NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050067

Metagenome / Metatranscriptome Family F050067

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050067
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 171 residues
Representative Sequence ECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSEEREKFLKHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Number of Associated Samples 89
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.38 %
% of genes near scaffold ends (potentially truncated) 96.55 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(71.034 % of family members)
Environment Ontology (ENVO) Unclassified
(37.931 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(95.862 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 62.81%    β-sheet: 0.00%    Coil/Unstructured: 37.19%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF02755RPEL 0.69



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300010198|Ga0127509_1228863All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes684Open in IMG/M
3300010200|Ga0127507_1001187All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes758Open in IMG/M
3300010200|Ga0127507_1004120All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata852Open in IMG/M
3300016728|Ga0181500_1389410All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata500Open in IMG/M
3300020070|Ga0206356_10629894All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata513Open in IMG/M
3300020082|Ga0206353_10287456All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata665Open in IMG/M
3300030528|Ga0210277_10701855All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata828Open in IMG/M
3300030532|Ga0210290_1266121All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata609Open in IMG/M
3300030532|Ga0210290_1595104All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata672Open in IMG/M
3300030539|Ga0210281_1152874All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata517Open in IMG/M
3300030539|Ga0210281_1521170All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata500Open in IMG/M
3300030546|Ga0247646_1108838All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes696Open in IMG/M
3300030546|Ga0247646_1123040All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata670Open in IMG/M
3300030547|Ga0247656_1087246All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata669Open in IMG/M
3300030555|Ga0247618_1115452All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata585Open in IMG/M
3300030566|Ga0257186_1045306All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata766Open in IMG/M
3300030569|Ga0247628_1231334All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata542Open in IMG/M
3300030572|Ga0210258_10222500All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata508Open in IMG/M
3300030575|Ga0210288_1227900All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata536Open in IMG/M
3300030579|Ga0247633_10268599All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata543Open in IMG/M
3300030583|Ga0210262_1079622All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata739Open in IMG/M
3300030583|Ga0210262_1108009All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata680Open in IMG/M
3300030590|Ga0247643_1133692All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes576Open in IMG/M
3300030591|Ga0247626_1169467All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata609Open in IMG/M
3300030592|Ga0247612_1141084All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata589Open in IMG/M
3300030594|Ga0210280_1109433All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata611Open in IMG/M
3300030595|Ga0210276_10216754All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata580Open in IMG/M
3300030596|Ga0210278_1222409All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata500Open in IMG/M
3300030614|Ga0247657_10214632All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata562Open in IMG/M
3300030615|Ga0257185_10194605All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata668Open in IMG/M
3300030625|Ga0210259_10668396All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata742Open in IMG/M
3300030625|Ga0210259_11458325All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata631Open in IMG/M
3300030626|Ga0210291_10372414All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes553Open in IMG/M
3300030626|Ga0210291_11124359All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata843Open in IMG/M
3300030630|Ga0210282_10350990All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata536Open in IMG/M
3300030631|Ga0210279_10256186All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata652Open in IMG/M
3300030633|Ga0247623_10089985All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata755Open in IMG/M
3300030738|Ga0265462_10647566All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata818Open in IMG/M
3300030738|Ga0265462_10721073All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata793Open in IMG/M
3300030738|Ga0265462_11132592All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata690Open in IMG/M
3300030738|Ga0265462_11671244All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata603Open in IMG/M
3300030740|Ga0265460_11178084All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes731Open in IMG/M
3300030740|Ga0265460_11450510All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata680Open in IMG/M
3300030740|Ga0265460_12245054All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata575Open in IMG/M
3300030741|Ga0265459_11162028All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata837Open in IMG/M
3300030741|Ga0265459_11425084All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata783Open in IMG/M
3300030741|Ga0265459_12102287All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata681Open in IMG/M
3300030743|Ga0265461_10806318All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata880Open in IMG/M
3300030743|Ga0265461_12140032All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata645Open in IMG/M
3300030748|Ga0074043_11409678All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata590Open in IMG/M
3300030777|Ga0075402_10754282All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata739Open in IMG/M
3300030799|Ga0074010_10661446All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata528Open in IMG/M
3300030840|Ga0074020_11219923All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata696Open in IMG/M
3300030841|Ga0075384_10506504All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata525Open in IMG/M
3300030842|Ga0075404_10911049All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata651Open in IMG/M
3300030842|Ga0075404_11468655All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata505Open in IMG/M
3300030848|Ga0075388_10737091All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata536Open in IMG/M
3300030848|Ga0075388_11626005All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata687Open in IMG/M
3300030850|Ga0075387_11439786All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata789Open in IMG/M
3300030852|Ga0075389_11473667All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes616Open in IMG/M
3300030853|Ga0075372_11328625All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes560Open in IMG/M
3300030854|Ga0075385_10849532All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata564Open in IMG/M
3300030854|Ga0075385_11409114All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata678Open in IMG/M
3300030854|Ga0075385_11811042All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata795Open in IMG/M
3300030855|Ga0075374_11315569All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes779Open in IMG/M
3300030858|Ga0102759_1466786All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata622Open in IMG/M
3300030866|Ga0102744_1708791All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata682Open in IMG/M
3300030907|Ga0074013_11713879All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata528Open in IMG/M
3300030911|Ga0102763_11148989All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata723Open in IMG/M
3300030916|Ga0075386_11565978All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata586Open in IMG/M
3300030923|Ga0138296_1263703All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes528Open in IMG/M
3300030933|Ga0074039_10964895All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata504Open in IMG/M
3300030933|Ga0074039_11216120All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata544Open in IMG/M
3300030933|Ga0074039_11568549All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata541Open in IMG/M
3300030934|Ga0075391_11218769All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata692Open in IMG/M
3300030935|Ga0075401_11631743All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata627Open in IMG/M
3300030935|Ga0075401_11858587All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata666Open in IMG/M
3300030935|Ga0075401_11861080All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata540Open in IMG/M
3300030938|Ga0138299_10078788All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata539Open in IMG/M
3300030949|Ga0074031_1025072All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata749Open in IMG/M
3300030970|Ga0075381_10011798All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata754Open in IMG/M
3300030971|Ga0075375_11590334All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata841Open in IMG/M
3300030979|Ga0068589_11192735All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata660Open in IMG/M
3300030980|Ga0074027_11348991All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata606Open in IMG/M
3300030992|Ga0074040_10923712All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata500Open in IMG/M
3300030992|Ga0074040_11374277All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata815Open in IMG/M
3300030992|Ga0074040_11380479All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata739Open in IMG/M
3300030995|Ga0074011_1707979All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata593Open in IMG/M
3300030999|Ga0074019_10799696All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata500Open in IMG/M
3300030999|Ga0074019_10874144All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata722Open in IMG/M
3300030999|Ga0074019_10957636All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes553Open in IMG/M
3300031008|Ga0074038_11671099All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata626Open in IMG/M
3300031013|Ga0102753_1402476All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata614Open in IMG/M
3300031020|Ga0074016_1242940All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata604Open in IMG/M
3300031021|Ga0102765_11116735All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata603Open in IMG/M
3300031021|Ga0102765_11508785All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata682Open in IMG/M
3300031022|Ga0138301_1754202All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes539Open in IMG/M
3300031029|Ga0074012_10010687All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata849Open in IMG/M
3300031029|Ga0074012_10034220All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata564Open in IMG/M
3300031030|Ga0074030_10596442All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata542Open in IMG/M
3300031031|Ga0074042_11392372All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata629Open in IMG/M
3300031031|Ga0074042_11447586All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata804Open in IMG/M
3300031034|Ga0074041_11355392All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata507Open in IMG/M
3300031034|Ga0074041_11403699All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata534Open in IMG/M
3300031034|Ga0074041_11543333All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata691Open in IMG/M
3300031035|Ga0074026_10889010All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes505Open in IMG/M
3300031049|Ga0074036_10542433All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes660Open in IMG/M
3300031050|Ga0074028_11358269All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata609Open in IMG/M
3300031051|Ga0074029_1403089All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata639Open in IMG/M
3300031053|Ga0074018_1733420All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata505Open in IMG/M
3300031055|Ga0102751_1379951All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata590Open in IMG/M
3300031057|Ga0170834_105230469All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes833Open in IMG/M
3300031057|Ga0170834_111047887All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata758Open in IMG/M
3300031057|Ga0170834_111188948All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata868Open in IMG/M
3300031057|Ga0170834_112086426All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata520Open in IMG/M
3300031057|Ga0170834_114116280All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata587Open in IMG/M
3300031122|Ga0170822_10983028All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata543Open in IMG/M
3300031128|Ga0170823_10523408All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes795Open in IMG/M
3300031128|Ga0170823_14829570All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata695Open in IMG/M
3300031231|Ga0170824_103556089All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes1067Open in IMG/M
3300031231|Ga0170824_104095769All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata823Open in IMG/M
3300031231|Ga0170824_116098915All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata625Open in IMG/M
3300031231|Ga0170824_117880986All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes1186Open in IMG/M
3300031231|Ga0170824_123903900All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata603Open in IMG/M
3300031231|Ga0170824_126919868All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes1122Open in IMG/M
3300031231|Ga0170824_127082578All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata560Open in IMG/M
3300031446|Ga0170820_10899402All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes841Open in IMG/M
3300031446|Ga0170820_12743985All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata678Open in IMG/M
3300031446|Ga0170820_12788866All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata719Open in IMG/M
3300031446|Ga0170820_15400240All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata592Open in IMG/M
3300031469|Ga0170819_13068542All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata508Open in IMG/M
3300031469|Ga0170819_14054000All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes857Open in IMG/M
3300031474|Ga0170818_105286172All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata662Open in IMG/M
3300031474|Ga0170818_106031987All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata915Open in IMG/M
3300031474|Ga0170818_107714672All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes501Open in IMG/M
3300031474|Ga0170818_111915641All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes701Open in IMG/M
3300031474|Ga0170818_113478293All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata853Open in IMG/M
3300032739|Ga0315741_10725602All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes857Open in IMG/M
3300032739|Ga0315741_10845859All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata803Open in IMG/M
3300032756|Ga0315742_10983891All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata832Open in IMG/M
3300032756|Ga0315742_11677517All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes691Open in IMG/M
3300032756|Ga0315742_12027245All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata642Open in IMG/M
3300032756|Ga0315742_12269139All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata613Open in IMG/M
3300032756|Ga0315742_13500823All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata507Open in IMG/M
3300033535|Ga0314759_1187499All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Sarcoptiformes → Oribatida → Brachypylina → Oppioidea → Oppiidae → Medioppia → Medioppia subpectinata658Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil71.03%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil22.76%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated2.07%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.38%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.38%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.69%
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300010198Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010200Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300016728Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030532Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030539Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO111SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030546Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030547Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030555Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030566Metatranscriptome of decayed wood fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP2-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030569Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030583Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030590Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030591Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030592Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030614Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030615Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030631Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030633Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030748Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030777Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030799Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030840Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030841Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030842Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030850Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030852Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030853Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030854Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030855Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030858Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030866Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030907Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030911Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 2A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030933Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030934Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030935Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030938Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030949Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030970Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030971Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030979Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030980Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030992Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030995Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030999Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031008Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031013Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 4A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031020Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031021Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031022Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031029Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031030Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031031Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031034Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031035Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031049Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031050Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031051Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031053Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031055Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033535Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0127509_122886313300010198Host-AssociatedTEAEIKKQCNSFKEMYECVGNYTRRCSTKSMREFIRGIQTQGGEARSWYDEFCKKENSEERTNFLKHSPCLNNAQKEARPCIRDLTVALDKAINSDIEQRIPGMCCAVRRMRACTSKIINDKCGKEGQKYMNQMLTSVAGTRLPEIACRDYDPENQVCQEILPKPGSKAANTRSNSVLSRLLNTYAAL*
Ga0127507_100118713300010200Host-AssociatedMLLKSLSFLVFLYLANLVRAQNSCHLRELDLCLASGLASGQNLPTTEAEIKKQCNSFKEMYECVGNYTRRCSTKSMREFIRGIQTQGGEARSWYDEFCKKENSEERTNFLKHSPCLNNAQKEARPCIRDLTVALDKAINSDIEQRIPGMCCAVRRMRACTSKIINDKCGKEGQKYMSQMLTSVAGTRLPEIACRDYDPENQVCQEILPKPGSKAANTRSN
Ga0127507_100412013300010200Host-AssociatedQSSCHLRELDLCLASGLASGQNLPTTVAEINKQCNGFKEMNECIGNYSRRCSTKSMREFLRSITSQGDVRSWYSEFCSKDSSAEREKYLKHAVCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGAKYMGQMLSSVAGTRLPEIACRDYDPSSQECISILPAPGSKPANTKSNSVLSRLLNTYSAL*
Ga0181500_138941013300016728PeatlandAVCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGAKYMGQMLSSVAGTRLPEIACRDYDPSSQECISILPAPGSKPANTKSNSVLSRLLNTYSA
Ga0206356_1062989413300020070Corn, Switchgrass And Miscanthus RhizospherePTTMAEIKKQCNGMKEMNECIGNYSRRCSTKSMREFMRSVTSQGDARSWYNDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIEAKCGKEGLKYSSQMLTSVAGTRIPEIACRDYDPTSQRCQSILPPPGSKP
Ga0206353_1028745613300020082Corn, Switchgrass And Miscanthus RhizosphereNLPTTIAEINKQCNGFKEMNECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSEEREKFLKHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCISILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0210277_1070185513300030528SoilLCLASGLASGQNLPTTVAEMNKQCNGFKEMNECIGNYSRRCSTKSMREFLRSITSQGDVRSWYSEFCTKESSAEREKFLKHSVCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCNTDIVEGKCGKEGARYMGQMLASVAGTRLPEIACREFDPTSQQCISILPAPGSKPANTKTNSVLSRLLNTYSAL
Ga0210290_126612113300030532SoilREFMRSVTSQGDAKSWYSDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIETKCGKEGLKYSSQMLTSVAGTRIPEIACRDYDPTSQRCKSILPAPGSKPGNTKSNSVLSRLLNTYSAL
Ga0210290_159510413300030532SoilFKEMNECIGNYSRRCSTKSMREFLRSITSQGDVKSWYSEFCTSDNSAEREKYLRHAACLNTAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGTRYMSQMLTSVAGTRIPEIACREFDPASQACISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0210281_115287413300030539SoilAEIKKQCNGMKEMNECIGNYSRRYSTKSMREFMRRVTSQGDAKSWYSDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTEIIEAKCGKEGLKYSSQMLTIVAGTRIPEIACRDYDPTSQRCKSILPAPGSKPGNTKS
Ga0210281_152117013300030539SoilHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0247646_110883813300030546SoilFKEMYECIGNYTRRCSTKSLREFIRGIRQQGEAKSWYDEFCSKEQSKERDNFLRHSTCLNTAQKEARSCIRDMTVALDRAINSEIDKRIPGMCCAVKRMRACSSTIIEGKCGKEGAKYMGQMLSSVAGTRLPEIACRDYEPNSPECKEVLPPPGSKPTNTKTNSVISRLLNTYSAL
Ga0247646_112304013300030546SoilIGNYSRRCSTKSMREFMRSLTSQGDVKSWYSEFCTKDDSGEREKYLRHAVCLNNAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPTSQKCISILPAPGTKPGNTRSNSVLSRLLNTYSAL
Ga0247656_108724613300030547SoilKQCNGMKEMNECIGNYSRRCSTKSMREFMRSITSQGDARSFYNDFCVKDNSAERENFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTEIIEAKCGKEGMKYSGQMITNVAGTRIPEIACRDYDPTSKKCTSILPAPGTKPGNTKSNSVLSRLLNTYSA
Ga0247618_111545213300030555SoilSWYNDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIEAKCGKEGMKYSGQMITNVAGTRIPEIACRDYDPTSSKCTSILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0257186_104530623300030566Host-AssociatedLASGQNLPTTNAEINKQCNGFKEMNECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSAEREKFLKHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGMKYMGQMLQSVAGTRIPEIACRDFDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0247628_123133413300030569SoilGMKEMNECIGNYSRRCSTKSMREFMRSITSQGDARSWYQDFCVKDNSEEREKFLKHAVCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIEAKCGKEGMKYSGQMLTNVAGTRIPEIACRDYDPTSQKCISILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0210258_1022250013300030572SoilEKYLNHAVCLNSAQKDARSCMRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTDIIEAKCGKEGMKYMGQMLSSVAGTRIPEIACRDYDPTSQRCTSVLPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0210288_122790013300030575SoilREFMRSLTSQGDVKSWYSEFCTKDDSGEREKYLRHAVCLNNAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPTSQRCTSILPAPGTKPGNTRSNSVLSRLLNTYSAL
Ga0247633_1026859913300030579SoilMREFMRSITSQGDARSWYQDFCVKDNSEEREKFLKHAVCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIEAKCGKEGMKYSGQMLTNVAGTRIPEIACRDYDPTSQKCISILPAPGTKAGNTKSNSVLSRLLN
Ga0210262_107962223300030583SoilLASGQNLPTTVAEINKQCNGMKEMNECIGNYSRRCSTKSMREFMRSITSQGDATSWYNQFCLKDNSEEREKYLRHAVCLNNAQKEARPCISDLTVAIDKAINADIENRVPEMCCAFRRMRKCSSDKIEAKCGKDGLKYMGQMLQSIAGTRIPEIACRDFDPSSQKCISILPAPGTKPGNTKSNSVFSRLLRAFPGLN
Ga0210262_110800913300030583SoilGCIGNYSRRCSTKSMREFLRSITSQGDVKSWYSEFCTSDNSAEREKYLRHAACLNTAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGTRYMSQMLTSVAGTRIPEIACREFDPASQACISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0247643_113369213300030590SoilAEVTKQCNGFKEMYECIGNYTRRCSTKSLREFIRGIRQQGEAKSWYDEFCSKEQSKERDNFLRHSTCLNTAQKEARSCIRDMTVALDRAINSEIDKRIPGMCCAVKRMRACSSTIIEGKCGKEGAKYMGQMLSSVAGTRLPEIACRDYEPNSPECKEVLPPPGSKPTNTKTNSVISRLLNTYSAL
Ga0247626_116946713300030591SoilEIKKQCNGMKEMNECIGNYSRRCSTKSMREFMRSVTSQGDARSWYNDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIEAKCGKEGLKYSSQMLTSVAGTRIPEIACRDYDPTSQRCQSILPAPGSKPGNTKSNSVLSRLLNTYSAL
Ga0247612_114108423300030592SoilGDVKSWYSEFCTKESSTEREKYLKHAVCLNNANKESRGCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGAKYMGQMLSSVAGTRLPEIACRDYDPSSQQCISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0210280_110943313300030594SoilTSDNSAEREKYLRHAACLNTAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVKRMRKCSSDIIEGKCGKEATRYMSQMLTSVAGTRIPEIACREFDPASQACISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0210276_1021675413300030595SoilVKSWYSEFCTKESSEEREKYLKHAVCLNTAQKESRSCLRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTDIVEAKCGKEGMKYSSSMIQSAAGTRIPEIACRDFDPTSQKCISILPPPGSKPGNTKSNSVLSRLLNTYSAL
Ga0210278_122240913300030596SoilFMRSVTSQGDVKSWYSEFCTKESSEEREKFLKHAVCLNSAQKDARSCMRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTDIIEAKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQRCTSVLPPPGSKPGNTKSNSVLSRLLNTYSAL
Ga0247657_1021463213300030614SoilEKYLRHAACLNTAQKDSRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGTKYMSQMLTSVAGTRIPEIACRDFDPSSQACISILPAPGTKPANTKSNSVLSRLLNTYSAL
Ga0257185_1019460513300030615Host-AssociatedMRSITSQGDARSWYDDFCVKDNSAEREKFLKHSVCLNNAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIEAKCGKEGMKYSGQMIQNVAGTRIPEIACRDYDPTSQKCIAILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0210259_1066839613300030625SoilQNLPTTIAEINKQCNGMKEMNECIGNYSRRCSHPSQREFMRSLTSQGDVKSWYSEFCTKDSSEEREKYLKHAVCLNTAQKDARSCLRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTDIIEAKCGKEGMKYSSSMIQSAAGTRIPEIACRDFDPTSQKCVSILPPPGSKPGNTKSNSVLSRLLNTYSAL
Ga0210259_1145832513300030625SoilSAEREKFLKHSVCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGARYMGQMLSSVAGTRLPEIACRDYDPSSQQCISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0210291_1037241413300030626SoilNTAQKEARSCIRDMTVALDRAINSEIDKRIPGMCCAVKRMRACSSTIIEGKCGKEGAKYMGQMLSSVAGTRLPEIACRDYEPNSPECKEVLPPPGSKPTNTKTNSVISRLLNTYSAL
Ga0210291_1112435913300030626SoilHLRELDLCLASGLASGQNLPTTIAEINKQCNGFKEMNECIGNYSRRCSTKSMREFLRSITSQGDVKSWYQEFCQSDSSAEREKYLRHAACLNTAQKDSRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGTKYMGQMLTSVAGTRIPEIACRDFDPSSQACISILPAPGTKPANTKSNSVLSRLLNTYSAL
Ga0210282_1035099013300030630SoilAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0210279_1025618613300030631SoilRCSTKSMREFMRSLTSQGDVKSWYSEFCTKESSAEREKYLKHAVCLNSAQKEARSCLRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTDIIEAKCGKEGMKYSSSMIQSAAGTRIPEIACRDFDPTSQKCISILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0247623_1008998513300030633SoilCNGMKEMNECIGNYSRRCSTKSMREFMRSITSQGDARSFYNDFCVKDNSAERENFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTEIIEAKCGKEGMKYSGQMITNVAGTRIPEIACRDYDPTSKKCTSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0265462_1064756613300030738SoilLASGLASGQNLPTTIAEINKQCNGFKEMNECIGNYSRRCSTKSMREFLRSITSQGDVKSWYQEFCQSDSSAEREKYLRHAACLNTAQKDSRSCIRDLTVALDKAINSDIENRIPEMCCSVKRMRKCSSDIIEGKCGKEGTKYMGQMLTSVAGTRIPEIACRDFDPSSQACISILPAPGTKPANTKSNSVLSRLLNTYSAL
Ga0265462_1072107313300030738SoilLASGQNLPTTVAEINKQCNGFKEMNECIGNYSRRCSTKSMREFLRSITSQGDVKSWYSEFCTSDNSAEREKYLRHAACLNTAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGTRYMSQMLTSVAGTRIPEIACREFDPASQACISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0265462_1113259213300030738SoilMRSVTSQGDVKSWYSEFCTKDSSEEREKFLKHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0265462_1167124413300030738SoilMREFMRSVTSQGDAKSWYSDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMMKCSSEIIETKCGKEGLKYSSQMLTSVAGTRIPEIACRDYDPTSQRCKSILPAPGSKPGNTKSNSVLSRLLNTYSAL
Ga0265460_1117808413300030740SoilGFKEMYDCIGNYTRRCSTKSLREFIRGIRQQGEAKSWYDEFCSKEQSKERDNFLRHSTCLNTAQKEARSCIRDMTVALDRAINSEIDKRIPGMCCAVKRMRACSSAIIEGKCGKEGAKYMGQMLTSVAGTRLPEIACRDYEPNSPECKEVLPPPGSKPTNTKTNSVISRLLNTYSAL
Ga0265460_1145051013300030740SoilCHLRELDLCLASGLASGQNLPTTMAEIKKQCNGMKEMNECIGNYSRRCSTKSMREFMRSVTSQGDAKSWYSDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIETKCGKEGLKYSSQMLTSVAGTRIPEIACRDYDPTSQRCKSILPAPGSKPGNTKSNSVLSRLLNTYSAL
Ga0265460_1224505413300030740SoilWYQEFCQSDSSAEREKYLRHAACLNTAQKDSRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGTKYMGQMLTSVAGTRIPEIACRDFDPSSQACISILPAPGTKPANTKSNSVLSRLLNTYSAL
Ga0265459_1116202813300030741SoilLASGLASGQNLPTTVSEMNKQCNGFKEMNECIGNYSRRCSTKSMREFLRSITSQGDVRSWYSEFCTKESSAEREKFLKHSVCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCNTDIVEGKCGKEGARYMGQMLSSVAGTRLPEIACRDYDPSSQQCISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0265459_1142508423300030741SoilRELDLCLASGLASGQNLPTTIAEINKQCNGMKEMNECIGNYSRRCSTKSMREFMRSLTSQGDVKSWYSEFCTKDSSEEREKYLKHAVCLNTAQKDARSCLRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTDIIEAKCGKEGMKYSSSMIQSAAGTRIPEIACRDFDPTSQKCISILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0265459_1210228723300030741SoilCIGNYSRRCSTKSMREFMRSITSQGDVRSWYSEFSTKDNSAEREKYLKHATCLNSAQKETRSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPSSQRCISILPPPGSKPGNTKSNSVLSRLLNTYSAL
Ga0265461_1080631813300030743SoilAVIVRAQSSCHLRELDLCLASGLASGQNLPTTVAEMNKQCNGFKEMNECIGNYSRRCSTKSMREFLRSITSQGDVRSWYSEFCTKESSAEREKFLKHSVCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCNTDIVEGKCGKEGARYMGQMLASVAGTRLPEIACREFDPTSQQCISILPAPGSKPANTKTNSVLSRLLNTYSAL
Ga0265461_1214003213300030743SoilVRSWYSEFCTKDSSAEREKFLKHSVCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGARYMGQMLSSVAGTRLPEIACRDYDPSSQQCISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0074043_1140967813300030748SoilSWYNDFCTKDNSEEREKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIETRIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSNQMVTSVAGTRIPEIACRDFDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0075402_1075428213300030777SoilAVIVRAQSSCHLRELDLCLASGLASGQNLPTTVAEINKQCNGFKEMNECIGNYSRRCSTKSMREFLRSITSQGDVRSWYSEFCTKQNSEEREKYLKHAVCLNTAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVKRMRKCSNDIIEGKCGKEGAKYMGQMLGSVAGTRLPEIACRDYDPSSQECISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0074010_1066144613300030799SoilRSITSQGDARSWYDDFCVKDNSAEREKFLKHSVCLNNAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIEAKCGKEGMKYSGQMIQNVAGTRIPEIACRDYDPTSQKCIAILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0074020_1121992313300030840SoilKQCNGMKEMNECIGNYSRRCSTKSMREFMRSITSQGDTTSWYNQFCLKDNSEEREKYLRHAVCLNNAQKEARPCISDLTVAIDKAINADIENRVPEMCCAFRRMRKCSSDKIEAKCGKDGLKYMGQMLQSIAGTRIPEIACRDFDPSSQKCISILPAPGTKPGNTKSNSVFSRLLRAFPGLN
Ga0075384_1050650413300030841SoilATCLNTAQKDARSCIRDLTVALDKAINSDIEGRIPEMCCAVRRMRKCSSDIIEAKCGKEGSKYMGSMLQSVAGTRIPEIACRDFDPTSQKCISILPAPGTKAGNTKSNSVLSRLLNTYSA
Ga0075404_1091104913300030842SoilGNYSRRCSTKSMREFMRSITSQGDAKSWYDEFCVKENSKERENFLKHSVCLNTAQKEARTCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTELIEAKCGKEGMKYSTQMITNVAGTRIPEIACRDYDPSSERCIKVLPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0075404_1146865513300030842SoilVCLNNAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPTSQRCTSILPAPGTKPGNTRSNSVLSRLLNTYSAL
Ga0075388_1073709113300030848SoilQKETRSCIRDLTVALDKAINSDIESRIPEMCCAVRRMRKCSTDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPSSQRCISILPPPGSKPGNTKSNSVLSRLLNTYSAL
Ga0075388_1162600513300030848SoilGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSAEREKFLKHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPASQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0075387_1143978613300030850SoilELDLCLASGLASGQNLPTTIAEINKQCNGFKEMNECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSEEREKFLKHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0075389_1147366713300030852SoilGIAFLALAVVVRAQSSCHLRELDLCLASSLAGPQSLPTTVAEIKKRCDAMKETNECISDYSSLCSTKSMREFMRSVTHQGDGKSWYSEFCTKDDSAEREKYLRHAVCLNNAQKEARTCTRDMTVALDKAIASDIESKIPGMCCAVRRMRKCSIDITEEKCGKEGLKYGVKMVQSVAGINMLEILCRDFDPTSQKCTSILPPPGT
Ga0075372_1132862513300030853SoilEREKYLKHATCLNSAQKETRSCIRDLTVALDKAINSDIESRIPEMCCAVRRMRKCSTDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPSSQRCISILPPPGSKPGNTKSNSVLSRLLNTYSAL
Ga0075385_1084953213300030854SoilSEFCTKDDSGEREKYLRHAVCLNNAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPTSQRCTSILPAPGTKPGNTRSNSVLSRLLNTYSAL
Ga0075385_1140911413300030854SoilCSTKSMREFMRSITSQGDARSFYEDFCVKDNTEEKEKYLKHAVCLNAAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCNTEIIEAKCGKEGLKYTSGMVQSVAGTRLPEIACRDFDPTSQKCISILPAPGSKAGNTKSNSVLSRLLNTYSAL
Ga0075385_1181104213300030854SoilSCHLRELDLCLASGLASGQNLPTTVAEIQKQCNGMKEMQECIGNYSRRCSTKSMREFMRSITSQGDAKSWYDEFCVKENSKERENFLKHSVCLNTAQKEARTCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTELIEAKCGKEGMKYSTQMITNVAGTRIPEIACRDYDPSSERCIKVLPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0075374_1131556913300030855SoilAQSSCHLRELDLCIASGLASGQNLPTTIAEINKQCAGFKEMNECVGNYSRKCSTKSIREFLRGITDQGDAKSWYQEFCTNDNSAEREKYLRHATCLNNAQKDARTCIRDMTVALDKAITADIDARIPGMCCAVNRMRKCSTEIIEGKCGKDGSKYMGQMLSSVAGTRLPEIACRDYDANSPQCQKILPAPGSKPSGQKSNSVLSRLLNTYSAL
Ga0102759_146678613300030858SoilLASGLASGQNLPTTMAEIKKQCNGMKEMNECIGNYSRRCSTKSMREFMRSVTSQGDARSWYNDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIEAKCGKEGLKYSSQMLTSVAGTRIPEIACRDYDPTSQRCQSILPAPGSKPGNTKSNSVLSRLLNTYSAL
Ga0102744_170879113300030866SoilHLRELDLCLASGLASGQNLPTTVAEIQKQCNGMKEMQECIGNYSRRCSTKSMREFMRSITSQGDARSWYQDFCVKDNSEEREKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIEAKCGKEGMKYSGQMLTNVAGTRIPEIACRDYDPTSQKCISILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0074013_1171387913300030907SoilGNYSRRCSTKSMREFMKSVTQQGDVKSWYSEFCTKDSSEEREKFLKHSVCLNTAQKDARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGMKYSSQMLQSVAGTRIPEIACRDFDPTSQKCVAILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0102763_1114898913300030911SoilNGMKEMNECIGNYSRRCSTKSMREFMRSVTSQGDARSWYSDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTEIIEAKCGKEGLKYSSQMLSSVAGTRIPEIACREYDPTSQRCQSILPAPGSKPGNTKSNSVLSRLLNTYSAL
Ga0075386_1156597813300030916SoilAEITKQCNGMKEMNECIGNYSRRCSTKSMREFMRSVTSQGDARSWYTDFCVKDNSEEKEKFLKHSVCLNTAQKDARSCISDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSGQMLTSVAGTRIPEIACRDYDPSSQKCTSILPAPGTKAGNTKSNSVLSRLLKTYSAL
Ga0138296_126370313300030923SoilAEREKYLRHATCLNNAQKDARTCIRDMTVALDKAITADIDARIPGMCCAVNRMRKCSTEIIEGKCGKDGSKYMGQMLSSVAGTRLPEIACRDYDSNSPQCQKILPAPGSKPSGQKSNSVLSRLLNTYSAL
Ga0074039_1096489513300030933SoilAVCLNTAQKDARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGIKYSGQMITNVAGTRIPEIACRDFDPTSQKCISILPAPGSKPANTKSNSVLSRLLNTYSA
Ga0074039_1121612013300030933SoilEEREKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIETRIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSNQMVTSVAGTRIPEIACRDFDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0074039_1156854913300030933SoilTEFCTKDDSGEREKYLRHAVCLNNAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPTSQRCTSILPAPGTKPGNTRSNSVLSRLLNTYSAL
Ga0075391_1121876913300030934SoilECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSEEREKFLKHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0075401_1163174313300030935SoilMREFMRSITSQGDARSFYEDFCVKDNTEEKEKYLKHAVCLNAAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCNTEIIEAKCGKEGLKYTSGMVQSVAGTRLPEIACRDFDPTSQKCISILPAPGSKAGNTKSNSVLSRLLNTYSAL
Ga0075401_1185858723300030935SoilKQCNGMKEMNECIGNYSRRCSTKSMREFMRSITSQGDVRSWYSEFCTKDNSAEREKYLKHATCLNSAQKETRSCIRDLTVALDKAINSDIESRIPEMCCAVRRMRKCSTDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPSSQRCISILPPPGSKPGNTKSNSVLSRLLNTYSA
Ga0075401_1186108013300030935SoilEREKYLRHAVCLNNAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPTSQRCTSILPAPGTKPGNTRSNSVLSRLLNTYSAL
Ga0138299_1007878813300030938SoilCSTKSMREFMRSVTSQGDAKSWYNDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSGQMLTSVAGTRIPEIACRDYDPSSQKCTSILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0074031_102507213300030949SoilPTTVAEINKQCNGFKEMNECIGNYSRRCSTKSMREFLRSITAQGDVRSWYSEFCSKDSSEEREKYLKHATCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGAKYMGQMLSSVAGTRLPEIACRDYDPSSQQCTSILPPPGSKPANTKSNSVLSRLLNTYSAL
Ga0075381_1001179813300030970SoilQNLPTTIAEINKQCNGFKEMNECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSAEREKFLKHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0075375_1159033413300030971SoilLVAIVRAQSSCHLRELDLCLASGLASGQNLPTTIAEINKQCNGFKEMNECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSEEREKFLKHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0068589_1119273513300030979SoilCHLRELDLCLASGLASGQNLPTTKAEITKQCNGMKEMNECIGNYSRRCSTKSMREFMRSVTSQGDARSWYTDFCVKDNSEEKEKFLKHSVCLNTAQKDARSCISDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSGQMLTSVAGTRIPEIACRDYDPSSQKCTSILPAPGTKAGNTKSNSVLSRLLKTYSAL
Ga0074027_1134899123300030980SoilMRSITSQGDVRSWYSEFCTKDNSAEREKYLKHATCLNSAQKETRSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPSSQRCISILPPPGSKPGNTKSNSVLSRLLNTYSAL
Ga0074040_1092371213300030992SoilKEMNECIGNYSRRCSTKSMREFMRSITSQGDARSWYQDFCVKDNSEEREKFLKHSVCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSGQMLTNVAGTRIPEIACRDYDPSSQKCTSILPAPGTKPGNTKSNSVLS
Ga0074040_1137427713300030992SoilSCHLRELDLCLASGLASGQNLPTTVAEINKQCNGMKEMNECIGNYTRRCSTKSMREFFRSITSQGDVKSWYNDFCTKDNTEEREKFLKHSVCLNTAQKESRSCIRDLTVALDKAINSDIEARIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSTQMVQSVAGTRLPEIACRDFDPTSQRCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0074040_1138047923300030992SoilASGQNLPTTVAEINKQCNGFKEMNECIGNYSRRCSTKSMREFMRSLTSQGDVKSWYTEFCTKDDSGEREKYLRHAVCLNNAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGLKYMGQMLQSVAGTRIPEIACRDFDPTSQRCTSILPAPGTKPGNTRSNSVLSRLLNTYSAL
Ga0074011_170797913300030995SoilSGQNLPTTVAEIQKQCNGMKEMQECIGNYSRRCSTKSMREFMRSITSQGDARSWYDDFCVKDNSAEREKFLKHSVCLNNAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIEAKCGKEGMKYSGQMIQNVAGTRIPEIACRDYDPTSQKCIAILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0074019_1079969613300030999SoilRSWYSDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTEIIETKCGKEGLKYSSQMLSSVAGTRIPEIACREYDPTSQRCQSILPAPGSKPGNTKSNSVLSRLLNTYSAL
Ga0074019_1087414413300030999SoilSCHLRELDLCIASGLASGQNLPTTVAEMNKQCNGMKEMNECIGNYSRRCSTKSMREFMRSITSQGDTTSWYNQFCLKDNSEEREKYLRHAVCLNNAQKEARPCISDLTVAIDKAINADIENRVPEMCCAFRRMRKCSSDKIEAKCGKDGLKYMGQMLQSIAGTRIPEIACRDFDPSSQKCISILPAPGTKPGNTKSNSVFSRLLRAFPGLN
Ga0074019_1095763613300030999SoilSEERTNFLKHSPCLNNAQKEGRPCIRDLTVALDKAINSDIEQRIPGMCCAVRRMRECTTKIVEDKCGKEGLKYMSQMLTSVAGTRLPEIACRDYDPKSQVCTDILPKPGSKAANTRSNSVLSRLLNTYAAL
Ga0074038_1167109913300031008SoilPTTVAEINKQCNGFKEMNECMGNYSRRCTTKSMREFLRGITSQGDVRSWYSEFCTKESSVEREKYLKHATCLNNANKEARGCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGAKYMGQMLSSVAGTRLPEIACRDYDPTSQQCISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0102753_140247613300031013SoilMREFMRSVTSQGDARSWYNDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSEIIEAKCGKEGLKYSSQMLTSVAGTRIPEIACRDYDPTSQRCQSILPAPGSKPGNTKSNSVLSRLLNTYSAL
Ga0074016_124294013300031020SoilVIVRAQSSCHLRELDLCLASGLASGQNLPTTVAEINKQCNGFKEMNECMGNYSRRCTTKSMREFLRGITSQGDVRSWYSEFCTKESSVEREKYLKHAVCLNSANKESRGCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGAKYMGQMMSSIAGTRLPEIACRDYDPTSQQCISILPAPGSKPAN
Ga0102765_1111673513300031021SoilASGLASGQNLPTTMAEITKQCNGMKEMNECIGNYSRRCSTKSMREFMRSITSQGDARSWYDDFCVKENSAEREKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTEIIEAKCGKEGMKYSGQMLTNVAGTRIPEIACRDYDPASQKCTSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0102765_1150878513300031021SoilQKTCNGMKEMNECIGNYSRRCSTKSMREFMRSITSQGDARSFYNDYCLKDNSEEREKFLKHSVCLNTAQKDARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCTTEIIEAKCGKEGMKYSSQMITNVAGTRIPEIACRDYDPTSQKCTSILPPPGSKPGNTKSNSVLSRLLNTYSAL
Ga0138301_175420213300031022SoilAKSWYQEFCTNDNSAEREKYLRHATCLNNAQKDARTCIRDMTVALDKAITADIDARIPGMCCAVNRMRKCSTEIIEGKCGKDGSKYMGQMLSSVAGTRLPEIACRDYDSNSPQCQKILPAPGSKPSGQKSNSVLSRLLNTYSAL
Ga0074012_1001068713300031029SoilLRELDLCLASGLASGQNLPTTMAEIKKQCNGMKEMNECIGNYSRRCSTKSMREFMRSVTSQGDARSWYSDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTEIIEAKCGKEGLKYSSQMLSSVAGTRIPEIACREYDPTSQRCQSILPAPGSKPGNTKSNSVLSRLLNTYSAL
Ga0074012_1003422013300031029SoilDFCVKDNSEEKEKFLKHAVCLNTAQKDARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSGQMLTNVAGTRIPEIACRDYDPASSKCTSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0074030_1059644213300031030SoilDLCLASGLASGQNLPTTIAEINKQCNGFKEMNECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSEEREKFLKHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAP
Ga0074042_1139237213300031031SoilSMREFFRSITSQGDVKSWYNDFCTKDNSEEREKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIETRIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSNQMVTSVAGTRIPEIACRDFDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0074042_1144758613300031031SoilHLRELDLCLASGLASGQNLPTTVAEINKQCNGFKEMNECIGNYSRRCSTKSMREFLRSITSQGDVRSWYSEFCSKDSSEEREKYLKHATCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGAKYMGQMLSSVAGTRLPEIACRDYDPSSQQCTSILPPPGSKPANTKSNSVLSRLLNTYSAL
Ga0074041_1135539213300031034SoilQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTEIIEAKCGKEGMKYSGQMLTSVAGTRIPEIACRDYDPTSQRCTSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0074041_1140369913300031034SoilSSCHLRELDLCLASGLASGQNLPTTVAEINKQCNGMKEMNECIGNYTRRCSTKSMREFFRPITSQGDVKSWYNDFCTKDNSEEREKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIETRIPEMCCAVRRMRKCSSDIIETKCGKEGLKYSNQMVTSVAGTRIPEIACRDFDPTS
Ga0074041_1154333323300031034SoilPTTVAEINKQCNGMKEMNECIGNYSRRCSTKSMREFMRSLTSQGDVRSWYSEFCTKDDSAEREKYLRHAVCLNNAQKESRSCIRDLTVALDKAINADIESRIPEMCCAVRRMRKCSSDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPTSQRCTSILPAPGTKPGNTRSNSVLSRLLNTYSAL
Ga0074026_1088901013300031035SoilLKHATCLNSAQKETRSCIRDLTVALDKAINSDIESRIPEMCCAVRRMRKCSTDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPSSQRCISILPPPGSKPGNTKSNSVLSRLLNTYSAL
Ga0074036_1054243313300031049SoilFKEMNECVGNYSRKCSTKSIREFLRGITDQGDAKSWYQEFCTNDNSAEREKYLRHATCLNNAQKDARTCIRDMTVALDKAITADIDARIPGMCCAVNRMRKCSTEIIEGKCGKEGSKYMGQMLSSVAGTRLPEIACRDYDANSPQCQKILPAPGSKPSGQKSNSVLSRLLNTYSAL
Ga0074028_1135826923300031050SoilRSLTSQGDVKSWYTEFCTKDDSGEREKYLRHAVCLNNAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGLKYMGQMLQSIAGTRIPEIACRDFDPTSQRCTSILPAPGTKPGNTRSNSVLSRLLNTYSAL
Ga0074029_140308913300031051SoilRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSAEREKFLKHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0074018_173342013300031053SoilNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0102751_137995113300031055SoilQGDARSFYNEYCVNENSDEREKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTEIIEAKCGKEGMKYSSQMITNVAGTRIPEIACRDYDPTSQRCTSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0170834_10523046913300031057Forest SoilVVIMLLKSISFLVFLYSANVARAQNSCHLRELDLCLASGLASGQNLPTSEAEIKKQCNAFKEMYECVGNYTRRCSTKSMREFIRGIQTQGGEARSWYDEFCKKENSEERTNFLKHSGCLNNAQKEARPCIRDLTVALDKAINSDIEQRIPGMCCAVRRMRACTTKIISDKCGKEGMKYMSQMLSSVAGTRLPEIACREYDPASQVCADILPKPGSKAANTRSNSVLSRLLNTYAAL
Ga0170834_11104788713300031057Forest SoilATVAEITKQCNGMKEMNECIGNYTRRCSTKSMREFMRSITSQGDARSFYEDFCVKDNTEEKEKYLKHAVCLNAAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCNTEIIEAKCGKEGLKYTSGMVQSVAGTRLPEIACRDFDPTSQKCISILPAPGSKAGNTKSNSVLSRLLNTYSAL
Ga0170834_11118894813300031057Forest SoilAIVRAQSSCHLRELDLCLASGLASGQNLPTTIAEINKQCNGFKEMNECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSAEREKFLKHSVCLNTAQKEARSCTRDLTVALDKAINSDIESRIPEMCCAVRRMRKCSSDIIEAKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0170834_11208642613300031057Forest SoilHAVCLNTAQKDARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTDIIEAKCGKEGMKYSSSMIQSAAGTRIPEIACRDFDPTSQKCISILPPPGSKPGNTKSNSVLSRLLNTYSAL
Ga0170834_11411628013300031057Forest SoilSEFCTKDSSEEREKYLKHATCLNTAQKDARSCIRDLTVALDKAINSDIEGRIPEMCCAVRRMRKCSSDIIEAKCGKEGSKYMGSMLQSVAGTRIPEIACRDFDPTSQKCISILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0170822_1098302813300031122Forest SoilPRSCTRDLTVALDKAINSDIESRIPEMCCAVRRMRKCSSDIIEAKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0170823_1052340813300031128Forest SoilLNNAQKEGRPCIRDLTVALDKAINSDIEQRIPGMCCAVRRMRECTTKIVEDKCGKEGLKYMSQMLTSVAGTRLPEIACRDYDPKSQVCTDILPKPGSKAANTRSNSVLSRLLNTYAAL
Ga0170823_1482957013300031128Forest SoilECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSEEREKFLKHSTCLNTAQKEARSCTRDLTVALDKAINADIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGMKYMGQMLQSVAGTRIPEIACRDFDPTSQKCVSILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0170824_10355608913300031231Forest SoilPFFLSSVVPFFESFRSLSFTSRHSKVQSNMLLKSLSFLVFLYLANLVRAQNSCHLRELDLCLASGLASGQNLPTTEAEIKKQCNSFKEMYECVGNYTRRCSTKSMREFIRGIQTQGGEARSWYDEFCKKENSEERTNFLKHSPCLNNAQKEARPCIRDLTVALDKAINSDIEQRIPGMCCAVRRMRACTTKIITDKCGKEGQKYMSQMLTSVAGTRLPEIACRDYDPETQVCTDILPKPGSKAANTRSNSVLSRLLNTYAAL
Ga0170824_10409576913300031231Forest SoilLASGLASGQNLPTTVAEINKQCNGFKEMNECIGNYSRRCSTKSMREFLRSITSQGDVRSWYSEFCTKQNSEEREKYLKHAVCLNTAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVKRMRKCSNDIIEGKCGKEGAKYMGQMLGSVAGTRLPEIACRDYDPSSQECISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0170824_11609891513300031231Forest SoilPTTVAEIQKQCNGMKEMNECIGNYSRRCSTKSMREFMRSVTSQGDARSWYQDFCVKDNSEEREKFLKHSVCLNTAQKDARSCIRDLTVALDKAINSDIEGRIPEMCCAVRRMRKCSSEIIEAKCGKEGMKYSGQMLQNVAGTRIPEIACRDYDPSSQRCTSILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0170824_11788098613300031231Forest SoilMLLKSISFLVFLYFANVARAQNSCHLRELDLCLASGLASGQNLPTSEAEIKKQCNSFKEMYECVGNYTRRCSTKSMREFIRGIQTQGGEARSWYDEFCKKENSEERTNFLKHSGCLNNAQKEARPCIRDLTVALDKAINSDIEQRIPGMCCAVRRMRECTTKIISDKCGKEGMKYMSQMLSSVAGTRLPELACREYDPASQVCADILPKPGSKAANTRSNSVLSRLLNTYAAL
Ga0170824_12390390013300031231Forest SoilRELDLCLASGLASGQNLPTTNAEINKQCNGFKEMNECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSEEREKFLKHSTCLNTAQKEARSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSSKCTSILPAPGTKPANTKSNSVLSRLLN
Ga0170824_12691986813300031231Forest SoilEFIRGVQTQGGEARSWYDEFCKKENSEERTNFLKHSPCLNNAQKEGRPCIRDLTVALDKAINSDIEQRIPGMCCAVRRMRECTTKIVEDKCGKEGLKYMSQMLTSVAGTRLPEIACRDYDPKSQVCTDILPKPGSKAANTRSNSVLSRLLNTYAAL
Ga0170824_12708257813300031231Forest SoilNLPTTMAEIKKQCNGMKEMNECIGNYSRRCSTKSMREFMRSVTSQGDARSWYNDFCVKDNSEEKEKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRMCSSEIIEAKCGKEGLKYSSQMLTSVAGTRIPEIACRDYDPTSQRCKSILPAPGSKPGNTKSNSVLSRLLN
Ga0170820_1089940213300031446Forest SoilPCLNNAQKEGRPCIRDLTVALDKAINSDIEQRIPGMCCAVRRMRECTTKIVEDKCGKEGMKYMSQMLTSVAGTRLPEIACRDYDPKSQVCTDILPKPGSKAANTRSNSVLSRLLNTYAAL
Ga0170820_1274398513300031446Forest SoilKQCNGMKEMNECIGNYSRRCSTKSMREFMRSVTSQGDARSWYTDFCVKDNSEEKEKFLKHSVCLNTAQKDARSCISDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSGQMLTSVAGTRIPEIACRDYDPSSQKCTSILPAPGTKAGNTKSNSVLSRLLKTYSA
Ga0170820_1278886613300031446Forest SoilFKEMNECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSEEREKFLKHSTCLNTAQKEARSCTRDLTVALDKAINADIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGMKYMGQMLQSVAGTRIPEIACRDFDPTSQKCVSILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0170820_1540024013300031446Forest SoilTKDSSEEREKFLKHSTCLNTAQKESRSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEGKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0170819_1306854213300031469Forest SoilRGFYQDYCVKENSEEREKFLKHSVCLNTAQKDARSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSSQMLTSVAGTRIPEIACRDYDPSSQRCTSILPAPGSKPGNTKSNSVLSRLLNTYSAL
Ga0170819_1405400013300031469Forest SoilPFFLSSVVPFFESFRSLSFTSRHSKVQSNMLLKSLSFLVFLYLANLVRAQNSCHLRELDLCLASGLASGQNLPTTEAEIKKQCNSFKEMYECVGNYTRRCSTKSMREFIRGIQTQGGEARSWYDEFCKKENSEERTNFLKHSPCLNNAQKEARPCIRDLTVALDKAINSDIEQRIPGMCCAVRRMRACTTKIITDKCGKEGQKYMSQMLTSVAGTRLPEIACRDYDPETQVCADILPKPGSKAANTRSNSVLSRLFEHVRCSLSHVMI
Ga0170818_10528617223300031474Forest SoilGDVRSWYSEFCTKDSSAEREKFLKHSVCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGAKYMGQMLSSVAGTRLPEIACRDFDPTSQQCISTLPPPGSKPANTKSNSVLSRLLNTYSAL
Ga0170818_10603198713300031474Forest SoilSCHLRELDLCLASGLASGQNLPTTNAEINKQCNGFKEMNECIGNYSRRCSTKAMRDFMRSVTSQGDVKSWYSEFCTKDSSEEREKFLKHSTCLNTAQKEARSCTRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSSDIIEAKCGKEGMKYMGQMLQSVAGTRIPEIACRDYDPTSQKCISILPAPGTKPANTKSNSVLSRLLNTYSAL
Ga0170818_10771467213300031474Forest SoilCSTKSIREFLRGITDQGDAKSWYQEFCTNDNSAEREKYLRHATCLNNAQKDARTCIRDMTVALDKAITADIDARIPGMCCAVNRMTKCSTEIIEGKCGKEGSKYMGQMLSSVAGTRLPEIACRDYDANSPQCQKILPAPGSKPSGQKSNSVLSRLLNTYSAL
Ga0170818_11191564113300031474Forest SoilMLLKSLSFLVFLYLANLVRAQNSCHLRELDLCLASGLASGQNLPTTEAEIKKQCNSFKEMYECVGNYTRRCSTKSMREFIRGIQTQGGEARSWYDEFCKKENSEERTNFLKHSPCLNNAQKEARPCIRDLTVALDKAINSDIEQRIPGMCCAVRRMRACTTKIITDKCGKEGQKYMSQMLTSVAGTRLPEIACRDYDPETQVCA
Ga0170818_11347829313300031474Forest SoilSCHLRELDLCLASGLASGQNLPTTVAEINKQCNGFKEMNECIGNYSRRCSTKSMREFLRSITSQGDVRSWYSEFCTKQNSEEREKYLKHAVCLNTAQKESRSCIRDLTVALDKAINADIENRIPEMCCAVKRMRKCSNDIIEGKCGKEGAKYMGQMLGSVAGTRLPEIACRDYDPSSQECISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0315741_1072560213300032739Forest SoilARSWYDEFCKKENSEERTNFLKHSPCLNNAQKEGRPCIRDLTVALDKAINSDIEQRIPGMCCAVRRMRECTTKIVEDKCGKEGLKYMSQMLTSVAGTRLPEIACRDYDPKSQVCTDILPKPGSKAANTRSNSVLSRLLNTYAAL
Ga0315741_1084585913300032739Forest SoilVIVRAQSSCHLRELDLCLASGLASGQNLPTTVAEINKQCNGFKEMNECMGNYSRRCTTKSMREFLRGITSQGDVRSWYSEFCTKESSVEREKYLKHAVCLNSANKESRGCIRDLTVALDKAINSDIENRIPEMCCAVKRMRKCSSDIIEGKCGKEGAKYMGQMMSSIAGTRLPEIACRDYDPTSQQCISILPAPGSKPANTKSNSVLSRLLNTYSAL
Ga0315742_1098389113300032756Forest SoilVKAQSSCHLRELDLCLASGLASGQNLPTTVAEITKQCNGMKEMNECIGNYSRRCSTKSMREFMRSITSQGDARSWYQDFCVKDNSEEREKFLKHSVCLNTAQKESRSCIRDLTVALDKAINSDIENRIPEMCCAVRRMRKCSTEIIEAKCGKEGMKYSGQMLTSVAGTRIPEIACRDYDPTSQRCTSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0315742_1167751713300032756Forest SoilEINKQCAGFKEMNECVGNYSRKCSTKSIREFLRGITDQGDAKSWYQEFCTNDNSAEREKYLRHATCLNNAQKDARTCIRDMTVALDKAITADIDARIPGMCCAVNRMRKCSTEIIEGKCGKEGSKYMGQMLSSVAGTRLPEIACRDYDANSPQCQKILPAPGSKPSGQKSNSVLSRLLNTYSAL
Ga0315742_1202724513300032756Forest SoilYTRRCSTKSMREFFRSITSQGDAKSWYSEFCTKDNTEEREKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSDIEARIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSTQMVQSVAGTRLPEIACRDFDPTSQRCVSILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0315742_1226913913300032756Forest SoilRRCSTKSMREFMRSITSQGDARSWYDDFCVKVNSEEREKFLKHSVCLNTAQKDARSCIRDLTVALDKAINSYIENRIPEMCCAVRRMRKCSTEIIENKCGKEGLKYSGQMISNVAGTRIPEIACRDYDPTSSRCTSILPAPGTKAGNTKSNSVLSRLLNTYSAL
Ga0315742_1350082313300032756Forest SoilREFFRSITTQGDAKSWYSEFCTKDDSAEREKFLKHSVCLNTAQKEARSCIRDLTVALDKAINSEIETRIPEMCCAVRRMRKCSSDIIEAKCGKEGLKYSNQMVTSVAGTRIPEIACRDFDPTSQKCISILPAPGTKPGNTKSNSVLSRLLNTYSAL
Ga0314759_118749913300033535Switchgrass PhyllosphereMKEMNECIGNYSRRCSTKSMREFMRSLTQQGDVKSWYSEFCTKDSSEEREKYLKHAVCLNTATKEARSCIRDLTVALDKAINSDIESRIPEMCCAVRRMRKCSSDIIEAKCGKEGMKYTTSMVQSAAGTRIPEIACRDFDPTSQKCVSILPAPGTKAGNTKSNSVLSRLLNTYSAL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.