NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049972

Metagenome / Metatranscriptome Family F049972

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049972
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 38 residues
Representative Sequence MIPIHDTAAGVTFAVKVHPRARKNAITGELGDALK
Number of Associated Samples 131
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 62.07 %
% of genes near scaffold ends (potentially truncated) 96.58 %
% of genes from short scaffolds (< 2000 bps) 82.88 %
Associated GOLD sequencing projects 129
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.890 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.644 % of family members)
Environment Ontology (ENVO) Unclassified
(23.288 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.521 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 12.70%    Coil/Unstructured: 87.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF01168Ala_racemase_N 53.42
PF03169OPT 12.33
PF02594DUF167 2.74
PF14279HNH_5 1.37
PF13531SBP_bac_11 0.68
PF13662Toprim_4 0.68
PF04368DUF507 0.68
PF13701DDE_Tnp_1_4 0.68
PF00583Acetyltransf_1 0.68
PF07676PD40 0.68
PF13537GATase_7 0.68
PF13520AA_permease_2 0.68
PF01844HNH 0.68
PF02910Succ_DH_flav_C 0.68
PF030614HBT 0.68
PF00156Pribosyltran 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG1297Predicted oligopeptide transporter, OPT familyGeneral function prediction only [R] 12.33
COG1872Uncharacterized conserved protein YggU, UPF0235/DUF167 familyFunction unknown [S] 2.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.89 %
UnclassifiedrootN/A4.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004091|Ga0062387_101495716All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300004633|Ga0066395_10210321All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1023Open in IMG/M
3300005167|Ga0066672_10323712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1004Open in IMG/M
3300005330|Ga0070690_100066828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2328Open in IMG/M
3300005454|Ga0066687_10175871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1151Open in IMG/M
3300005534|Ga0070735_10766684All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300005566|Ga0066693_10135587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae915Open in IMG/M
3300005568|Ga0066703_10156577All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1370Open in IMG/M
3300005602|Ga0070762_11068844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae555Open in IMG/M
3300005764|Ga0066903_101663110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1214Open in IMG/M
3300005764|Ga0066903_104409925All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300005764|Ga0066903_108343122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter529Open in IMG/M
3300005841|Ga0068863_100165826All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2118Open in IMG/M
3300006028|Ga0070717_11810950Not Available552Open in IMG/M
3300006052|Ga0075029_100695325All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300006059|Ga0075017_100995215All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300006162|Ga0075030_100130617All Organisms → cellular organisms → Bacteria2038Open in IMG/M
3300006163|Ga0070715_10122083All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300006163|Ga0070715_10835290All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300006806|Ga0079220_11563536All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300006893|Ga0073928_10065811All Organisms → cellular organisms → Bacteria3170Open in IMG/M
3300009623|Ga0116133_1088585All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300009634|Ga0116124_1148343All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345656Open in IMG/M
3300009643|Ga0116110_1036226All Organisms → cellular organisms → Bacteria → Acidobacteria1825Open in IMG/M
3300009646|Ga0116132_1158306All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300009665|Ga0116135_1025164All Organisms → cellular organisms → Bacteria2036Open in IMG/M
3300009665|Ga0116135_1028383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1917Open in IMG/M
3300009698|Ga0116216_10275508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1027Open in IMG/M
3300010339|Ga0074046_10159751All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300010341|Ga0074045_10041488All Organisms → cellular organisms → Bacteria3385Open in IMG/M
3300010358|Ga0126370_11508119All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300010366|Ga0126379_12335585All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300010379|Ga0136449_101443707All Organisms → cellular organisms → Bacteria → Acidobacteria1058Open in IMG/M
3300010391|Ga0136847_10088667All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300010937|Ga0137776_1012493All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300010937|Ga0137776_1856819All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300011271|Ga0137393_11752416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300012683|Ga0137398_10055289All Organisms → cellular organisms → Bacteria2368Open in IMG/M
3300012923|Ga0137359_11433303All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012925|Ga0137419_10432749All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300012958|Ga0164299_11621891All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300012984|Ga0164309_10352466All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1081Open in IMG/M
3300012986|Ga0164304_10832832All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300014156|Ga0181518_10054722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2377Open in IMG/M
3300014159|Ga0181530_10004306All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis15198Open in IMG/M
3300014200|Ga0181526_10082066All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2055Open in IMG/M
3300014325|Ga0163163_12605094All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300014654|Ga0181525_10651225All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300014658|Ga0181519_10454374All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300014968|Ga0157379_12582064All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300014969|Ga0157376_10026684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4567Open in IMG/M
3300014969|Ga0157376_10990367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae863Open in IMG/M
3300014969|Ga0157376_11954019Not Available624Open in IMG/M
3300015371|Ga0132258_12679770All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1244Open in IMG/M
3300015371|Ga0132258_12890004All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300015373|Ga0132257_102174488All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300016750|Ga0181505_10015848All Organisms → cellular organisms → Bacteria1854Open in IMG/M
3300017934|Ga0187803_10452798All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300017943|Ga0187819_10556934All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300017955|Ga0187817_10052477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2515Open in IMG/M
3300017959|Ga0187779_10679779All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300017972|Ga0187781_10394661All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300017975|Ga0187782_10200303All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1493Open in IMG/M
3300017996|Ga0187891_1260667All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300018020|Ga0187861_10243812All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300018020|Ga0187861_10382078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300018029|Ga0187787_10288039All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300018044|Ga0187890_10862407All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300018086|Ga0187769_10138386All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1776Open in IMG/M
3300018086|Ga0187769_10870544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium681Open in IMG/M
3300018088|Ga0187771_11008269All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300018088|Ga0187771_11054216All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300019880|Ga0193712_1000081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae14432Open in IMG/M
3300019887|Ga0193729_1012015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3886Open in IMG/M
3300020579|Ga0210407_11459878Not Available506Open in IMG/M
3300020581|Ga0210399_10518809All Organisms → cellular organisms → Bacteria → Acidobacteria990Open in IMG/M
3300020582|Ga0210395_11255569All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300020583|Ga0210401_11319925All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300021171|Ga0210405_10225006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1486Open in IMG/M
3300021406|Ga0210386_11196656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300021420|Ga0210394_11559962All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300021433|Ga0210391_10042506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3631Open in IMG/M
3300021439|Ga0213879_10281836All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300021475|Ga0210392_10574079All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300021479|Ga0210410_10285367All Organisms → cellular organisms → Bacteria1481Open in IMG/M
3300021559|Ga0210409_10679238All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300021560|Ga0126371_11026770All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis965Open in IMG/M
3300021560|Ga0126371_12461010All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300022557|Ga0212123_10203170All Organisms → cellular organisms → Bacteria1467Open in IMG/M
3300024225|Ga0224572_1005583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2247Open in IMG/M
3300024295|Ga0224556_1167311All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300025915|Ga0207693_10159841All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1772Open in IMG/M
3300025921|Ga0207652_11641903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300025928|Ga0207700_12043792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300025939|Ga0207665_11327829All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae573Open in IMG/M
3300026089|Ga0207648_10120660All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2305Open in IMG/M
3300026305|Ga0209688_1063583All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300026309|Ga0209055_1113874All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300026469|Ga0257169_1049430All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300026552|Ga0209577_10681284All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300027641|Ga0208827_1077229All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1039Open in IMG/M
3300027667|Ga0209009_1131522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300027737|Ga0209038_10274962All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300027824|Ga0209040_10476843All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300027825|Ga0209039_10245675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300027842|Ga0209580_10346241All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300027846|Ga0209180_10170939All Organisms → cellular organisms → Bacteria1253Open in IMG/M
3300027879|Ga0209169_10719241All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300027894|Ga0209068_10461438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium730Open in IMG/M
3300027895|Ga0209624_10517822All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium794Open in IMG/M
3300027903|Ga0209488_10055833All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2911Open in IMG/M
3300027911|Ga0209698_11045373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300028759|Ga0302224_10109835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1065Open in IMG/M
3300028774|Ga0302208_10144363All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300029915|Ga0311358_10210464All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1753Open in IMG/M
3300029915|Ga0311358_11103835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300030019|Ga0311348_10596810All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium824Open in IMG/M
3300030399|Ga0311353_11677228All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300030580|Ga0311355_10783312All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300030688|Ga0311345_11005359All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300030706|Ga0310039_10027030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2697Open in IMG/M
3300030815|Ga0265746_1026814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300030991|Ga0073994_12201751All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300031712|Ga0265342_10511260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300031715|Ga0307476_10234254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1338Open in IMG/M
3300031715|Ga0307476_11065465All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300031718|Ga0307474_10122121All Organisms → cellular organisms → Bacteria1956Open in IMG/M
3300031720|Ga0307469_10230049All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1474Open in IMG/M
3300031753|Ga0307477_10027368All Organisms → cellular organisms → Bacteria → Acidobacteria3897Open in IMG/M
3300031754|Ga0307475_11213430All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300031821|Ga0318567_10897657All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031823|Ga0307478_10100653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2237Open in IMG/M
3300031902|Ga0302322_100218402All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2094Open in IMG/M
3300031902|Ga0302322_101600348All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300031941|Ga0310912_10457782All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300031945|Ga0310913_11005217Not Available584Open in IMG/M
3300032174|Ga0307470_10524618All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium869Open in IMG/M
3300032828|Ga0335080_11172975All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300033158|Ga0335077_10014861All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis9727Open in IMG/M
3300033289|Ga0310914_10232278All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1654Open in IMG/M
3300033402|Ga0326728_10238292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1755Open in IMG/M
3300033405|Ga0326727_10945498All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300033433|Ga0326726_12092810All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300034065|Ga0334827_003613All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis7480Open in IMG/M
3300034125|Ga0370484_0215850Not Available527Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.48%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.79%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.11%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.11%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.11%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.42%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.42%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.42%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.74%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.74%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.74%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.05%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.05%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.05%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.05%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.05%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment1.37%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.37%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.37%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.37%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.37%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.37%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.37%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.37%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.68%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.68%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.68%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.68%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.68%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019880Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028774Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3EnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062387_10149571613300004091Bog Forest SoilMVVIQKSPNGATFAVKVQPRAKKNAITGEVGDAVKLSLTA
Ga0066395_1021032123300004633Tropical Forest SoilMTTIRDSLAGATFSIRLHPRAKKNAITGEVDDGLKVSLTAPP
Ga0066672_1032371213300005167SoilMVTIHDTPSAATFVVKVHPRAKKNAITGEIGDALSLTPPPI
Ga0070690_10006682813300005330Switchgrass RhizosphereVITVHETAEGVTFAVKLQPRARRDAIVGELGGALKLSLTAPP
Ga0066687_1017587113300005454SoilVDVLVIPINDSPSGATFAVKVHPRAKKNGITGEIGDALKL
Ga0070735_1076668413300005534Surface SoilMFAIHEHDSTITFAVKVHPRAKKNAITGEFRDALKVSLTSPPVE
Ga0066693_1013558713300005566SoilMITIHNVPGGASFAIKVHPRAKMNAITGELGNVLKLA
Ga0066703_1015657713300005568SoilVIPIHDTAAGATFVVKVHPRAKKNAITGTVGDAIKLALTAPP
Ga0070762_1106884413300005602SoilMFRIRERRGGVSLVVRVHPRAKRNAITGEFGDALKVSLTAPA
Ga0066903_10166311033300005764Tropical Forest SoilVIPVKQSASGVTFAVRLHPRARKDQITGQAGDALKLSL
Ga0066903_10440992523300005764Tropical Forest SoilMIPVRDHLDGASFAVKVHPRAKHDRISGAIGDALK
Ga0066903_10834312223300005764Tropical Forest SoilVIPIRESDGGVSFAVKVQARARKNAITGELGDALKLA
Ga0068863_10016582613300005841Switchgrass RhizosphereMIPIHDTAQGASFAVKVHPRAKKNAITGELGDALKL
Ga0070717_1181095023300006028Corn, Switchgrass And Miscanthus RhizosphereMIKVQNGSQGVWFAVRVHPRAKKDAITGELGDALK
Ga0075029_10069532523300006052WatershedsVIPIHDTPAGATFQVKVHPRARKSGITGVVGDVLK
Ga0075017_10099521513300006059WatershedsVIKVQDGSQGVSFAVKVHPRAKKDAITGELGDALKVSLTTP
Ga0075030_10013061713300006162WatershedsMISIHETASGSTFAVKVHPGASKNAITGELGGALKVSLTA
Ga0070715_1012208333300006163Corn, Switchgrass And Miscanthus RhizosphereMIPIHESALGATFAVKVHPRARKNAITGESGDALRLSLT
Ga0070715_1083529013300006163Corn, Switchgrass And Miscanthus RhizosphereSLIPLQESGGVTFAVKVHPRAKKSEITGELGDALKVSLTAPPNRRQSK*
Ga0079220_1156353623300006806Agricultural SoilMIPVRESGVSVSFAVKVQPRARKNAIDGVLGDALKLPVT
Ga0073928_1006581143300006893Iron-Sulfur Acid SpringMIPVNDGPGGATFAVKVHPRANKTSITGELGEALKVS
Ga0116133_108858523300009623PeatlandLIPIYEAAGGVTFAVKVHPRAKKNAITGELGDALKISLTAA
Ga0116124_114834313300009634PeatlandLTSIRDTPGGATFQVKVQPRSKKNAIIGEVGEALKLGLTAP
Ga0116110_103622613300009643PeatlandMIPVRDTPSGATFQVKVHPRAKKNSITGEAGDALKLA
Ga0116132_115830613300009646PeatlandLIPIRESASGATFAIKVHPRAKKNAITGELDGALKLSLTAP
Ga0116135_102516413300009665PeatlandLIPIYEAAGGVTFAVKVHPRAKKNAITGELGDALKIS
Ga0116135_102838313300009665PeatlandMMAIQNSPAGATFAVKVHPRAKKNAITGEIGEALKLSLL
Ga0116216_1027550833300009698Peatlands SoilMSKVVTVHEGAGGASFVVRVHPRANKNAITGELGDALKVSLT
Ga0074046_1015975113300010339Bog Forest SoilMLEFKESPAGTTFALKVHPRAKKNAITGEVGDALKRA
Ga0074045_1004148833300010341Bog Forest SoilMVAIQNSPTGVTFAVKVHPRAKKNAITGEVGDALKL
Ga0126370_1150811923300010358Tropical Forest SoilMIPLKQTSAGISFTVKVHPRARKNAITGTFGDALKLA
Ga0126379_1233558523300010366Tropical Forest SoilMIPLKQTSAGISFAVKVHPRARKNAITGTLGDALK
Ga0105239_1127715723300010375Corn RhizosphereMIPISENDAGVSFAIKVHPRAKKAGIMGELGDALKVSLTA
Ga0136449_10144370733300010379Peatlands SoilMIPVRDTPFGATFQVKVHPRARKNTITGEVADALKLALTAPAT
Ga0136847_1008866723300010391Freshwater SedimentMISISDTPSGATFAVRLHPRARKNAITGALGDALKI
Ga0137776_101249323300010937SedimentMIPVRDTASGATFQVKVHPRAKKNAITGEIGDALKV
Ga0137776_185681913300010937SedimentMIPIRENSGAVSFAVKVHPRAKKDAITGELGDALKVALNAP
Ga0137393_1175241613300011271Vadose Zone SoilLIPIQESSGSVTFAVKIHPRAKKNAIMGELGDALKLSL
Ga0137398_1005528913300012683Vadose Zone SoilMAVVKNSPAGVTFAVKVHPRAKKNAITGQVGDTLKL*
Ga0137359_1143330313300012923Vadose Zone SoilMTIPIATSAAGVSFKIKVHPRAKKNAITGTVGDALKVSVTAP
Ga0137419_1043274913300012925Vadose Zone SoilMIPIHDTAAGATFVVKVHPHAKKNAITGELGEALKV
Ga0164299_1162189123300012958SoilMFSITDGPAGVTFAIKLHPRARKNAITGELGGTLK
Ga0164309_1035246613300012984SoilMIPVHETPLGVTFAVKVHPRARKSAITGELGDALKVS
Ga0164304_1083283223300012986SoilMLSIEKGPEGITFAVKIHPRARKNAITGELGGALK
Ga0181518_1005472213300014156BogMAAIKNAPNGATFAVKVHPRAKRNAITGEVGDAIK
Ga0181530_1000430613300014159BogVISIRGTPQGATFAIRVQPRARKNAIIGELGDALKLAL
Ga0181526_1008206633300014200BogMIPIHETAGGATLAVKVHPRAKKNAVTGELGDALKLALTAP
Ga0163163_1260509423300014325Switchgrass RhizosphereMFSIRDDSTGVGFAVRVHPRAKKNAITGILGDALK
Ga0181525_1065122513300014654BogMVTMQESERGVTFAVKVHPRAKKNAITGELGGALKV
Ga0181519_1045437423300014658BogMAFIREDEAGATFAIKVHPRAKKNAITGEVGDALK
Ga0157379_1258206423300014968Switchgrass RhizosphereLIKIAETAGCVSFAVKVHPRAKKNAITGEVGEALKVAL
Ga0157376_1002668413300014969Miscanthus RhizosphereMIPIYDTAQGASFAVKVHPGAKKNAITGELGDALKLAL
Ga0157376_1099036713300014969Miscanthus RhizosphereMIPIHDTAQGASFAVKVRPGAKKNAITGELGVALK
Ga0157376_1195401913300014969Miscanthus RhizosphereMIPVRETALGATFAVKVHPRARKTAVTGIFGDGPEAAIKV
Ga0132258_1267977013300015371Arabidopsis RhizosphereMIPVRETALGATFAVKVHPRAKKTAVTGIFGEGPDAA
Ga0132258_1289000423300015371Arabidopsis RhizosphereMLSIERGPEGITFAVKIHPRARKNAITGDLAGALKLSLT
Ga0132257_10217448823300015373Arabidopsis RhizosphereMLSIERGPEGITFAVKIHPRARKNAIAGDLAGALKLSL
Ga0181505_1001584853300016750PeatlandMIPIGQTAVGVTFAVKVHPRAKKNAITGEVGNALKLALTAP
Ga0187803_1045279823300017934Freshwater SedimentLIPIHESPSGVTFAVKVHPRARKNAIAGELGNALKLSLTSP
Ga0187819_1055693423300017943Freshwater SedimentVIPIRDTPQGATFAVHVQPRARKNAIVGELGGALKLA
Ga0187817_1005247733300017955Freshwater SedimentMTAIKDSPNGATFAVKVHPRAKKNAITGEVGEALKL
Ga0187779_1067977923300017959Tropical PeatlandMIPLHVSPDSVSFAVKVQPRARKNGVTGELGDALKLALT
Ga0187781_1039466133300017972Tropical PeatlandMIPILEHESSVSFGVRVHPRAKKNAITGEVGDALK
Ga0187782_1020030313300017975Tropical PeatlandMIPVRDTAQGATFAVKVHPRAKKNAIAGEIGDALKLALTAP
Ga0187891_126066723300017996PeatlandMAVIQNSANGAAFAVKVHPRAKKNAITGEVGDALKLSLTA
Ga0187861_1024381213300018020PeatlandMIPVHDSNAGATFAVRVHPRAKKNAITGELDGALK
Ga0187861_1038207813300018020PeatlandMAAIKNAPNGATFAVKVHPRAKRNAITGEVGDAIKLALTA
Ga0187787_1028803923300018029Tropical PeatlandMIPIKDTPSGATFSVRVFPRAKRNAITGEIGDALKVSLT
Ga0187890_1086240723300018044PeatlandVIPIHESGGGVTFAIKVHPRARKNTITGELGDALKLSIT
Ga0187769_1013838633300018086Tropical PeatlandMIPIHESNAGVRFTVKVHPRAKKNAITGELGDALKVSLT
Ga0187769_1087054413300018086Tropical PeatlandLILIQESGGGVTFAVKVYPRARKNAITGELGDALK
Ga0187771_1100826913300018088Tropical PeatlandMISIRENDGAVSFAVRVHPRAKKNAITGQLGDALKVS
Ga0187771_1105421623300018088Tropical PeatlandMISIQEGNTGVTFAVRVHPRAKKNAITGELGDALKV
Ga0193712_100008133300019880SoilMVSVHDTSAGVTFALKVHPRAKRNAISGEVGDALKSR
Ga0193729_101201513300019887SoilMVAIQNSAKGATFAVKVHPRAKKNAITGEAGDALKLALT
Ga0210407_1145987813300020579SoilMIPIRDSASGASFAVRVHPRAKKTAITGILGEGADTTLK
Ga0210399_1051880923300020581SoilVISIAESRGAVTFAVKVHPRARKNSITGELGGALKLSLT
Ga0210395_1125556923300020582SoilMISLREGGGAVSFSVRVHPRAKKNGITGEMGDALKLSLTTPS
Ga0210401_1131992513300020583SoilMFAVAETASCVTFAVKVHPRARKNTITGELGDALKVSLTSP
Ga0210405_1022500613300021171SoilMLAIRENADGVSFAVRVHPRAKKNAITGELGDALKV
Ga0210386_1119665623300021406SoilMIPLFESDCGTSFAVKVHPRAEKNAITGEFGDALKVSLT
Ga0210394_1155996213300021420SoilMFAIQETAGGVTFAVKIHPLAKKNAITGEFGDALKV
Ga0210391_1004250613300021433SoilMLLIHESDGGVSFAVKVRPRARKNAITGELGGALKV
Ga0213879_1028183613300021439Bulk SoilMIPLHETPAGVTIAVKIQPRAKKNALIGVVGDALKLALTA
Ga0210392_1057407913300021475SoilMIPVHDTSAGVAFAVKVQPRARKNTITGTVGDALK
Ga0210410_1028536723300021479SoilMIKVQDGNQGVSFAVKVHPRAKKDAITGEFGDALKVSLTT
Ga0210409_1067923813300021559SoilMIAINDSPEGVTFAVKIHPRAKKNAVTGTVGDALKLSLIA
Ga0126371_1102677013300021560Tropical Forest SoilMILLRQTSSGITFAVKVQPRARKNAITGTLGDALKLALT
Ga0126371_1246101023300021560Tropical Forest SoilMLPIHDTPAGATFQVKVQPRARKNAITGALGDALKLALTA
Ga0212123_1020317013300022557Iron-Sulfur Acid SpringMIPVNDGPGGATFAVKVHPRANKTSITGELGEALKVSVTSAPAD
Ga0224572_100558333300024225RhizosphereMIPLHESGGGITFVVKVHPRARKNVITGELGDALKLS
Ga0224556_116731123300024295SoilMVALQSSPSGVTFAVKVHPRAKKNGITGEVGDALK
Ga0207693_1015984113300025915Corn, Switchgrass And Miscanthus RhizosphereMIPISENATGVTFAIKVHPRAKRAAITGELGDALKVSLTAPPLE
Ga0207652_1164190313300025921Corn RhizosphereVIPIRESTDGLTFSVRVRPRAKKTAITGEVGDSLKVA
Ga0207700_1204379223300025928Corn, Switchgrass And Miscanthus RhizosphereLINVIETDDAVSFVVKVHPRAKKNAITGELGDAIKL
Ga0207665_1132782933300025939Corn, Switchgrass And Miscanthus RhizosphereMIPARESDDGVTFFVKVQPRAKRDAIIGELGDALKVALRAPAIE
Ga0207648_1012066033300026089Miscanthus RhizosphereMVAIQELANDVTFGVKVHPRAKKNAITGEIGDSLK
Ga0209688_106358313300026305SoilMITIHNVPGGASFAIKVHPRAKMNAITGELGNVLKLALAA
Ga0209055_111387423300026309SoilMIKVQDGIQGVTFAVKVHPRAKKDAITGELGDALKVSLT
Ga0257169_104943023300026469SoilMVAIQNSANGATFAVKVHPRAKKNAITGELGDALK
Ga0209577_1068128413300026552SoilVIPIRQLGGGVTFAVKVHPRAGKNAIIGELGNALKVSLTS
Ga0208827_107722913300027641Peatlands SoilMIPIHDSPAGATFAVKVHPRAKKNAIGGELGDALKLALTAP
Ga0209009_113152213300027667Forest SoilLIPIHESRSGVTFAVKVLSRAKGNAITGELGQALK
Ga0209038_1027496223300027737Bog Forest SoilMIPIKESKSGTTFAIKVHPRAKKNAITGIVGDALK
Ga0209040_1047684313300027824Bog Forest SoilVIPIRDTEASATFAVKVHPRAKKNAITGEMGDALK
Ga0209039_1024567513300027825Bog Forest SoilLIAIQEYGDAVTFAVKVHPRAKKNAITGEFGEALKLSLTS
Ga0209580_1034624133300027842Surface SoilLIPVNQTDDGATFAVKAHPRAKKNAITGELGDALKVSLTTP
Ga0209180_1017093913300027846Vadose Zone SoilMIPIHDTAAGVTFAVKVHPRARKNAITGELGDALK
Ga0209169_1071924113300027879SoilMIPVHEAARGVSFSIRVHPRAKKNAITGEIGDALKISL
Ga0209068_1046143813300027894WatershedsMIPIHDTPAGATFEVKVHPRAKKNAITGEFGDALKLAL
Ga0209624_1051782233300027895Forest SoilVIPVQDTPGGAFFAVKVHPRARKNAITGELGDVLKVSLTSP
Ga0209488_1005583313300027903Vadose Zone SoilMAVVKNSPAGVTFAVKVHPRAKKNAITGQVGDALA
Ga0209698_1104537313300027911WatershedsVPPVVKTSMVAIQNSPSGAAFEVKIHPRAKRNAITGEVGDALKL
Ga0302224_1010983513300028759PalsaMAAIKDVSNGSTFAVKVHPRARKNAITGAVGEALKV
Ga0302208_1014436313300028774FenMTPIRDTPSGATFQVKVHPRARKNAITGVVGEALK
Ga0311358_1021046413300029915BogMIPMQESRGSVTFAVKVHPRAKNNGITGEIAGTLKLSLTS
Ga0311358_1110383513300029915BogMVAIQSSPTGVTFAVKLHPRAKKNGVTGEVGDALKLSLT
Ga0311348_1059681033300030019FenMIPVRDTPSGATFQVKVHPRARKNAITGVVGEALKLSL
Ga0311353_1167722813300030399PalsaVVHLQELDNAVTFCAKVHPRAKKNGITGEIGDALKVSL
Ga0311355_1078331233300030580PalsaLIPIHESAGAVTFEVKVHPRARKNAITGELGGALKLS
Ga0311345_1100535923300030688BogMAFIREDEAGATFAIKVHPRAKKNAITGEVGDALKVSLS
Ga0310039_1002703013300030706Peatlands SoilVIPLNESSGGVTFAVKVHPRAKKNAITGEFGDALKVS
Ga0265746_102681413300030815SoilLIPIQESNGSVTFAVKVHPRARKNTITGELGNALKV
Ga0073994_1220175113300030991SoilLIPVQQTGDGISFAVKIHPRAKKNAITGVLGDALQVSL
Ga0265342_1051126023300031712RhizosphereMIPIRDTPSGATFQVKLHPRAKKNAITGEVGEALKVALTA
Ga0307476_1023425443300031715Hardwood Forest SoilLIPFQESNNGVTFAVKVHPRAKKNAITGEVGEALKLSLT
Ga0307476_1106546513300031715Hardwood Forest SoilVIPVHDTPDGAFFAIKVHPRARKNAITGELGDALKVSLT
Ga0307474_1012212113300031718Hardwood Forest SoilLIPIQKSAEGVTFAVRVHPRARKNAVTGTVGDALKI
Ga0307469_1023004933300031720Hardwood Forest SoilMISIHDTPDGATFAIKVHPRARKNAITGELGGALKLSLTAP
Ga0307477_1002736853300031753Hardwood Forest SoilLISVTESGGSVAFSVKVHPHARKNAITGELDGALKV
Ga0307475_1121343013300031754Hardwood Forest SoilVIPIQESRGSVTFAVKVRPRARKNAITGELGDATNLSLT
Ga0318567_1089765713300031821SoilMIPIREDGRGVTFGIKVHPRAKRNAITGELGDALK
Ga0307478_1010065313300031823Hardwood Forest SoilMVAIKNSPDGVTFAVKVHPRAKKNAITGEVGDALKLAL
Ga0302322_10021840213300031902FenMAVIQNSPAGVTFAVKVHPRAKKNAITGEVGDALKLAL
Ga0302322_10160034823300031902FenMIPIRDTRSGATFQVKVHPRARKNAITGVVGDTLK
Ga0310912_1045778223300031941SoilVTLVPIHDTPAGATFQVKVHPRARKNAITGVLGDAIKLALT
Ga0310913_1100521713300031945SoilLIPVHDTPAGATCQVKVHPRARKNAITGVLGDALKLALT
Ga0307470_1052461833300032174Hardwood Forest SoilMPAIREDASGASIQVRIHPRAKKNGITGDLGDALKVS
Ga0335080_1117297523300032828SoilMIPLHESSSVVTFAIKVHPRAKKNGITGEIRDALK
Ga0335077_1001486113300033158SoilMIPVRQTAAGVTFSVKIHPRAKKNAVTGELDDALKVSLTAPPTE
Ga0310914_1023227813300033289SoilMIKIAESRQGVSFAVKVHPRAKKNAITGELGEALK
Ga0326728_1023829213300033402Peat SoilMIPVRQHDSEISFQIRVHPRAKKNAITGEVGDALKLT
Ga0326727_1094549823300033405Peat SoilVIPIRDTAQGATFAVKVHPRAKKNAVSGEVGEALKVSLTAPP
Ga0326726_1209281023300033433Peat SoilVVPINDTPSGATFTVRLHPRAKKNAITGTLGDALKISL
Ga0334827_003613_3_1073300034065SoilMIAIQSSPGGATFAVKVHPRAKKNAITGEVGDALK
Ga0370484_0215850_3_1073300034125Untreated Peat SoilMIAIQENDGGVSFAVRVHPRAKKNAITGELGDALK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.