Basic Information | |
---|---|
Family ID | F050376 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 145 |
Average Sequence Length | 41 residues |
Representative Sequence | MNLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAE |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 145 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 69.44 % |
% of genes near scaffold ends (potentially truncated) | 41.38 % |
% of genes from short scaffolds (< 2000 bps) | 73.79 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.345 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (21.379 % of family members) |
Environment Ontology (ENVO) | Unclassified (46.897 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.862 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 145 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 3.45 |
PF13640 | 2OG-FeII_Oxy_3 | 2.07 |
PF02867 | Ribonuc_red_lgC | 1.38 |
PF04488 | Gly_transf_sug | 1.38 |
PF13884 | Peptidase_S74 | 0.69 |
PF07463 | NUMOD4 | 0.69 |
PF01844 | HNH | 0.69 |
PF04820 | Trp_halogenase | 0.69 |
COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
---|---|---|---|
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 1.38 |
COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 50.34 % |
All Organisms | root | All Organisms | 49.66 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352004|2199816734 | Not Available | 6242 | Open in IMG/M |
3300000736|JGI12547J11936_1033478 | All Organisms → Viruses → Predicted Viral | 1131 | Open in IMG/M |
3300000756|JGI12421J11937_10019815 | All Organisms → Viruses → Predicted Viral | 2488 | Open in IMG/M |
3300000756|JGI12421J11937_10140187 | Not Available | 608 | Open in IMG/M |
3300002279|B570J29589_1030744 | Not Available | 501 | Open in IMG/M |
3300002835|B570J40625_100000380 | Not Available | 72625 | Open in IMG/M |
3300002835|B570J40625_100015630 | Not Available | 13272 | Open in IMG/M |
3300003277|JGI25908J49247_10020471 | All Organisms → Viruses → Predicted Viral | 1972 | Open in IMG/M |
3300003413|JGI25922J50271_10049171 | Not Available | 951 | Open in IMG/M |
3300003429|JGI25914J50564_10021003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1970 | Open in IMG/M |
3300003429|JGI25914J50564_10051984 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
3300003430|JGI25921J50272_10001498 | Not Available | 7853 | Open in IMG/M |
3300003499|JGI25930J51415_1008161 | All Organisms → Viruses → Predicted Viral | 2163 | Open in IMG/M |
3300004112|Ga0065166_10345189 | Not Available | 614 | Open in IMG/M |
3300004796|Ga0007763_11589531 | Not Available | 697 | Open in IMG/M |
3300005517|Ga0070374_10095509 | All Organisms → Viruses → Predicted Viral | 1548 | Open in IMG/M |
3300005517|Ga0070374_10162107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1159 | Open in IMG/M |
3300005517|Ga0070374_10317112 | Not Available | 790 | Open in IMG/M |
3300005583|Ga0049085_10033361 | All Organisms → Viruses → Predicted Viral | 1904 | Open in IMG/M |
3300005583|Ga0049085_10170097 | Not Available | 730 | Open in IMG/M |
3300005662|Ga0078894_11040147 | Not Available | 702 | Open in IMG/M |
3300005662|Ga0078894_11143002 | Not Available | 662 | Open in IMG/M |
3300005941|Ga0070743_10039824 | Not Available | 1610 | Open in IMG/M |
3300005941|Ga0070743_10046704 | All Organisms → Viruses → Predicted Viral | 1479 | Open in IMG/M |
3300006484|Ga0070744_10019513 | All Organisms → Viruses → Predicted Viral | 2014 | Open in IMG/M |
3300006484|Ga0070744_10041821 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
3300006484|Ga0070744_10110857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 792 | Open in IMG/M |
3300006484|Ga0070744_10201258 | Not Available | 566 | Open in IMG/M |
3300007544|Ga0102861_1221751 | Not Available | 522 | Open in IMG/M |
3300007546|Ga0102874_1145199 | Not Available | 739 | Open in IMG/M |
3300007546|Ga0102874_1146506 | Not Available | 735 | Open in IMG/M |
3300007546|Ga0102874_1263597 | Not Available | 521 | Open in IMG/M |
3300007547|Ga0102875_1259956 | Not Available | 530 | Open in IMG/M |
3300007552|Ga0102818_1063561 | Not Available | 727 | Open in IMG/M |
3300007562|Ga0102915_1036216 | All Organisms → Viruses → Predicted Viral | 1634 | Open in IMG/M |
3300007606|Ga0102923_1153198 | Not Available | 720 | Open in IMG/M |
3300007621|Ga0102872_1204678 | Not Available | 518 | Open in IMG/M |
3300007624|Ga0102878_1122964 | Not Available | 761 | Open in IMG/M |
3300007624|Ga0102878_1173169 | Not Available | 623 | Open in IMG/M |
3300007639|Ga0102865_1264630 | Not Available | 512 | Open in IMG/M |
3300007644|Ga0102902_1172300 | Not Available | 640 | Open in IMG/M |
3300007647|Ga0102855_1037380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1333 | Open in IMG/M |
3300007708|Ga0102859_1006827 | All Organisms → Viruses → Predicted Viral | 2748 | Open in IMG/M |
3300007708|Ga0102859_1170305 | Not Available | 642 | Open in IMG/M |
3300007862|Ga0105737_1212969 | Not Available | 512 | Open in IMG/M |
3300008107|Ga0114340_1194395 | Not Available | 690 | Open in IMG/M |
3300008261|Ga0114336_1104179 | All Organisms → Viruses → Predicted Viral | 1928 | Open in IMG/M |
3300008999|Ga0102816_1027530 | All Organisms → Viruses → Predicted Viral | 1654 | Open in IMG/M |
3300009026|Ga0102829_1314414 | Not Available | 523 | Open in IMG/M |
3300009051|Ga0102864_1085454 | Not Available | 859 | Open in IMG/M |
3300009058|Ga0102854_1046339 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
3300009142|Ga0102885_1028173 | All Organisms → Viruses → Predicted Viral | 1322 | Open in IMG/M |
3300009159|Ga0114978_10757035 | Not Available | 550 | Open in IMG/M |
3300009161|Ga0114966_10008135 | Not Available | 8556 | Open in IMG/M |
3300009164|Ga0114975_10012374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5286 | Open in IMG/M |
3300009181|Ga0114969_10460328 | Not Available | 718 | Open in IMG/M |
3300009181|Ga0114969_10594145 | Not Available | 607 | Open in IMG/M |
3300009183|Ga0114974_10062367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2466 | Open in IMG/M |
3300010388|Ga0136551_1000674 | Not Available | 9353 | Open in IMG/M |
3300010388|Ga0136551_1007812 | All Organisms → Viruses → Predicted Viral | 2300 | Open in IMG/M |
3300010388|Ga0136551_1034794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 942 | Open in IMG/M |
3300010885|Ga0133913_11619623 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
3300010965|Ga0138308_143986 | All Organisms → Viruses → Predicted Viral | 1866 | Open in IMG/M |
3300012000|Ga0119951_1000236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 40167 | Open in IMG/M |
3300012667|Ga0157208_10001943 | All Organisms → Viruses → Predicted Viral | 4244 | Open in IMG/M |
3300012667|Ga0157208_10003689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2673 | Open in IMG/M |
3300012667|Ga0157208_10007639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1602 | Open in IMG/M |
3300012712|Ga0157598_1055074 | Not Available | 913 | Open in IMG/M |
3300012715|Ga0157599_1113661 | Not Available | 502 | Open in IMG/M |
3300012731|Ga0157616_1235883 | Not Available | 687 | Open in IMG/M |
3300012773|Ga0138290_1020452 | Not Available | 817 | Open in IMG/M |
3300012779|Ga0138284_1387287 | Not Available | 563 | Open in IMG/M |
3300013092|Ga0163199_1016909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3736 | Open in IMG/M |
3300017761|Ga0181356_1119827 | Not Available | 841 | Open in IMG/M |
3300017761|Ga0181356_1119971 | Not Available | 840 | Open in IMG/M |
3300019784|Ga0181359_1068151 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
3300020141|Ga0211732_1371119 | Not Available | 9683 | Open in IMG/M |
3300020151|Ga0211736_10742777 | Not Available | 618 | Open in IMG/M |
3300020161|Ga0211726_10400109 | All Organisms → Viruses → Predicted Viral | 2472 | Open in IMG/M |
3300020161|Ga0211726_10858316 | Not Available | 794 | Open in IMG/M |
3300020172|Ga0211729_10881181 | Not Available | 824 | Open in IMG/M |
3300020561|Ga0207934_1001289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3645 | Open in IMG/M |
3300020565|Ga0208718_1000372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8124 | Open in IMG/M |
3300021519|Ga0194048_10007053 | Not Available | 5276 | Open in IMG/M |
3300021519|Ga0194048_10015027 | All Organisms → Viruses → Predicted Viral | 3446 | Open in IMG/M |
3300021961|Ga0222714_10029622 | Not Available | 4097 | Open in IMG/M |
3300021961|Ga0222714_10066801 | Not Available | 2400 | Open in IMG/M |
3300021963|Ga0222712_10004743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14076 | Open in IMG/M |
3300021963|Ga0222712_10122338 | All Organisms → Viruses → Predicted Viral | 1790 | Open in IMG/M |
3300021963|Ga0222712_10454568 | Not Available | 767 | Open in IMG/M |
3300022553|Ga0212124_10135694 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
3300022752|Ga0214917_10461238 | Not Available | 504 | Open in IMG/M |
3300023174|Ga0214921_10006379 | All Organisms → Viruses | 16205 | Open in IMG/M |
3300023174|Ga0214921_10056325 | All Organisms → Viruses → Predicted Viral | 3382 | Open in IMG/M |
3300023174|Ga0214921_10489746 | Not Available | 589 | Open in IMG/M |
3300024343|Ga0244777_10090453 | All Organisms → Viruses → Predicted Viral | 1973 | Open in IMG/M |
3300024343|Ga0244777_10386718 | Not Available | 873 | Open in IMG/M |
3300024346|Ga0244775_10001871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 23645 | Open in IMG/M |
3300024346|Ga0244775_10003330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17094 | Open in IMG/M |
3300024346|Ga0244775_10618604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300024346|Ga0244775_10907850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 699 | Open in IMG/M |
3300024348|Ga0244776_10284426 | Not Available | 1136 | Open in IMG/M |
3300024348|Ga0244776_10534222 | Not Available | 751 | Open in IMG/M |
3300024348|Ga0244776_10632594 | Not Available | 670 | Open in IMG/M |
3300024480|Ga0255223_1016973 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
3300025872|Ga0208783_10340947 | Not Available | 588 | Open in IMG/M |
3300027142|Ga0255065_1053861 | Not Available | 713 | Open in IMG/M |
3300027148|Ga0255115_1088298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 533 | Open in IMG/M |
3300027155|Ga0255081_1020931 | All Organisms → Viruses → Predicted Viral | 1486 | Open in IMG/M |
3300027193|Ga0208800_1036616 | Not Available | 661 | Open in IMG/M |
3300027197|Ga0208922_1064094 | Not Available | 612 | Open in IMG/M |
3300027254|Ga0208177_1087040 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300027320|Ga0208923_1008057 | All Organisms → Viruses → Predicted Viral | 1844 | Open in IMG/M |
3300027387|Ga0208311_1127016 | Not Available | 547 | Open in IMG/M |
3300027563|Ga0209552_1029512 | All Organisms → Viruses → Predicted Viral | 1619 | Open in IMG/M |
3300027593|Ga0255118_1030779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 960 | Open in IMG/M |
3300027594|Ga0255120_1046848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300027600|Ga0255117_1027640 | All Organisms → Viruses → Predicted Viral | 1236 | Open in IMG/M |
3300027627|Ga0208942_1030753 | All Organisms → Viruses → Predicted Viral | 1708 | Open in IMG/M |
3300027631|Ga0208133_1011409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2421 | Open in IMG/M |
3300027631|Ga0208133_1015811 | All Organisms → Viruses → Predicted Viral | 1997 | Open in IMG/M |
3300027644|Ga0209356_1027709 | All Organisms → Viruses → Predicted Viral | 1873 | Open in IMG/M |
3300027689|Ga0209551_1193549 | Not Available | 625 | Open in IMG/M |
3300027689|Ga0209551_1199143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300027710|Ga0209599_10002364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7842 | Open in IMG/M |
3300027733|Ga0209297_1150139 | Not Available | 959 | Open in IMG/M |
3300027754|Ga0209596_1005861 | Not Available | 8995 | Open in IMG/M |
3300027756|Ga0209444_10267232 | Not Available | 589 | Open in IMG/M |
3300027769|Ga0209770_10014316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3546 | Open in IMG/M |
3300027769|Ga0209770_10246039 | Not Available | 694 | Open in IMG/M |
3300027782|Ga0209500_10162137 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
3300027892|Ga0209550_10250848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1169 | Open in IMG/M |
3300028025|Ga0247723_1146361 | Not Available | 556 | Open in IMG/M |
3300033978|Ga0334977_0022969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3554 | Open in IMG/M |
3300033978|Ga0334977_0154314 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
3300034066|Ga0335019_0486554 | Not Available | 739 | Open in IMG/M |
3300034071|Ga0335028_0048447 | All Organisms → Viruses → Predicted Viral | 2889 | Open in IMG/M |
3300034082|Ga0335020_0175801 | All Organisms → Viruses → Predicted Viral | 1074 | Open in IMG/M |
3300034095|Ga0335022_0263720 | Not Available | 996 | Open in IMG/M |
3300034102|Ga0335029_0003158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13083 | Open in IMG/M |
3300034118|Ga0335053_0640784 | Not Available | 606 | Open in IMG/M |
3300034121|Ga0335058_0085910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1836 | Open in IMG/M |
3300034272|Ga0335049_0134846 | All Organisms → Viruses → Predicted Viral | 1775 | Open in IMG/M |
3300034279|Ga0335052_0240202 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 21.38% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.55% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.79% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.28% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 8.28% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.83% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.14% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.14% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.45% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.07% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.07% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.07% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 2.07% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.38% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.38% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.69% |
Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.69% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.69% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.69% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.69% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300002279 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
3300009142 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300012712 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020565 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
3300027148 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h | Environmental | Open in IMG/M |
3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027197 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes) | Environmental | Open in IMG/M |
3300027254 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027387 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027594 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h | Environmental | Open in IMG/M |
3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2199990798 | 2199352004 | Freshwater | MTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD |
JGI12547J11936_10334782 | 3300000736 | Freshwater And Sediment | MKLDEFKAQVEAQRKASLQEAIAKMSEANAKMASLFNLDEAE* |
JGI12421J11937_100198153 | 3300000756 | Freshwater And Sediment | MTLEEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAD* |
JGI12421J11937_101401871 | 3300000756 | Freshwater And Sediment | MTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLF |
B570J29589_10307441 | 3300002279 | Freshwater | MTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAX* |
B570J40625_1000003804 | 3300002835 | Freshwater | MTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
B570J40625_1000156301 | 3300002835 | Freshwater | MTLDEYRAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
JGI25908J49247_100204716 | 3300003277 | Freshwater Lake | MNLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAE* |
JGI25922J50271_100491711 | 3300003413 | Freshwater Lake | MTLEEYKAHVEAQRKASLLKAIATMSEANATMSSLFNTKEAE* |
JGI25914J50564_100210038 | 3300003429 | Freshwater Lake | MNLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
JGI25914J50564_100519843 | 3300003429 | Freshwater Lake | MNLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAD* |
JGI25921J50272_100014981 | 3300003430 | Freshwater Lake | MTLEEYKAHVEAQRKESLQKAIATLSEANAKMSQLFGTKEAN* |
JGI25930J51415_10081619 | 3300003499 | Freshwater Lake | DEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
Ga0065166_103451891 | 3300004112 | Freshwater Lake | MNLDEFKAQVEAQRKESLLKAIATMSEASATMGSLFNTKEAN* |
Ga0007763_115895314 | 3300004796 | Freshwater Lake | MNLNEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
Ga0070374_100955091 | 3300005517 | Freshwater Lake | LDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAD* |
Ga0070374_101621073 | 3300005517 | Freshwater Lake | MNLEEYKAHVEAQRKASLAKAIATMSEANDKMGSLFNTKEAN* |
Ga0070374_103171125 | 3300005517 | Freshwater Lake | LDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAE* |
Ga0049085_100333618 | 3300005583 | Freshwater Lentic | MNLAEYKAHVEAQRKESLLKAIATMSEANDKMSSLFNTKEAN* |
Ga0049085_101700971 | 3300005583 | Freshwater Lentic | MNLEEYKAHVEAQRKESLLKAIATMSEANAKMSSLFNTEEAN* |
Ga0078894_110401473 | 3300005662 | Freshwater Lake | MTLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAD* |
Ga0078894_111430023 | 3300005662 | Freshwater Lake | MNLEEYKAHVEAQRKASLAKAIATMSEANDKMGSLFNTKEDN* |
Ga0070743_100398245 | 3300005941 | Estuarine | MTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAN* |
Ga0070743_100467043 | 3300005941 | Estuarine | MTLEEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAE* |
Ga0070744_100195135 | 3300006484 | Estuarine | MTLDEYKALVEAQRKESLLKAIATMSEANAKMSSLFNTKEAE* |
Ga0070744_100418215 | 3300006484 | Estuarine | MNLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAN* |
Ga0070744_101108571 | 3300006484 | Estuarine | MNLEEYKAHVEAQRKSSLAKAIATMSEANDKMGSLFNTKEAN* |
Ga0070744_102012583 | 3300006484 | Estuarine | MTLEEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAN* |
Ga0102861_12217511 | 3300007544 | Estuarine | KAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
Ga0102874_11451991 | 3300007546 | Estuarine | KVDKMTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
Ga0102874_11465061 | 3300007546 | Estuarine | KVDKMTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAN* |
Ga0102874_12635974 | 3300007546 | Estuarine | NLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAE* |
Ga0102875_12599561 | 3300007547 | Estuarine | MTLEEYKALVEAQRKASLLKAIATMSEANDKMSSLFNTKEAD* |
Ga0102818_10635611 | 3300007552 | Estuarine | MNLDEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAE* |
Ga0102915_10362161 | 3300007562 | Estuarine | RRSEMNLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAE* |
Ga0102923_11531981 | 3300007606 | Estuarine | LDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
Ga0102872_12046784 | 3300007621 | Estuarine | ERRSEMNLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
Ga0102878_11229641 | 3300007624 | Estuarine | SEMNLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAE* |
Ga0102878_11731692 | 3300007624 | Estuarine | MNLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNT |
Ga0102865_12646301 | 3300007639 | Estuarine | MNLDEYKAYVEATRKESLLNAIATMSEANDKMSSLFNTKEAE* |
Ga0102902_11723005 | 3300007644 | Estuarine | YVEATRKESLLKAIATMSEANDKMSSLFNTKEAE* |
Ga0102855_10373801 | 3300007647 | Estuarine | KALVEAQRKASLLKAIATMSEANDKMSSLFNTKEAN* |
Ga0102859_10068279 | 3300007708 | Estuarine | MTLEEYKALVEAQRKASLLKAIATMSEANDKMSSLFNTKEAN* |
Ga0102859_11703051 | 3300007708 | Estuarine | MNLEEYKAHVEAQRKESLLKAIATMSEANAKMSSLFNTKEAE* |
Ga0105737_12129693 | 3300007862 | Estuary Water | KMTLEEYKAHVEAQRKASLLKAIATMSEANATMSSLFNTKEAN* |
Ga0114340_11943951 | 3300008107 | Freshwater, Plankton | EYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
Ga0114355_12390932 | 3300008120 | Freshwater, Plankton | MKLHEYKEMIEAQRKASLAEAIAKMSEANAKMSSMFNLDEEE* |
Ga0114336_11041794 | 3300008261 | Freshwater, Plankton | MTLEEYKAHVEAQRKASLLKAIATMSEANATMSSLFNTKEAN* |
Ga0102816_10275304 | 3300008999 | Estuarine | MNLDEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAN* |
Ga0102829_13144141 | 3300009026 | Estuarine | MTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAE* |
Ga0102864_10854541 | 3300009051 | Estuarine | KAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAE* |
Ga0102854_10463391 | 3300009058 | Estuarine | MTLEEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTK |
Ga0102885_10281735 | 3300009142 | Estuarine | MTLDEYKAYVEATRKESLLKAIATMSEDNDKMSSLFNTKEAD* |
Ga0114978_107570354 | 3300009159 | Freshwater Lake | EMNLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAE* |
Ga0114966_1000813515 | 3300009161 | Freshwater Lake | MNLEEYKAHVEAQRKESLLKAIATMSEANAKMSSLFNTEEAK* |
Ga0114975_1001237417 | 3300009164 | Freshwater Lake | MNLEEYKAQVEAQRKASLLKAIATMSEANDKMSSLFNTKEAN* |
Ga0114969_104603283 | 3300009181 | Freshwater Lake | MTLEEYKALVEAQRKASLLKAIATMSEANDKMSSLFNTKEAE* |
Ga0114969_105941451 | 3300009181 | Freshwater Lake | TTKEGQFMNLDEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAN* |
Ga0114974_100623671 | 3300009183 | Freshwater Lake | DEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAE* |
Ga0136551_100067412 | 3300010388 | Pond Fresh Water | MNLDEYKAYVEAQRKASLQKAIATMSEANDKMSSLFGTKEAN* |
Ga0136551_10078121 | 3300010388 | Pond Fresh Water | MTLEEYKAQVEAQRKASLLKAIATMSEANATMSQLF |
Ga0136551_10347941 | 3300010388 | Pond Fresh Water | MNIEEYKAYVEAQRKASLLKAIATMSEANATMSQLF |
Ga0133913_116196233 | 3300010885 | Freshwater Lake | MNLAEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAE* |
Ga0138308_1439863 | 3300010965 | Lake Chemocline | MTLEEYKAHVEAQRKASLLKAIATMSEANATMGSLFNTKEAN* |
Ga0119951_100023614 | 3300012000 | Freshwater | MNLEEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAD* |
Ga0157208_100019434 | 3300012667 | Freshwater | MTLEEYKAQVEAQRKASLEKAIATMSVANATMSQLFNTKEAD* |
Ga0157208_100036896 | 3300012667 | Freshwater | MNLEEFQAHVEAQRKASMLKAIATMSQANDTMSSLFSTKEAD* |
Ga0157208_100076394 | 3300012667 | Freshwater | MNLEEYKSHVEAQRKASLAKAIATMSEANDKMGSLFNTKEAN* |
Ga0157598_10550745 | 3300012712 | Freshwater | TLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
Ga0157599_11136611 | 3300012715 | Freshwater | VDKMTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
Ga0157616_12358831 | 3300012731 | Freshwater | QRKVDKMTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD* |
Ga0138290_10204521 | 3300012773 | Freshwater Lake | TNERRSEMNLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAN* |
Ga0138284_13872871 | 3300012779 | Freshwater Lake | RRSEMNLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAE* |
Ga0163199_10169097 | 3300013092 | Freshwater | MNLDEYKAQVEAQRKASRLEAIATLTKANETISQLFNTKEAE* |
Ga0181356_11198271 | 3300017761 | Freshwater Lake | NLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAD |
Ga0181356_11199711 | 3300017761 | Freshwater Lake | NLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAE |
Ga0181359_10681514 | 3300019784 | Freshwater Lake | MNLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAE |
Ga0211732_137111917 | 3300020141 | Freshwater | MTLEEYKAHVEAQRKASLLKAIATMSEANATIGSLFNTKEAN |
Ga0211736_107427771 | 3300020151 | Freshwater | MNLDEYKAYVEATRKESLLKAIATMSEANDKMSSLF |
Ga0211726_1040010911 | 3300020161 | Freshwater | MTLEEYKAHVEAQRKESLLKAIATLSQANATMSQLFNTKEAD |
Ga0211726_108583163 | 3300020161 | Freshwater | MNLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAE |
Ga0211729_108811812 | 3300020172 | Freshwater | MNLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAN |
Ga0207934_100128912 | 3300020561 | Freshwater | MTLDEYKAYVEASRKESLLKAIATMSEANDKMSSLFNTKEAE |
Ga0208718_100037211 | 3300020565 | Freshwater | MTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAE |
Ga0194048_100070531 | 3300021519 | Anoxic Zone Freshwater | MNLEEYKAHVEAQRKESLLKAIATMSEANAKMSSLFNTEEAK |
Ga0194048_1001502711 | 3300021519 | Anoxic Zone Freshwater | MNLAEYKAHVEAQRKESLLKAIATMSEANDKMSSLFNTKEAE |
Ga0222714_100296226 | 3300021961 | Estuarine Water | MNLEEYKAHVEAQRQASLQKAIATMSVANATMSQLFNTKEAN |
Ga0222714_100668016 | 3300021961 | Estuarine Water | MKLHEYKEMIEAQRKASLAEAIAKMSEANAKMSSMFNLDEEE |
Ga0222712_1000474323 | 3300021963 | Estuarine Water | MTLDEYKALVEAQRKASLLKAIATMSEANDKMGSLFNTKEAN |
Ga0222712_101223381 | 3300021963 | Estuarine Water | EYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAN |
Ga0222712_104545681 | 3300021963 | Estuarine Water | MNLEEYKAHVEAQRKASLQKAIATMSEANATMSALFGTEEAN |
Ga0212124_101356945 | 3300022553 | Freshwater | MNLDEYKAQVEAQRKASRLEAIATLTKANETISQLFNTKEAE |
Ga0214917_104612383 | 3300022752 | Freshwater | MTLEEYKALVEAQRKASLLKAIATMSEANDKMSSLFNTKEAD |
Ga0214921_1000637921 | 3300023174 | Freshwater | MNLEEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAD |
Ga0214921_1005632510 | 3300023174 | Freshwater | MTLDEYKALVEAQRKASLLKAIATMSEANDKMSSLFNTKEAD |
Ga0214921_104897462 | 3300023174 | Freshwater | MNLEEYKAQVEAQRKASLLKAIATMSEANDKMSSLFNTKEAE |
Ga0244777_100904539 | 3300024343 | Estuarine | MTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAN |
Ga0244777_103867184 | 3300024343 | Estuarine | MTLEEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAD |
Ga0244775_1000187125 | 3300024346 | Estuarine | MNLDEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAN |
Ga0244775_1000333027 | 3300024346 | Estuarine | MTLEEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAE |
Ga0244775_106186041 | 3300024346 | Estuarine | MTLEEYKAHVEAQRKASLLKAIATMSEANATMSQLFGTEEAN |
Ga0244775_109078503 | 3300024346 | Estuarine | YKAHVEAQRKSSLAKAIATMSEANDKMGSLFNTKEAN |
Ga0244776_102844264 | 3300024348 | Estuarine | MTLEEYKALVEAQRKASLLKAIATMSEANDKMSSLFNTKEAN |
Ga0244776_105342224 | 3300024348 | Estuarine | KAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAN |
Ga0244776_106325941 | 3300024348 | Estuarine | MTLEEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAN |
Ga0255223_10169737 | 3300024480 | Freshwater | TLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD |
Ga0208783_103409472 | 3300025872 | Aqueous | MNLEEYKAHIEAQRKASLQKAIATMSQANATMSALFGTEEAN |
Ga0255065_10538611 | 3300027142 | Freshwater | AYVEATRKESLLKAIATMSEANDKMSSLFNTKEAE |
Ga0255115_10882982 | 3300027148 | Freshwater | TTLPTKGQLMKLDEFKAQVEAQRKASLQEAIAKMSEANAKMASLFNLDEAE |
Ga0255081_10209311 | 3300027155 | Freshwater | MNLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFN |
Ga0208800_10366161 | 3300027193 | Estuarine | MTLDEYKAYVEATRKESLLKAIATMSEANDKMSSL |
Ga0208922_10640941 | 3300027197 | Estuarine | MNLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTREAD |
Ga0208177_10870401 | 3300027254 | Estuarine | DEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD |
Ga0208923_10080571 | 3300027320 | Estuarine | MNLDEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTK |
Ga0208311_11270164 | 3300027387 | Estuarine | KVDKMTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD |
Ga0209552_10295121 | 3300027563 | Freshwater Lake | MNLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEA |
Ga0255118_10307792 | 3300027593 | Freshwater | MSVHSVILTTLPTKGQLMKLDEFKAQVEAQRKASLQEAIAKMSEANAKMASLFNLDEAE |
Ga0255120_10468481 | 3300027594 | Freshwater | MKLDEFKAQVEAQRKASLQEAIAKMSEANAKMASL |
Ga0255117_10276405 | 3300027600 | Freshwater | MKLDEFKAQVEAQRKASLQEAIAKMSEANAKMASLFNLDEAE |
Ga0208942_10307531 | 3300027627 | Freshwater Lentic | MNLAEYKAHVEAQRKESLLKAIATMSEANDKMSSLFNTKEAN |
Ga0208133_10114091 | 3300027631 | Estuarine | MNLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTK |
Ga0208133_10158116 | 3300027631 | Estuarine | MTLDEYKALVEAQRKESLLKAIATMSEANAKMSSLFNTKEAE |
Ga0209356_10277091 | 3300027644 | Freshwater Lake | MTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTK |
Ga0209551_11935492 | 3300027689 | Freshwater Lake | MTLEEYKAHVEAQRKESLQKAIATLSEANAKMSQLFGTKEAN |
Ga0209551_11991432 | 3300027689 | Freshwater Lake | MNLEEYKAQVEAQRKASLLKAIATMSEANDKMSSLFNTKEAN |
Ga0209599_1000236416 | 3300027710 | Deep Subsurface | MNLEEYKAHVEAQRKESLLKAIATMSEANAKMSSLFNTKEAE |
Ga0209297_11501391 | 3300027733 | Freshwater Lake | NERRSEMNLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAN |
Ga0209596_100586126 | 3300027754 | Freshwater Lake | MTLEEYKALVEAQRKASLLKAIATMSEANDKMSSLFNTKEAE |
Ga0209444_102672321 | 3300027756 | Freshwater Lake | MNLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEA |
Ga0209770_100143164 | 3300027769 | Freshwater Lake | MTLEEYKAHVEAQRKASLLKAIATMSEANATMSSLFNTKEAE |
Ga0209770_102460391 | 3300027769 | Freshwater Lake | KVDKMTLDEYKAYVEATRKESLLKAIATMSEANDTMSSLFNTKEAD |
Ga0209500_101621371 | 3300027782 | Freshwater Lake | MNLDEYKALVEAQRKASLLKAIATMSEANDKMSSLFNTKEAE |
Ga0209550_102508482 | 3300027892 | Freshwater Lake | MNLEEYKAHVEAQRKASLAKAIATMSEANDKMGSLFNTKEAN |
Ga0247723_11463611 | 3300028025 | Deep Subsurface Sediment | MTLDEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAE |
Ga0334977_0022969_3446_3553 | 3300033978 | Freshwater | AYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD |
Ga0334977_0154314_19_147 | 3300033978 | Freshwater | MTLDEYRAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD |
Ga0335019_0486554_3_125 | 3300034066 | Freshwater | LEEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAE |
Ga0335028_0048447_2765_2887 | 3300034071 | Freshwater | MTLDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEA |
Ga0335020_0175801_2_118 | 3300034082 | Freshwater | MTLDEYRAYVEATRKESLLKAIATMSEANDKMSSLFNTK |
Ga0335022_0263720_880_996 | 3300034095 | Freshwater | EYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAD |
Ga0335029_0003158_1150_1278 | 3300034102 | Freshwater | MNLDEFKAQVEAQRKESLLKAIATMSEASATMGSLFNTKEAN |
Ga0335053_0640784_488_604 | 3300034118 | Freshwater | MTLDEYKAHVEAQRKASLLKAIETMSEANAKMSQLFNTK |
Ga0335058_0085910_1712_1834 | 3300034121 | Freshwater | LDEYKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAE |
Ga0335049_0134846_955_1083 | 3300034272 | Freshwater | MTLDEYKAHVEAQRKASLLKAIETMSEANAKMSQLFNTKEAN |
Ga0335052_0240202_1_114 | 3300034279 | Freshwater | YKAYVEATRKESLLKAIATMSEANDKMSSLFNTKEAN |
⦗Top⦘ |