Basic Information | |
---|---|
Family ID | F050367 |
Family Type | Metagenome |
Number of Sequences | 145 |
Average Sequence Length | 49 residues |
Representative Sequence | MIINSLTILIVAGVGLAAYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGR |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 145 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 71.03 % |
% of genes near scaffold ends (potentially truncated) | 27.59 % |
% of genes from short scaffolds (< 2000 bps) | 70.34 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (75.862 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (17.241 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.655 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.345 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.41% β-sheet: 0.00% Coil/Unstructured: 43.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 145 Family Scaffolds |
---|---|---|
PF01844 | HNH | 5.52 |
PF03354 | TerL_ATPase | 4.14 |
PF04586 | Peptidase_S78 | 2.76 |
PF00145 | DNA_methylase | 2.07 |
PF05869 | Dam | 2.07 |
PF09723 | Zn-ribbon_8 | 1.38 |
PF05065 | Phage_capsid | 0.69 |
PF04860 | Phage_portal | 0.69 |
COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
---|---|---|---|
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 4.14 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 2.76 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.07 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.79 % |
Unclassified | root | N/A | 6.21 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003430|JGI25921J50272_10076727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300003499|JGI25930J51415_1010740 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
3300004112|Ga0065166_10022111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1889 | Open in IMG/M |
3300004112|Ga0065166_10083115 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300004240|Ga0007787_10021196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2730 | Open in IMG/M |
3300004240|Ga0007787_10201189 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300004282|Ga0066599_101429841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300005527|Ga0068876_10194387 | All Organisms → Viruses → Predicted Viral | 1179 | Open in IMG/M |
3300005527|Ga0068876_10593176 | Not Available | 601 | Open in IMG/M |
3300005662|Ga0078894_10002318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14430 | Open in IMG/M |
3300005662|Ga0078894_10237877 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
3300005662|Ga0078894_10300216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1456 | Open in IMG/M |
3300005662|Ga0078894_10377449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1282 | Open in IMG/M |
3300005662|Ga0078894_11262544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300006029|Ga0075466_1177956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300006484|Ga0070744_10084694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300006484|Ga0070744_10188719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
3300006639|Ga0079301_1101093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
3300006641|Ga0075471_10574256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300006802|Ga0070749_10253497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
3300006802|Ga0070749_10297751 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300006805|Ga0075464_10090929 | All Organisms → Viruses → Predicted Viral | 1743 | Open in IMG/M |
3300006863|Ga0075459_1069995 | Not Available | 596 | Open in IMG/M |
3300006917|Ga0075472_10184003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
3300007734|Ga0104986_1159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11480 | Open in IMG/M |
3300007734|Ga0104986_1500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16109 | Open in IMG/M |
3300007735|Ga0104988_10307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13283 | Open in IMG/M |
3300008107|Ga0114340_1022418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2963 | Open in IMG/M |
3300008107|Ga0114340_1034609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2293 | Open in IMG/M |
3300008107|Ga0114340_1169627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
3300008107|Ga0114340_1195584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300008108|Ga0114341_10347159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
3300008110|Ga0114343_1020983 | All Organisms → Viruses → Predicted Viral | 2890 | Open in IMG/M |
3300008110|Ga0114343_1174893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300008261|Ga0114336_1009151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8642 | Open in IMG/M |
3300008261|Ga0114336_1223862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
3300008266|Ga0114363_1041213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2834 | Open in IMG/M |
3300008266|Ga0114363_1156507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300008266|Ga0114363_1188098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300008267|Ga0114364_1017941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3904 | Open in IMG/M |
3300008267|Ga0114364_1044381 | All Organisms → Viruses → Predicted Viral | 1634 | Open in IMG/M |
3300008267|Ga0114364_1051965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1465 | Open in IMG/M |
3300008267|Ga0114364_1102877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
3300008448|Ga0114876_1046415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1995 | Open in IMG/M |
3300008448|Ga0114876_1223630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300008448|Ga0114876_1226855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300008450|Ga0114880_1001511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13689 | Open in IMG/M |
3300008450|Ga0114880_1013988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3873 | Open in IMG/M |
3300008450|Ga0114880_1069012 | All Organisms → Viruses → Predicted Viral | 1440 | Open in IMG/M |
3300008450|Ga0114880_1183507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300008450|Ga0114880_1214574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300009081|Ga0105098_10168846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
3300009085|Ga0105103_10190897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300009152|Ga0114980_10003409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10895 | Open in IMG/M |
3300009158|Ga0114977_10001497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15337 | Open in IMG/M |
3300009159|Ga0114978_10002421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15354 | Open in IMG/M |
3300009159|Ga0114978_10292727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
3300009159|Ga0114978_10420741 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300009164|Ga0114975_10686818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300009165|Ga0105102_10421053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300009168|Ga0105104_10103783 | All Organisms → Viruses → Predicted Viral | 1530 | Open in IMG/M |
3300009168|Ga0105104_10546786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300009169|Ga0105097_10080139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1777 | Open in IMG/M |
3300009169|Ga0105097_10574051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300009170|Ga0105096_10248026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
3300009194|Ga0114983_1134209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300010354|Ga0129333_10250967 | All Organisms → Viruses → Predicted Viral | 1595 | Open in IMG/M |
3300010354|Ga0129333_11188115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300010354|Ga0129333_11199987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300010368|Ga0129324_10047007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1985 | Open in IMG/M |
3300010368|Ga0129324_10118524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
3300010368|Ga0129324_10171921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300010374|Ga0114986_1006614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2454 | Open in IMG/M |
3300010388|Ga0136551_1000229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16181 | Open in IMG/M |
3300010388|Ga0136551_1007379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2379 | Open in IMG/M |
3300010388|Ga0136551_1019909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1311 | Open in IMG/M |
3300010388|Ga0136551_1039402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300011009|Ga0129318_10353898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300012663|Ga0157203_1003751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3106 | Open in IMG/M |
3300012665|Ga0157210_1010178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1673 | Open in IMG/M |
3300013005|Ga0164292_10842893 | Not Available | 577 | Open in IMG/M |
3300014811|Ga0119960_1013733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
3300014811|Ga0119960_1046809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300014811|Ga0119960_1059325 | Not Available | 652 | Open in IMG/M |
3300018420|Ga0181563_10244779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1071 | Open in IMG/M |
3300020048|Ga0207193_1111795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2438 | Open in IMG/M |
3300020160|Ga0211733_10128292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15399 | Open in IMG/M |
3300020534|Ga0208596_1018983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
3300021438|Ga0213920_1008391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3276 | Open in IMG/M |
3300021438|Ga0213920_1010492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2745 | Open in IMG/M |
3300021963|Ga0222712_10652193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300022407|Ga0181351_1075724 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
3300022407|Ga0181351_1222105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300022747|Ga0228703_1011344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3280 | Open in IMG/M |
3300022747|Ga0228703_1093053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
3300023174|Ga0214921_10045305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3974 | Open in IMG/M |
3300025889|Ga0208644_1169426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 980 | Open in IMG/M |
3300025889|Ga0208644_1388612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300027114|Ga0208009_1049211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
3300027518|Ga0208787_1146644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300027693|Ga0209704_1136909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300027697|Ga0209033_1061053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1323 | Open in IMG/M |
3300027721|Ga0209492_1007378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3631 | Open in IMG/M |
3300027733|Ga0209297_1001160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15340 | Open in IMG/M |
3300027769|Ga0209770_10010983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4103 | Open in IMG/M |
3300027782|Ga0209500_10001887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15369 | Open in IMG/M |
3300027805|Ga0209229_10427365 | Not Available | 572 | Open in IMG/M |
3300027808|Ga0209354_10183964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
3300027816|Ga0209990_10072603 | All Organisms → Viruses → Predicted Viral | 1706 | Open in IMG/M |
3300027900|Ga0209253_10140275 | All Organisms → Viruses → Predicted Viral | 1963 | Open in IMG/M |
3300027956|Ga0209820_1006774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2788 | Open in IMG/M |
3300027956|Ga0209820_1044258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1172 | Open in IMG/M |
3300027956|Ga0209820_1145502 | Not Available | 654 | Open in IMG/M |
3300027973|Ga0209298_10001302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16330 | Open in IMG/M |
3300028025|Ga0247723_1001285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14963 | Open in IMG/M |
3300028025|Ga0247723_1003328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8084 | Open in IMG/M |
3300028025|Ga0247723_1004087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7058 | Open in IMG/M |
3300031784|Ga0315899_10031383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5603 | Open in IMG/M |
3300031787|Ga0315900_10012490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10409 | Open in IMG/M |
3300031951|Ga0315904_10440909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1167 | Open in IMG/M |
3300032050|Ga0315906_11128903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300032093|Ga0315902_10972154 | Not Available | 642 | Open in IMG/M |
3300033979|Ga0334978_0448358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300033992|Ga0334992_0000897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24245 | Open in IMG/M |
3300033992|Ga0334992_0225989 | All Organisms → Viruses | 916 | Open in IMG/M |
3300033995|Ga0335003_0143648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1194 | Open in IMG/M |
3300033996|Ga0334979_0484258 | All Organisms → Viruses | 672 | Open in IMG/M |
3300034012|Ga0334986_0009412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7081 | Open in IMG/M |
3300034012|Ga0334986_0234888 | All Organisms → Viruses | 1005 | Open in IMG/M |
3300034013|Ga0334991_0248664 | All Organisms → Viruses | 743 | Open in IMG/M |
3300034013|Ga0334991_0297921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300034019|Ga0334998_0757655 | Not Available | 512 | Open in IMG/M |
3300034061|Ga0334987_0143235 | All Organisms → Viruses → Predicted Viral | 1761 | Open in IMG/M |
3300034062|Ga0334995_0340243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
3300034092|Ga0335010_0149843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1480 | Open in IMG/M |
3300034093|Ga0335012_0005507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7680 | Open in IMG/M |
3300034093|Ga0335012_0035771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2910 | Open in IMG/M |
3300034101|Ga0335027_0165721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1606 | Open in IMG/M |
3300034106|Ga0335036_0002871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14972 | Open in IMG/M |
3300034106|Ga0335036_0397584 | All Organisms → Viruses | 886 | Open in IMG/M |
3300034108|Ga0335050_0134746 | All Organisms → Viruses → Predicted Viral | 1370 | Open in IMG/M |
3300034112|Ga0335066_0503854 | Not Available | 642 | Open in IMG/M |
3300034117|Ga0335033_0590301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300034118|Ga0335053_0274818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
3300034119|Ga0335054_0058279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2383 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.24% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.10% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 11.03% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 8.97% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.21% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.21% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.52% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.83% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.45% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.45% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.76% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 2.76% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.76% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 2.07% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.07% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.38% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.38% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.69% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.69% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.69% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.69% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.69% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.69% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020534 | Freshwater microbial communities from Lake Mendota, WI - 12JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25921J50272_100767273 | 3300003430 | Freshwater Lake | MIINSLTILTVAGICLAMYLSYRLGEEVGRDRGIVEGRKALRKQFEQVG |
JGI25930J51415_10107403 | 3300003499 | Freshwater Lake | MNSLTILTVVGICIALYASFRWGQECGYDDGYIDGRKAVRNYYEQVGR* |
Ga0065166_100221112 | 3300004112 | Freshwater Lake | MIINSLTILIVAGICLANYVAYRLGQENGYDQGYCEGRKFMRKFYEQAGR* |
Ga0065166_100831152 | 3300004112 | Freshwater Lake | MIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR* |
Ga0007787_100211962 | 3300004240 | Freshwater Lake | MIINSLTILTVAGIGLAMYLSYRLGEEVGRDRGIVEGRKALRKQFEQVGR* |
Ga0007787_102011893 | 3300004240 | Freshwater Lake | MIINSLTILIVAGICFANYVAYRLGQENGYDQGYCEGRKFMRKFYEQEQR* |
Ga0066599_1014298412 | 3300004282 | Freshwater | MVINSLTILIVAGIGLAMYLSFRLGFEIGYDRGMTQGRVALRRYYEQVQK* |
Ga0068876_101943874 | 3300005527 | Freshwater Lake | KYGARKGKMIINSLTILMITGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR* |
Ga0068876_105931762 | 3300005527 | Freshwater Lake | MIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGR* |
Ga0078894_1000231818 | 3300005662 | Freshwater Lake | MIINSLTILTVAGICLAMYLSYRLGEEVGRDRGIVEGRKALRKQFEQVGR* |
Ga0078894_102378773 | 3300005662 | Freshwater Lake | MNSLTILTVVGIAIALYFAFRWGQETGYDEGLVDGRKAVRKYYEQVGR* |
Ga0078894_103002162 | 3300005662 | Freshwater Lake | MIINSLTILIVAGICLANYVAYRLGQENGYDQGYCEGRKFMRKFYEEAGR* |
Ga0078894_103774493 | 3300005662 | Freshwater Lake | MIINSLTILIVAGICFANYVAYRLGQENGYDQGYCEGRKFMRKFYEQAGR* |
Ga0078894_112625442 | 3300005662 | Freshwater Lake | MVINSLTILIVAGIGVALYFSFKWGQQSGYAEGYVEGRKAIRAYYEQVGR* |
Ga0075466_11779562 | 3300006029 | Aqueous | MIINSLTIIIVAGICFAVYAAYRLGEENGYDRGYCEGRKFMRKFYEQVSK* |
Ga0070744_100846942 | 3300006484 | Estuarine | MNSLTILTVVGLCLANYFTFRWGQETGYDQGLVDGRKAVRKYYEQVGK* |
Ga0070744_101887191 | 3300006484 | Estuarine | IINSLTILIIAGVGLLSYFCFRLGQEVGYDEGLIAGRKAVRKYYEQVGR* |
Ga0079301_11010933 | 3300006639 | Deep Subsurface | MMNSLTILTVVGIAIALHFAFRWGQETGYDQGLVDGRKAVRKYYEQVGR* |
Ga0075471_105742561 | 3300006641 | Aqueous | MIINSLTILLVAGVGLISYFSFRLGQEVGYDQGMVEGRKAVRKYYEQVGR* |
Ga0070749_102534973 | 3300006802 | Aqueous | MNSLTILTVIGICIALYAAFRLGQESGYNDGMLDGRKAVRNYYEQVGR* |
Ga0070749_102977511 | 3300006802 | Aqueous | MNSLTILTVVGIAVALYFAFRWGQEVGYDRGIVDGRTALRKIYEQAGR* |
Ga0075464_100909294 | 3300006805 | Aqueous | MVINSLTILTVVGVCMAIYFSFKLGLEVGYDRGIVDGRKALRKQFEQVGR* |
Ga0075459_10699951 | 3300006863 | Aqueous | MIINSLTILLVAGFSLAMYAAFRLGQECGYDQGMVEGRKAVRKYYEQVAMKATEALINAI |
Ga0075472_101840032 | 3300006917 | Aqueous | MIINSLTILLVAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGR* |
Ga0104986_115915 | 3300007734 | Freshwater | MIINSLTILIVAGVGLIAYFSFRLGQEVGYDKGMVEGRTAIRRYYEQVQK* |
Ga0104986_150018 | 3300007734 | Freshwater | MIINSLTILIVAGICGALYFAFRLGLEIGYDRGMTQGRIAIRKYYEQVQK* |
Ga0104988_103078 | 3300007735 | Freshwater | MNTWTILTVVGFGFALYFSFSFGYEVGYDRGNVDGRKALRKQLEQVGR* |
Ga0114340_10224181 | 3300008107 | Freshwater, Plankton | MTILIVAGVGLLSYFSFRWGQETGYDQGLVDGRTAVRKYYEQVGR* |
Ga0114340_10346091 | 3300008107 | Freshwater, Plankton | MTILIVAGVGLLSYFSFRWGQETGYDQGLVDGRKAVRKYYEQVGR* |
Ga0114340_11696273 | 3300008107 | Freshwater, Plankton | MIINSLTILMITGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR* |
Ga0114340_11955841 | 3300008107 | Freshwater, Plankton | TLFLFPKYGARKGKMIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR* |
Ga0114341_103471593 | 3300008108 | Freshwater, Plankton | MIIISLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGR* |
Ga0114343_10209836 | 3300008110 | Freshwater, Plankton | KGKMIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGK* |
Ga0114343_11748931 | 3300008110 | Freshwater, Plankton | KGKMIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR* |
Ga0114336_100915111 | 3300008261 | Freshwater, Plankton | MGSNDGDGGIMIINSLTILTVVGVCMAIYFSFKLGLEVGYDRGIVDGRKALRKQFEQVGR |
Ga0114336_12238623 | 3300008261 | Freshwater, Plankton | LMIAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGK* |
Ga0114363_10412132 | 3300008266 | Freshwater, Plankton | MVINSLTILIVAGIGVALYFSFKWGQESGYAEGYVEGRKAIRSYYEQVGR* |
Ga0114363_11565071 | 3300008266 | Freshwater, Plankton | LKYRTRKGKMIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGR* |
Ga0114363_11880981 | 3300008266 | Freshwater, Plankton | YGARKGKMIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR* |
Ga0114364_10179418 | 3300008267 | Freshwater, Plankton | MVINSLTILIVAGIGVALYFSFKWGQESGYAEGYVEGRKAIRAYYEQVGR* |
Ga0114364_10443815 | 3300008267 | Freshwater, Plankton | MIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGK* |
Ga0114364_10519651 | 3300008267 | Freshwater, Plankton | NSLTILTVVGLCLANYFTFRWGQETGYDQGLVDGRKAVRKYYEQVGK* |
Ga0114364_11028772 | 3300008267 | Freshwater, Plankton | MTILIIAGVGLLAYFSFRWGQETGYDQGLVDGRKAVRKYYEQVGK* |
Ga0114876_10464153 | 3300008448 | Freshwater Lake | MTILIIAGVGLLSYFSFRWGQEVGYDEGLVDGRTAVRKYYEQVGQ* |
Ga0114876_12236303 | 3300008448 | Freshwater Lake | TLFLFPKYGARKGKMIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGR* |
Ga0114876_12268551 | 3300008448 | Freshwater Lake | RKGKMIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR* |
Ga0114880_10015116 | 3300008450 | Freshwater Lake | MTINSLTILTIIGVCMAIYFAYRLGEEVGHDRGIVEGRKALRKQFEQVGR* |
Ga0114880_10139888 | 3300008450 | Freshwater Lake | MMNSLTILTVVGIAIALYFAFRWGQETGYDEGLVDGRKAVRKYYEQVDK* |
Ga0114880_10690121 | 3300008450 | Freshwater Lake | MVINSLTILIVAGIGVALYFSFKWGQEAGYAEGYVEGRKAIRSYYEQVGR* |
Ga0114880_11835073 | 3300008450 | Freshwater Lake | IINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGR* |
Ga0114880_12145741 | 3300008450 | Freshwater Lake | IINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR* |
Ga0105098_101688462 | 3300009081 | Freshwater Sediment | MMNSLTILTVVGIAVALYFAFRWGQETGYDEGLVDGRKAVRKYYEEAGR* |
Ga0105103_101908972 | 3300009085 | Freshwater Sediment | MMNSLTILTVVGIAVALYFAFRWGQETGYDEGLVDGRKAVRKYYEQVGK* |
Ga0114980_1000340912 | 3300009152 | Freshwater Lake | MIINSLTIIIVAGFSFAIYAAFRLGQESGYDNGYCEGRKAVRKYYEQVGK* |
Ga0114977_100014978 | 3300009158 | Freshwater Lake | MNSLTILTVIGMGLAMYFAFRMGQECGYDQGMVDGRKAVRKYYEQVGR* |
Ga0114978_100024215 | 3300009159 | Freshwater Lake | MVINSLTILIVAGIGLAMYLSFRLGFEIGYDRGMTQGRVAIRRYYEQVQK* |
Ga0114978_102927272 | 3300009159 | Freshwater Lake | MNSLTILAVIAGCFALYFAFRMGQECGYDQGMVEGRKAVRKYYEQVGR* |
Ga0114978_104207411 | 3300009159 | Freshwater Lake | MIINSLTILIVAGVCFALYAAFRLGQESGYDSGYCEGRKAVRKYYEQVGR* |
Ga0114975_106868181 | 3300009164 | Freshwater Lake | MIINSLTILIVAGACFAMYAAFRLGQESGYDQGYCEGRKAVRKYYEQ |
Ga0105102_104210532 | 3300009165 | Freshwater Sediment | MTILIVAGVGLLSYFSFRWGQEVGYDEGLVDGRTAVRKYYEQVG |
Ga0105104_101037833 | 3300009168 | Freshwater Sediment | MMNSLTILTVVGIAIALYFAFRWGQETGYDEGLVDGRKAVRKYYEEAGR* |
Ga0105104_105467862 | 3300009168 | Freshwater Sediment | MTILIIAGVGLLAYFSFRWGQAVGYDEGLVDGRTAVRKYYEQVGK* |
Ga0105097_100801392 | 3300009169 | Freshwater Sediment | MIINSLTILIVAGVGLAAYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGR* |
Ga0105097_105740512 | 3300009169 | Freshwater Sediment | MNSLTILTVVGIAIALYFAFRWGQEVGYDRGIVDGRTALRKIYEQAGR* |
Ga0105096_102480262 | 3300009170 | Freshwater Sediment | MMNSLTILTVVGIALALYFAFRWGQETGYDEGLVDGRKAVRKYYEEAGR* |
Ga0114983_11342092 | 3300009194 | Deep Subsurface | MNSLTILTVVGIAIALYFAFRWGQETGYDEGLVDGRKAVRKYYEQVGK* |
Ga0129333_102509671 | 3300010354 | Freshwater To Marine Saline Gradient | YGARKGKMIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGR* |
Ga0129333_111881153 | 3300010354 | Freshwater To Marine Saline Gradient | FLFPKYGARKGKMIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGR* |
Ga0129333_111999873 | 3300010354 | Freshwater To Marine Saline Gradient | LMIAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQAGR* |
Ga0129324_100470075 | 3300010368 | Freshwater To Marine Saline Gradient | MMNSLTILTVVGIAIALYFAFRWGQETGYDEGLVDGRKAVRKYYEQVGK* |
Ga0129324_101185242 | 3300010368 | Freshwater To Marine Saline Gradient | MNSLTILTVVGIAIALYFSFRWGQEVGYDRGIVDGRKALRKINEQDGR* |
Ga0129324_101719213 | 3300010368 | Freshwater To Marine Saline Gradient | TVVGIAVALYFAFRWGQEVGYDRGIVDGRTALRKIYEQAGR* |
Ga0114986_10066143 | 3300010374 | Deep Subsurface | MIAGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR* |
Ga0136551_10002298 | 3300010388 | Pond Fresh Water | MIINSLTIIIVAGIGLAMYLSFRLGEEVGYDRGNAEGRKALRKQFMEQVNQ* |
Ga0136551_10073792 | 3300010388 | Pond Fresh Water | MIINSLTILTVVGVCMAIYFSFKLGLEVGYDRGIVDGRKALRKQFEQVGR* |
Ga0136551_10199092 | 3300010388 | Pond Fresh Water | MNSLTILIVAGICLANYFAFRWGQECGYDQGLVDGRTAVRKYYEQVGK* |
Ga0136551_10394022 | 3300010388 | Pond Fresh Water | MVINSLTILIVAGIGLAMYLSFRLGEEVGYDRGNVEGRKALRKQFMEQVNQ* |
Ga0129318_103538981 | 3300011009 | Freshwater To Marine Saline Gradient | TSCATLFLFPKYGARKGKMIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR* |
Ga0157203_10037515 | 3300012663 | Freshwater | MNSLTNLTVIGICLAIYTAFRLGQETGYDRGIVDGRKALRKQFEQVGR* |
Ga0157210_10101784 | 3300012665 | Freshwater | MNSLTILTVVGICLAIYTAFRLGQETGYDRGIVDGRKALRKQFEQVGR* |
Ga0164292_108428932 | 3300013005 | Freshwater | MNSLTILTVVGLCLANYFTFRWGQETGYDQGLVDGRKAVRKY |
Ga0119960_10137331 | 3300014811 | Aquatic | MIINSLTILMIAGVGLISYFSFRLGQEVGYDEGLVDGRTAVRKYYEQVGK* |
Ga0119960_10468092 | 3300014811 | Aquatic | MIINSLTILTVVGVCMALYFSFKLGVEVGYDRGVVEGRKALRKQFEQVGR* |
Ga0119960_10593252 | 3300014811 | Aquatic | MIINSLTILIVIGAGLAAYFSFKLGQEVGYNRGIADGRKALRKQFEQAGR* |
Ga0181563_102447792 | 3300018420 | Salt Marsh | MIINSLTILLVAGVGLISYFSFRLGQEVGYDQGMVEGRKAVRKYYEQVGR |
Ga0207193_11117955 | 3300020048 | Freshwater Lake Sediment | MVINSLTILIVAGVGLAMYFSFRLGEEVGYDRGNVEGRKALRKQFQDVNK |
Ga0211733_1012829219 | 3300020160 | Freshwater | MNSLTILTVIGIGIALYASFRLGQESGYNDGMLDGRKAVRNYYEQVGR |
Ga0208596_10189833 | 3300020534 | Freshwater | MNSLTILTVIGIAIALYFAFRWGQETGYDEGLVDGRKAVRKYYEQVGK |
Ga0213920_10083915 | 3300021438 | Freshwater | MIINSLTIIIVAGICLAIYAAYRLGQEQGYDRGYCEGRIFMRKFYERMGK |
Ga0213920_10104922 | 3300021438 | Freshwater | MIINSLTIIIVAGICFAVYAAYRLGEENGYDRGYCEGRKFMRKFYEQVSK |
Ga0222712_106521931 | 3300021963 | Estuarine Water | TILIIAGVGLLSYFSFRWGQEVGYDEGLVDGRTAVRKYYEQVGK |
Ga0181351_10757241 | 3300022407 | Freshwater Lake | IINSVTILTVAGICLAMYLSYRLGEEVGRDRGIVEGRKALRKQFEQVGR |
Ga0181351_12221051 | 3300022407 | Freshwater Lake | MIINSLTILTIAGICLAMYLSYRLGEEVGRDRGIVEGRKALRKQFQQVGR |
Ga0228703_10113447 | 3300022747 | Freshwater | MIINSLTIIIVAGICFAVYAAYRLGEEHGYDRGYCEGRKAVRKYYEQVGR |
Ga0228703_10930532 | 3300022747 | Freshwater | MIINSLTILLVAGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR |
Ga0214921_1004530510 | 3300023174 | Freshwater | GTMIINSLTIIIVAGICFAVYAAYRLGEEHGYDRGYCEGRKFMRKFYEQVGK |
Ga0208644_11694262 | 3300025889 | Aqueous | MNSLTILTVVGIAVALYFAFRWGQEVGYDRGIVDGRTALRKIYEQAGR |
Ga0208644_13886122 | 3300025889 | Aqueous | MNSLTILTVIGICIALYAAFRLGQESGYNDGMLDGRKAVRNYYEQVGR |
Ga0208009_10492113 | 3300027114 | Deep Subsurface | MMNSLTILTVVGIAIALHFAFRWGQETGYDQGLVDGRKAVRKYYEQVGR |
Ga0208787_11466442 | 3300027518 | Deep Subsurface | MNSLTILTVVGIAIALHFAFRWGQETGYDQGLVDGRKAVRKYYEQVGR |
Ga0209704_11369092 | 3300027693 | Freshwater Sediment | MMNSLTILTVVGIAVALYFAFRWGQETGYDEGLVDGRKAVRKYYEEAGR |
Ga0209033_10610531 | 3300027697 | Freshwater Lake | MNSLTILTVVGICIALYASFRWGQECGYDDGYIDGRKAVRNYYEQVGR |
Ga0209492_10073782 | 3300027721 | Freshwater Sediment | MIINSLTILIVAGVGLAAYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGR |
Ga0209297_100116024 | 3300027733 | Freshwater Lake | MNSLTILTVIGMGLAMYFAFRMGQECGYDQGMVDGRKAVRKYYEQVGR |
Ga0209770_100109839 | 3300027769 | Freshwater Lake | MIINSLTILIVAGICLANYVAYRLGQENGYDQGYCEGRKFMRKFYEQAGR |
Ga0209500_100018873 | 3300027782 | Freshwater Lake | MVINSLTILIVAGIGLAMYLSFRLGFEIGYDRGMTQGRVAIRRYYEQVQK |
Ga0209229_104273652 | 3300027805 | Freshwater And Sediment | MIINSLTILIVVGVGLFGYFSFRLGQEVGYDRGIADGRKALRKQFEQAGR |
Ga0209354_101839643 | 3300027808 | Freshwater Lake | MIINSLTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGK |
Ga0209990_100726032 | 3300027816 | Freshwater Lake | MIINSLTILMITGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR |
Ga0209253_101402751 | 3300027900 | Freshwater Lake Sediment | MIINSLTILIVAGVGLIAYFSFRLGQEVGYDKGMVEGRTAIRRYYEQVQK |
Ga0209820_10067749 | 3300027956 | Freshwater Sediment | IVAGVGLLSYFSFRWGQETGYDQGLVDGRKAVRKYYEQVGR |
Ga0209820_10442581 | 3300027956 | Freshwater Sediment | MIINSMTILIIAGVGLLAYFSFRWGQEVGYDEGLVDGRTAVRKYYEQVGK |
Ga0209820_11455021 | 3300027956 | Freshwater Sediment | MMNSLTILTVVGLCLANYFTFRWGQETGYDEGLIDGRKAVRKYYEQVGK |
Ga0209298_1000130220 | 3300027973 | Freshwater Lake | MIINSLTIIIVAGFSFAIYAAFRLGQESGYDNGYCEGRKAVRKYYEQVGK |
Ga0247723_100128518 | 3300028025 | Deep Subsurface Sediment | MIINSLTILTVVGVCMALYFSFKLGVEVGYDRGVVEGRKALRKQFEQVGR |
Ga0247723_100332815 | 3300028025 | Deep Subsurface Sediment | MNSLTILTVVGIAIALYFAFRWGQETGYDEGLVDGRKAVRKYYEQVGK |
Ga0247723_100408712 | 3300028025 | Deep Subsurface Sediment | MIINSLTILIVVGAGLAAYFSFKLGQEVGYDRGIVEGRKALRKQFEQAGR |
Ga0315899_100313839 | 3300031784 | Freshwater | MTILIVAGVGLLSYFSFRWGQETGYDQGLVDGRKAVRKYYEQVGR |
Ga0315900_1001249014 | 3300031787 | Freshwater | MITGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR |
Ga0315904_104409091 | 3300031951 | Freshwater | MITGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYY |
Ga0315906_111289032 | 3300032050 | Freshwater | MIINSMTILIVAGVGLLSYFSFRWGQETGYDQGLVDGRKAVRKYYEQVGR |
Ga0315902_109721542 | 3300032093 | Freshwater | MNSLTILTVVGLCLANYFTFRWGQETGYDQGLVDG |
Ga0334978_0448358_420_605 | 3300033979 | Freshwater | LFLFPKYGARKGYMNSLTILTVVGLCLANYFTFRWGQETGYDQGLVDGRKAVRKYYEQVG |
Ga0334992_0000897_18895_19047 | 3300033992 | Freshwater | MVINSLTILIVAGIGAALYFAFRLGLEVGYDQGMVEGRKAVRKYYEQVGR |
Ga0334992_0225989_772_915 | 3300033992 | Freshwater | NSLTILTVVGLCLANYFTFRWGQETGYDQGLVDGRKAVRKYYEQVGK |
Ga0335003_0143648_162_314 | 3300033995 | Freshwater | MIINSLTILLVTGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR |
Ga0334979_0484258_1_195 | 3300033996 | Freshwater | CATLFLFPKYGARKGYMNSLTILTVVGLCLANYFTFRWGQETGYDQGLVDGRKAVRKYYEQVGK |
Ga0334986_0009412_3169_3315 | 3300034012 | Freshwater | MNSLTILTVVGICIAIYASFRFGQECGYDQGMVDGRKAVRNYYEQVGR |
Ga0334986_0234888_864_1004 | 3300034012 | Freshwater | SLTILTVVGLCLANYFTFRWGQETGYDQGLVDGRKAVRKYYEQVGK |
Ga0334991_0248664_1_138 | 3300034013 | Freshwater | LTILMIAGVGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR |
Ga0334991_0297921_295_447 | 3300034013 | Freshwater | MIINSLTILMVAGVGLISYFSFRLGQEVGYDQGMVEGRKAVRKYYEQVGR |
Ga0334998_0757655_394_510 | 3300034019 | Freshwater | MNSLTILTVVGLCLANYFTFRWGQETGYDQGLVDGRKAV |
Ga0334987_0143235_393_545 | 3300034061 | Freshwater | MILNSLTILIVAGVGLIAYFSFRLGQEVGYDEGLVDGRKAVRKYYEQVGK |
Ga0334995_0340243_2_115 | 3300034062 | Freshwater | MNSLTILTVVGIAIAIYFAFRWGQETGYDEGLVDGRKA |
Ga0335010_0149843_1_138 | 3300034092 | Freshwater | LTILTVVGLCLANYFTFRWGQETGYDQGLVDGRKAVRKYYEQVGK |
Ga0335012_0005507_4715_4867 | 3300034093 | Freshwater | MIINSLTILTVVGVCMAIYFSFKLGLEVGYDRGIVDGRKALRKQFEQVGR |
Ga0335012_0035771_561_713 | 3300034093 | Freshwater | MVINSLTILIVAGFVLAAYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGR |
Ga0335027_0165721_702_851 | 3300034101 | Freshwater | MMNSLTILTVVGIAISMYFAFRWGQETGYDEGLVDGRKAVRKYYEEAGR |
Ga0335036_0002871_1701_1847 | 3300034106 | Freshwater | MNSLTILTVVGIAVALYFAFRWGQETGYDEGLVDGRKAVRKYYEQVGK |
Ga0335036_0397584_683_832 | 3300034106 | Freshwater | MMNSLTILTVIAIGIALYFSFRWGQECGYDQGLTDGRKAVRKYYEQVGK |
Ga0335050_0134746_1237_1368 | 3300034108 | Freshwater | ILTVVGLCLANYFTFRWGQETGYDQGLVDGRKAVRKYYEQVGK |
Ga0335066_0503854_59_211 | 3300034112 | Freshwater | MVINSLTILLVAGVGLISYFSFRLGQEVGYVQGLVDGRTAVRKYYEQVGR |
Ga0335033_0590301_1_114 | 3300034117 | Freshwater | VGLISYFSFRLGQEVGYDQGLVDGRTAVRKYYEQVGR |
Ga0335053_0274818_207_359 | 3300034118 | Freshwater | MIINSLTILLVAGVGLISYFSFRLGQEVGYDQGLVDGRKAVRKYYEQVGK |
Ga0335054_0058279_2245_2382 | 3300034119 | Freshwater | MTILIIAGVGLLSYFSFRWGQETGYDQGLVDGRKAVRKYYEQVGR |
⦗Top⦘ |