscanthus RhizosphereMRHLVGVMLAIVMAAAVFFAASWGYLKLLIGPAGLGRLPAGGGSLLHNHAVLEGFGALLA
Ga0070707_10169224423300005468Corn, Switchgrass And Miscanthus RhizosphereMRHLVGVMLAIVMAAAVFFAASWGYLRLLIGPAGLGRLPAGGGSLLH
Ga0073909_1037847123300005526Surface SoilMRHLVGVMLAIIMAAALFFAASWGYLKLLIGPTGIGRLPAGGGSLLHNHAVLEG
Ga0070730_1054954213300005537Surface SoilMRHLIGVALAIVMAAAVFFAASWGYFKLLSGLAGSGLPGGGGTLIHDHAVLEGLGALL
Ga0066697_1025405223300005540SoilMRHLVGVMLAIVMAAAVFFAASWGYLKLLIGPAGLGRLPGGGGSLLHDHAVLEGFG
Ga0070732_1069974813300005542Surface SoilMRHLIGVGLAMVMAAAVFFAASWGYLKLLTGPARSAVLPAGASSLIHNHAVVEGFAALL
Ga0070763_1019346723300005610SoilMRHLVGVVLAIVLAAAVFFVASWGYLKLLIVPAPGTLPGGGGSLLHNHAVLEGFGA
Ga0075029_10016988213300006052WatershedsMRPAVSFSLWIPKGLSDMRHLVGVILAIVLAAAVFFAASWGYLKLLIGPAGPGRLPGGGGSLLHNHAVLEG
Ga0075432_1031393023300006058Populus RhizosphereMRHLVGVMLAIIMAAALFFAASWGYLKLLIGPTGVGRLPAGGGSLLHNHAVLEG
Ga0070765_10151657013300006176SoilMRHLVGVVLAIVMAAAVFFAASWGYLRLGLGSARLATLPGGGGSLF
Ga0068871_10150127323300006358Miscanthus RhizosphereMRHLMGVVLAIVMTAAIFFAASWGYLKLLIGPAGPGSGALPGAGGSLL
Ga0079220_1171007323300006806Agricultural SoilMRHLVGVMLAVIMAAALYFAASWGYLRLLIGPAGLGRLPAGGGSLLHNHAVLEGFGALLG
Ga0079219_1012831323300006954Agricultural SoilMRHLVGVMLAVIMAAALYFAGSWGYLRLLIGPAGLGRLPAGGGSLLHNHAVLEGF
Ga0105251_1007708913300009011Switchgrass RhizosphereMLAIIMAAALFFAASWGYLKLLIGPTGVGRLPAGGGSLLHNHAVLE
Ga0105240_1175571623300009093Corn RhizosphereMSEMRHLVGVMLAIVMAAALFFAASWGYLKLLIGPAGLGRLPGGGGTLLHDHAVLEGFG
Ga0075423_1028095913300009162Populus RhizosphereMLAIIMAAALFFAASWGYLKLLIGPAGVGRLPAGGGSLLHNHAVLEGFGVMLAVGL
Ga0105241_1233918113300009174Corn RhizosphereMRHLVGVILAIVLAAAIFFAASWGYLKLLIGPAGIGRLPAGGGSLLHNHAVLEGF
Ga0116218_142501513300009522Peatlands SoilMRHLLGVVLAIVLAAAVFFAASWGYLKLLIGPAGPGTLPGGGGSLLHNHA
Ga0116221_110743513300009523Peatlands SoilMSDMRHLVGVALAIVLAAAVFFAASWGYLKLLIGPAPPGALPGGGGSLLHNHAVLEGFG
Ga0116224_1029190823300009683Peatlands SoilMSDMRHLVGVALAIVLAAAVFFAASWGYLKLLIGPAPPGALPGGGGSLLHN
Ga0116217_1027333323300009700Peatlands SoilMRHLLGVVLAIVLAAAVFFAASWGYLKLLIGPAGPGTLPGGGGSLLHNHAVL
Ga0116217_1035383313300009700Peatlands SoilMRHLVGVALAIVLAAVVFFAASWGYLKLLIGPAGPGTLPGGGGSLLHNHA
Ga0116219_1036582113300009824Peatlands SoilMSDMRHLVGVALAIVLAAAVFFAASWGYLKLLIGPAPPGALPGGGGSLLHNHAVLEGFGV
Ga0126380_1204822723300010043Tropical Forest SoilMLAIIMAAALYFAASWGYLKLLIGPVGLGRLPADGGSLLHNHAVLEGF
Ga0099796_1035400413300010159Vadose Zone SoilMSEMRHLVGVMLAIVMAAALFFAASWGYLKLLIGPAGLGRLPGGGGSLLHDHAVLEGFGALLG
Ga0134109_1040454713300010320Grasslands SoilMSEMRHLVGVMLAIVMAAAVFFAVSWGYLKLLIGPAGLGRLPGGGGSLLHNHAVLE
Ga0136449_10080061923300010379Peatlands SoilMRHLVGVLLAIVLAAAVFFAASWGYVKLLLGPLGPLPAGGGSLLHHT
Ga0136449_10339821223300010379Peatlands SoilMRHLLGVVLAIALAAAVFFAASWGYLKLLIGPAGPGTLPGGGGSLLHNHAVL
Ga0137389_1101717613300012096Vadose Zone SoilMRHLVGVVLAVALAAAVFFAASWGYLKLLIAPSALGSLPGGGGSLLHNHGVLEGF
Ga0137364_1009176913300012198Vadose Zone SoilMSDMRHLVGVMLAIIMAAAVFFAASWGYLKLLIGPAGLGRLPGGGGSLLHDHAVLEGFG
Ga0137365_1068225323300012201Vadose Zone SoilMSDMRHLVGVMLAIIMAAAVFFAASWGYLKLLIGPAGLGRLPAGGGSLLHNH
Ga0137380_1069253713300012206Vadose Zone SoilMRHLVGIVLAIVLAAAVFFAASWGYLKLLIGPAGPGSGSLPAAGGSLLHNHAVLEGFG
Ga0137386_1037627623300012351Vadose Zone SoilMSEMRHLVGVMLAIVMAAALFFAASWGYLKLLIGPAGLGRLPGGGGTLL
Ga0157329_101647923300012491Arabidopsis RhizosphereMLAIVMAAALFFAASWGYLKLLIGPTGVGRLPAGGGSLLHNHAVLEGFGVMLG
Ga0157302_1053210413300012915SoilMLAIIMAAALFFAASWGYLKLLIGPVGLGRLPAGGGSLLHDHAVLEGFGALL
Ga0164303_1117865513300012957SoilMRHLVGVILAIILAAAIFLAASWAYLKLLIGPAGVGRLPAGGGSLLHNHA
Ga0164308_1043317513300012985SoilMSEMRHLVGVMLAIVMAAAVFFAASWGYLRLLIGPAGLGRLPAGGG
Ga0182024_1238881223300014501PermafrostMRHLVSVILAIAMAAAVFFAASWGYLKLLTGSGKFGTLPAGGGSLLHDRTVVEGFGAL
Ga0132257_10396976713300015373Arabidopsis RhizosphereMRHLMGVVLAIVMAAAVFFAASWGYLKLLIGPAGPGGRLPAAGGSLLHNHAVLEG
Ga0182036_1052412023300016270SoilMRHLIGVALAIVMGAAVFFAASWGYLKLFIGPARTAVLPAGGGSL
Ga0182036_1129937513300016270SoilMRHLVGVMLAIVMAAALYFAASWGYLKLLIGPAGVGRLPAGGGSLLHNHAV
Ga0182040_1016862213300016387SoilMRHLIGVALAIVMAAAVYFAASWGYLKLLIGPARAGVLPAGGGSLIHDHAVL
Ga0187818_1006572113300017823Freshwater SedimentMRHLIGVALAIVMAAVVFFAGSWGYLKLLTGPARNGVLPAGGSLIHDHAVIEGIVALLAV
Ga0187818_1027461813300017823Freshwater SedimentMRHLLGVVLAIVLAAAVFFAASWGYLKLLIGPAGPGTLPGGGGSLLHNHAVLEGFGALLG
Ga0187824_1037517323300017927Freshwater SedimentMRHLIGVILAIAMAAAVFFAASWGYLKLLIGPAKDGVLPAGGGSLIH
Ga0187814_1030915113300017932Freshwater SedimentMRHVNGVALAIVMAAAVFFAGSWGYLKLLIGPAKGGVLPAGGGSLIHDHAVLEG
Ga0187808_1009598523300017942Freshwater SedimentMRHLIGVALAIVMAAAVFFAASWGYLKLLIGPAKTGVLPAGGGSLIHDHAVLEGFGVLLA
Ga0187783_1018046413300017970Tropical PeatlandMRHLIGVGLAIVMAAMVFFAGSWGYLKLLIGPVRAGVLPAAGGSLIHNHAVL
Ga0187823_1002241613300017993Freshwater SedimentMRHLIGVILAIAMAAAVFFAASWGYLKLLIGPAKDGVLPAGGGSLIHDHAVLEGFGVLL
Ga0187822_1013570323300017994Freshwater SedimentMRHLIGVGLAIVMAAALFFAASWGYLKLLTGPARSDVLSAGVGFLIH
Ga0187805_1049757513300018007Freshwater SedimentMRHVMRHLIGVALAIVMAAAVFFAGSWGYLKLLTGPAKGGVLPAGGGSLIHDHAVLEGFGVLLA
Ga0187890_1071461723300018044PeatlandMRHLIGVVLAIVLAAAVFFAASWGYLKLLTANLYQENLTGPSRFGTLPSAGSGSLLHDRTVL
Ga0187858_1055995513300018057PeatlandMRHLIGVVLAIVMAAAVFFAASWGYLKLLTGSGRFGTLPAGGGSLLHDRTVIEGFG
Ga0187766_1067207723300018058Tropical PeatlandMRHLVGVLLAIVMAAAVFFGASWGYLKLLIAPARGGALPAGGGSLIHSHAV
Ga0187772_1123788223300018085Tropical PeatlandMRHLVGVLLAIVMAAAVFFAASWGYLKLLILPVRGGPLPAGGGSLIHNHAVLEGF
Ga0187770_1145893523300018090Tropical PeatlandMRHLVGVLLAVVLAAAVFFAASWGYVKLLLGPLGPLPAGGGSLLHHTAILEGLGALAGV
Ga0193728_119878823300019890SoilMRHLVGVMLAIVMAAAVFFAASWGYLKLLIGPAGLGRLPGGGGSLLHNQAVLE
Ga0210400_1067584513300021170SoilMRHLIGVALAIVMAAAVFFAASWGYLKLLSGSARGTLPAGSGSLIHNHAVLEGFGV
Ga0213881_1016207823300021374Exposed RockMRHLVGVALAIVLAAAVFFAASWGYLKLLIAPAALGGTLPANGGSLLP
Ga0213875_1013409513300021388Plant RootsMRHLLGVVLAVVLAAVVFFVASWGYLKLLLATAGVGAAPVHGDSLWHAHTELEAFGALL
Ga0210385_1002653643300021402SoilMRHLIGVVLAIVMAAAVFFASSWGYLKLLNAPARVAGVLPAGGGSLIHTHAVIEGL
Ga0210397_1156696923300021403SoilMRHLVGVVLAIVMAAAVFFAASWGYLKLLIGPAGLGRLPAGGGSLLHDHAVLEGFGALL
Ga0210389_1058793513300021404SoilMRHLVGLLLAIVLAAAVFFAASWGYLRLLIGPAGIGALPGGGGSLLHNHAVLEGFGALLG
Ga0193695_108980013300021418SoilMRHLVGVMLAIVMAAAVFFAASWGYLKLLIGPAGLGRLPGGGGSLLHNHAVL
Ga0210390_1127413113300021474SoilMSDMRHLVGVVLAIVLAAAVFFAASWGYLRLLIGPAGLGALPGGGGS
Ga0210398_1115420423300021477SoilMRHLIGVVLAIVMAAAVFFASSWGYLKLLNAPARVAGVLPAGGGSLIHNHA
Ga0210402_1021348633300021478SoilMRHLVGVMLAIVMAAALFFAASWGYLKLLIGPAGLGRLPAGGGTLLHDQAVLEGFGALLGVS
Ga0210410_1110397313300021479SoilMRHLIGVALAIVMAAAVFFAASWGYLKLLSGSARGTLPAGSGSLIHDHAV
Ga0126371_1332613713300021560Tropical Forest SoilMRHLVGLMLAIIMAAALYFAASWGYLKLLIGPVGLGRLPAGGGSLLHNHAVLEGFGAL
Ga0242673_100489423300022716SoilMRHLIGVALAIVIAAAVFFAASWGYLKLLSGSARGTLPAGSGSP
Ga0247694_103285023300024178SoilMRHLVGVMLAIIMAAALFFAASWGYLKLLIGPTGVGRLPAGGGSLLHNHAVLEGFGVMLG
Ga0247669_109420613300024182SoilMRHLVGVMLAIIMAAALFFAASWGYLKLLIGPAGVGRLPAGGGSLLHNHAVLEGFGVM
Ga0247681_106773623300024310SoilMRHLVGVMLAIIMAAALFFAASWGYLKLLIGPTGVGRLPAGGGSLLHNHAVL
Ga0207699_1041949023300025906Corn, Switchgrass And Miscanthus RhizosphereMRHLMGVVLAIVMSAAVFFAASWGYLKLLIGPAGPGSGSLPAAGGSLLHN
Ga0207663_1010323333300025916Corn, Switchgrass And Miscanthus RhizosphereMRHLMGVVLAIVMSAAVFFAASWGYLKLLIGPAGPGSGSLPAAGGSL
Ga0207660_1011078433300025917Corn RhizosphereMRHLVGVMLAIIMAAALFFAASWGYLKLLIGPTGVGRLPAGGGSLLHNHAVLEGFG
Ga0207646_1122851823300025922Corn, Switchgrass And Miscanthus RhizosphereMRHLVGVMLAIVMAAAIFFAASWGYLKLLIGPAGLGRLPGGGGSLLHDHAVLEGFGALL
Ga0207681_1022863113300025923Switchgrass RhizosphereMRHLVGVMLAIVMAAAVFFAASWGYLKLLIGPAGLGRLPAGGGSLLHNHAVLEG
Ga0208369_100806423300026998Forest SoilMRHLLGVALAIIMAAAVFFAGSWGYLKLLSGSAKGTLPAGSGSL
Ga0207949_101771713300026999Forest SoilMRHLIGVALAIVMAAAVFFAASWGYLKLLSGSARGTLPAGSGSLIHNHAVL
Ga0208237_104736323300027080Forest SoilMRHLIGVVLAIVMAAAVFFASSWGYLKLLNAPARVAGVLPAGGGS
Ga0209525_101869713300027575Forest SoilMRHLIGVALAIVLAAAVFFAGSWGYLKLLSVSAKGALPAGDGTLIHNHAVLEG
Ga0208324_111601323300027604Peatlands SoilMRHLLGVVLAIVLAAAVFFAASWGYLKLLIGPAGPGTLPGGGGSLLHNHAVLEGFGA
Ga0209248_1007493723300027729Bog Forest SoilMRHLIGVALAIVMAAAVFFAASWGYLKLLSGSAKGTLPAGSGSLIHDHAV
Ga0209177_1016218523300027775Agricultural SoilMRHLVGVMLAIIMAAALFFAASWGYLKLLIGPAGVGRLPAGGGSLLHNHAVLEGFGA
Ga0209579_1047481623300027869Surface SoilMRHLVGVILAIVMAAAIFFAASWGYLKLLTGPARSAVLPAGSGSLIHDHAVVEGFAALL
Ga0209275_1004786513300027884SoilMRHLIGVALAIVMAAAVFFGGSWGYLKLLGASAKATLPAGSGSLIHDH
Ga0209275_1005186113300027884SoilMRHLVGVVLAIVMAAAVFFAASWGYLRLGLGSARLATLPGGGGSLFSDRNLLEG
Ga0209068_1031274513300027894WatershedsMRHLVGVLLAIVMAAAVFFAASWGYLKLLIGPAGLGTLPAGGGSLLHNHAVLEGF
Ga0209624_1038545723300027895Forest SoilMRHLVGIVLAIVMAAAVFFAASWGFLRLGLGSARPGTLPSGSLFSDRNLLEGF
Ga0209698_1100791713300027911WatershedsMRHLVGVLLAIVMAAAVFFAASWGYLKLLIGPAGLGTLPAGGGSLLHN
Ga0209062_122506913300027965Surface SoilMRHLIGVLLAIVMAAAVFFAASWGYQRLLIVPARVLPAGGGSLLHDRQVLE
Ga0209526_1096643923300028047Forest SoilMRHLIGVALAIVLAAAVFFAGSWGYLKLLSVSAKGTLPAGNGSLI
Ga0247682_103552213300028146SoilMRHLVGVMLAIIMAAALFFAASWGYLKLLIGPTGIGRLPAGGGSLLHNHAVLEGFG
Ga0302221_1026614313300028806PalsaMDMRHLLGVVLAIVLAAAVFFAGSWGYLKLLIGPAKLSALPAGGGSLLHDKAVLEGFGAL
Ga0302229_1038861723300028879PalsaMRHLIGVALAIVMAAAVFFAGSWGYLKLLAGPANRVLPAGGGSLIHDHAVLEGF
Ga0308309_1044028823300028906SoilMRHLVGVMLAIVMAAALYFAASWGYLKLLIGPAGPGRLPAGGGSLLHDHA
Ga0302176_1029009423300030057PalsaMRHLIGVGLAVVMAAAVFFAASWGYLKLLTGSGKFGTLPAGGGSLLHDRTVVEGFG
Ga0310037_1019331213300030494Peatlands SoilMRHLVGIALAIVLAAAVFFAASWGYLKLLIAPAPPGALPGGGGSLLHNHAVLEGFGALL
Ga0311357_1181367823300030524PalsaMRHLIGVALAIVMAAAVFFAGSWGYLKLLPGPANRVLPAGGGSLIHDHAV
Ga0310039_1040418523300030706Peatlands SoilMRHLLGVVLAIALAAAVFFAASWGYLKLLIGPAGPGTLPGGGGSLLHNHAVLEG
Ga0310038_1016302623300030707Peatlands SoilMRHLLGVVLAIVLAAAVFFAASWGYLKLLIGPAGPGTLPGGGGSLLHNHAVLEG
Ga0302324_10009951253300031236PalsaMRHLIGVGLAVVMAAAVFFAASWGYLKLLTGSGKFGTLPAGGGS
Ga0302326_1180373723300031525PalsaMRHVTGVVLAVVLAAAVFFAGSWGYLKLLASPARRGVLPAAGASLIHDHAVIEGFGAL
Ga0302326_1354517313300031525PalsaMRHLIGVALAIVMAAAVFFAGSWGYLKLLAGPANRVLPAGGGSLIHDHAVLEGFGALL
Ga0318534_1025636823300031544SoilMRHLAGVVLAVVMAAAVFFAASWGYLKLLILPAGSGALPVGKISSLRY
Ga0318571_1034641313300031549SoilMRHLIGVALAIVMGAAVFFAASWGYLKLFIGPARTAVLPAGGGSLIHNHAVLE
Ga0318528_1078304413300031561SoilMRHLIGVGLAMVMAAAVFFAASWGYLKLLTGPARSGVLPAGGGTLIHDHA
Ga0318573_1075290913300031564SoilMRHLIGVALAIVMAAAVFFAASWGYQTLLNGPARTGVLPAGGSFIHD
Ga0318555_1046037613300031640SoilMRHLVGVMLAIVMAAALYFAASWGYLKLLIGPAGVGRLPAGGGSLLHNH
Ga0318542_1023353123300031668SoilMRHLVGVMLAIIMAAVLYFAASWGYLKLLIGPAGLGRLPAGGGSLVHNHAVLEGFG
Ga0318561_1012808913300031679SoilMRHLVGVLLAVVMAAAVFFVASWGYLKLRLGPVRGGALPVGGGSLIHNHVVLE
Ga0318561_1032819123300031679SoilMRHLIGVALAIVMAAAVYFAASWGYLKLLIGPARAGVLPAGGGSLIHDHAVLE
Ga0318560_1082559023300031682SoilMRHLVGVMLAIVMAAALYFAASWGYLKLLIGPAGVGRLPAGGGSLLHNHAVLEGFG
Ga0310686_10133274123300031708SoilMRHLLGVVLAIVMAAAVFFAASWGYLKLLIGPAGLGTLPAGGGSLLHDRPVT
Ga0310686_10372648413300031708SoilMRHLVGVVLAIVLAAAVFFAASWGYLKLLIGPAGLGALPGGGGSLLHNHAVLEGFGALLG
Ga0306917_1007821713300031719SoilMRHLIGVALAIVMGAAVFFAASWGYLKLFIGPARTAVLPAGGGSLIHNHAVLEGFGALLA
Ga0318494_1063170623300031751SoilMRHLIGVALAIVMAAAVFFAASWGYLTLLIGPARTGVLPAAGGSLI
Ga0318521_1080681623300031770SoilMRHLIGVALAIVMAAAVFFAASWGYLTLLIGPARTGVLPAGGGSLIH
Ga0318543_1015974523300031777SoilMRHLVGVMLAIVMAAALYFAASWGYLKLLIGPAGVGRLPAGGGSLLHNHAVLEGFGALLGVA
Ga0318498_1032402813300031778SoilMRHLAGVVLAVVMAAAVFFAASWGYLKLLILPAGSGALPVGGGSLLH
Ga0318547_1064030413300031781SoilMRHLLGVILAIVLAVAVFFAASWGYLKLLIGPTGLSGTLPAGGGSLLH
Ga0318552_1011489423300031782SoilMRHLVGVMLAIVMAAALYFAASWGYLKLLIGPAGVGRLPAGGGSLLHNHAVLEGFGALLGGFGLP
Ga0318523_1040459823300031798SoilMRHLIGVALAIVMAAAVYFAASWGYLKLLIGPARAGVLPAGGGSLIHDHAVLEGFGVLLA
Ga0318565_1050186813300031799SoilMRHLVGVGLAIAWAAVVFFAASWGYVKLLIGPAGSGALPAGGGSLLHNHAV
Ga0318511_1028966413300031845SoilMRHLVGLMLAIIMAAALYFAASWGYLKLLIGPAGLGRLPAGGGSLLHDHAVLE
Ga0318544_1026508213300031880SoilMRHLIGVALAIVMAAAVYFAASWGYLKLLIGPARAGVLPAGGGSLIHD
Ga0306923_1233269213300031910SoilMDMRHLVGVGLAIAWAAVVFFAASWGYVKLLIGPAGSGALPAGGGSLLHNHAVLE
Ga0318562_1052275723300032008SoilMRHLIGVGLAMVMAAAVFFAASWGYLKLLTGPARSGVLPAGGGTLIHDHAVVEGF
Ga0318556_1047540023300032043SoilMDMRHLVGVGLAIAWAAVVFFAASWGYVKLLIGPAGSGALPAGGGSLLHNHAVLEGFGVL
Ga0318524_1012687313300032067SoilMRHLIGVALAIVMAAAVFFAASWGYLTLLIGPARTGVLPAAGGSLIHN
Ga0318553_1020328823300032068SoilMRHLIGVALAIVMAAAVFFAASWSYLKLLIGPARTGVLPAGGGSL
Ga0311301_1047500613300032160Peatlands SoilMRHLVGVVLAIVLAAAVFFAASWGYLKLLIGPTPPGTLPGGGGSLLHNHA
Ga0307470_1024146413300032174Hardwood Forest SoilMRHLVGVMLAIVMAAAVFFAASWGYLKLLIGPAGLGRLPAGGGSL
Ga0306920_10261989113300032261SoilMRHLVGVMLAIIMAAALYFAASWGYLKLLIGPAGLGRLPAGGGSLVHNHAVIEGFGA
Ga0334804_053767_1_1503300033818SoilMRHLVGVLLAIVMAAVVFFAASWGYLKLLSGAGRPGALPANGGSLLHHRT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.