Metagenome Family F050493

Basic Information
Family ID	F050493
Family Type	Metagenome
Number of Sequences	145
Average Sequence Length	39 residues
Representative Sequence	VLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMN
Number of Associated Samples	129
Number of Associated Scaffolds	145

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.38 %
% of genes near scaffold ends (potentially truncated)	97.93 %
% of genes from short scaffolds (< 2000 bps)	88.97 %
Associated GOLD sequencing projects	119
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.31

Most Common Taxonomy
Group	Bacteria (80.690 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (10.345 % of family members)
Environment Ontology (ENVO)	Unclassified (44.828 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (54.483 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 6.15% β-sheet: 12.31% Coil/Unstructured: 81.54%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 145 Family Scaffolds
PF12833	HTH_18	5.52
PF00392	GntR	2.76
PF01011	PQQ	2.76
PF05099	TerB	2.76
PF00069	Pkinase	2.76
PF07519	Tannase	2.76
PF00107	ADH_zinc_N	2.07
PF07859	Abhydrolase_3	2.07
PF07969	Amidohydro_3	2.07
PF00857	Isochorismatase	2.07
PF00072	Response_reg	1.38
PF13474	SnoaL_3	1.38
PF10605	3HBOH	1.38
PF01494	FAD_binding_3	1.38
PF12811	BaxI_1	1.38
PF00005	ABC_tran	1.38
PF12543	DUF3738	1.38
PF14534	DUF4440	1.38
PF12704	MacB_PCD	1.38
PF03401	TctC	0.69
PF10098	DUF2336	0.69
PF00106	adh_short	0.69
PF08238	Sel1	0.69
PF00496	SBP_bac_5	0.69
PF13847	Methyltransf_31	0.69
PF12680	SnoaL_2	0.69
PF11578	DUF3237	0.69
PF13472	Lipase_GDSL_2	0.69
PF17115	Toast_rack_N	0.69
PF00486	Trans_reg_C	0.69
PF13620	CarboxypepD_reg	0.69
PF08818	DUF1801	0.69
PF13594	Obsolete Pfam Family	0.69
PF13360	PQQ_2	0.69
PF00378	ECH_1	0.69
PF01590	GAF	0.69
PF01061	ABC2_membrane	0.69
PF01612	DNA_pol_A_exo1	0.69
PF01757	Acyl_transf_3	0.69
PF13649	Methyltransf_25	0.69
PF02738	MoCoBD_1	0.69
PF00753	Lactamase_B	0.69
PF02518	HATPase_c	0.69
PF02687	FtsX	0.69
PF07690	MFS_1	0.69
PF13618	Gluconate_2-dh3	0.69
PF07366	SnoaL	0.69

COG ID	Name	Functional Category	% Frequency in 145 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	11.03
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	2.76
COG3793	Tellurite resistance protein TerB	Inorganic ion transport and metabolism [P]	2.76
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	2.07
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	2.07
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	2.07
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	1.38
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	1.38
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	1.38
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.69
COG4430	Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family	Function unknown [S]	0.69
COG5646	Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)	Posttranslational modification, protein turnover, chaperones [O]	0.69
COG5649	Uncharacterized conserved protein, DUF1801 domain	Function unknown [S]	0.69

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	80.69 %
Unclassified	root	N/A	19.31 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	80.69 %
Unclassified	root	N/A	19.31 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	80.69 %
Unclassified	root	N/A	19.31 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	23.45 %
Unclassified	root	N/A	19.31 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	15.17 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.38 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.69 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.31 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	12.41 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	6.90 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3.45 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3.45 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1.38 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.38 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.69 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.34 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	4.14 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	2.07 %
Phycisphaerae	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	1.38 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	1.38 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.38 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.69 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.69 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.69 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.69 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.69 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.34 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2.07 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	1.38 %
unclassified Phycisphaerae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae	1.38 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.38 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.69 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	0.69 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.69 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	0.69 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.69 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.69 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.34 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2.07 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	1.38 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	1.38 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.38 %
Paludibaculum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum	0.69 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.69 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.69 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	0.69 %
Cedecea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Cedecea	0.69 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.69 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.34 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2.07 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1.38 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	1.38 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.38 %
Paludibaculum fermentans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans	0.69 %
Cedecea neteri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Cedecea → Cedecea neteri	0.69 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	0.69 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.69 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.69 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.69 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.34 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2.07 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1.38 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	1.38 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.38 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.69 %
Paludibaculum fermentans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans	0.69 %
Cedecea neteri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Cedecea → Cedecea neteri	0.69 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.69 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.69 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	0.69 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	0.69 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.69 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000033\|ICChiseqgaiiDRAFT_c0838411	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2526	Open in IMG/M
3300000550\|F24TB_10581973	Not Available	1060	Open in IMG/M
3300000891\|JGI10214J12806_12997603	All Organisms → cellular organisms → Bacteria	548	Open in IMG/M
3300004092\|Ga0062389_101174793	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	953	Open in IMG/M
3300004463\|Ga0063356_102745681	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	758	Open in IMG/M
3300004463\|Ga0063356_105685706	All Organisms → cellular organisms → Bacteria → Proteobacteria	535	Open in IMG/M
3300005328\|Ga0070676_11367452	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Cedecea → Cedecea neteri	542	Open in IMG/M
3300005334\|Ga0068869_101856117	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	539	Open in IMG/M
3300005335\|Ga0070666_10393740	All Organisms → cellular organisms → Bacteria → Proteobacteria	995	Open in IMG/M
3300005343\|Ga0070687_100426030	All Organisms → cellular organisms → Bacteria	876	Open in IMG/M
3300005353\|Ga0070669_100889683	All Organisms → cellular organisms → Bacteria	760	Open in IMG/M
3300005355\|Ga0070671_101981227	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300005365\|Ga0070688_101594768	All Organisms → cellular organisms → Bacteria → Proteobacteria	533	Open in IMG/M
3300005367\|Ga0070667_100061818	All Organisms → cellular organisms → Bacteria	3171	Open in IMG/M
3300005444\|Ga0070694_100400598	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1074	Open in IMG/M
3300005456\|Ga0070678_101401356	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	652	Open in IMG/M
3300005548\|Ga0070665_100156029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2284	Open in IMG/M
3300005548\|Ga0070665_101160346	All Organisms → cellular organisms → Bacteria → Proteobacteria	783	Open in IMG/M
3300005548\|Ga0070665_101663184	All Organisms → cellular organisms → Bacteria → Proteobacteria	646	Open in IMG/M
3300005617\|Ga0068859_100736531	Not Available	1075	Open in IMG/M
3300005617\|Ga0068859_101400757	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300005617\|Ga0068859_101762183	All Organisms → cellular organisms → Bacteria	684	Open in IMG/M
3300005617\|Ga0068859_103110807	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300005618\|Ga0068864_101661213	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	643	Open in IMG/M
3300005618\|Ga0068864_101953313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	593	Open in IMG/M
3300005719\|Ga0068861_101874182	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	596	Open in IMG/M
3300005764\|Ga0066903_103315453	All Organisms → cellular organisms → Bacteria	870	Open in IMG/M
3300005841\|Ga0068863_102022509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	586	Open in IMG/M
3300005843\|Ga0068860_101858402	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300006028\|Ga0070717_10603363	Not Available	996	Open in IMG/M
3300006031\|Ga0066651_10297183	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300006049\|Ga0075417_10289152	All Organisms → cellular organisms → Bacteria	793	Open in IMG/M
3300006176\|Ga0070765_101227026	All Organisms → cellular organisms → Bacteria	708	Open in IMG/M
3300006358\|Ga0068871_102170328	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300006638\|Ga0075522_10087118	All Organisms → cellular organisms → Bacteria → Proteobacteria	1715	Open in IMG/M
3300006847\|Ga0075431_101217462	Not Available	715	Open in IMG/M
3300006871\|Ga0075434_102077555	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300006914\|Ga0075436_101220994	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300006954\|Ga0079219_11026694	All Organisms → cellular organisms → Bacteria → Proteobacteria	688	Open in IMG/M
3300007004\|Ga0079218_11439907	All Organisms → cellular organisms → Bacteria → Proteobacteria	740	Open in IMG/M
3300009090\|Ga0099827_10814532	Not Available	808	Open in IMG/M
3300009098\|Ga0105245_10249214	All Organisms → cellular organisms → Bacteria → Acidobacteria	1725	Open in IMG/M
3300009098\|Ga0105245_11011085	Not Available	876	Open in IMG/M
3300009100\|Ga0075418_10686613	All Organisms → cellular organisms → Bacteria	1103	Open in IMG/M
3300009147\|Ga0114129_10705359	All Organisms → cellular organisms → Bacteria	1296	Open in IMG/M
3300009157\|Ga0105092_10330115	All Organisms → cellular organisms → Bacteria → Acidobacteria	863	Open in IMG/M
3300009174\|Ga0105241_10037075	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3672	Open in IMG/M
3300009176\|Ga0105242_10846717	All Organisms → cellular organisms → Bacteria	910	Open in IMG/M
3300009177\|Ga0105248_11895247	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300009839\|Ga0116223_10129124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1581	Open in IMG/M
3300010359\|Ga0126376_10996262	Not Available	838	Open in IMG/M
3300010366\|Ga0126379_13141175	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans	553	Open in IMG/M
3300010366\|Ga0126379_13321001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	539	Open in IMG/M
3300010376\|Ga0126381_101514734	All Organisms → cellular organisms → Bacteria	969	Open in IMG/M
3300010376\|Ga0126381_104701421	Not Available	526	Open in IMG/M
3300010398\|Ga0126383_11077567	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	893	Open in IMG/M
3300011398\|Ga0137348_1048280	All Organisms → cellular organisms → Bacteria	720	Open in IMG/M
3300012022\|Ga0120191_10132747	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300012210\|Ga0137378_11731731	Not Available	530	Open in IMG/M
3300012359\|Ga0137385_11171145	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	630	Open in IMG/M
3300012362\|Ga0137361_11223242	Not Available	674	Open in IMG/M
3300012469\|Ga0150984_110235297	Not Available	756	Open in IMG/M
3300012897\|Ga0157285_10099532	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	798	Open in IMG/M
3300012911\|Ga0157301_10111647	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	819	Open in IMG/M
3300012929\|Ga0137404_10874033	All Organisms → cellular organisms → Bacteria	819	Open in IMG/M
3300013308\|Ga0157375_13630893	Not Available	513	Open in IMG/M
3300014325\|Ga0163163_10721249	All Organisms → cellular organisms → Bacteria	1060	Open in IMG/M
3300014745\|Ga0157377_11359909	All Organisms → cellular organisms → Bacteria	558	Open in IMG/M
3300014969\|Ga0157376_11831972	All Organisms → cellular organisms → Bacteria → Acidobacteria	643	Open in IMG/M
3300015242\|Ga0137412_10076936	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2714	Open in IMG/M
3300015371\|Ga0132258_11276038	All Organisms → cellular organisms → Bacteria	1856	Open in IMG/M
3300015372\|Ga0132256_102379471	Not Available	632	Open in IMG/M
3300015374\|Ga0132255_100129326	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	3487	Open in IMG/M
3300015374\|Ga0132255_104969040	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	563	Open in IMG/M
3300015374\|Ga0132255_105188711	All Organisms → cellular organisms → Bacteria → Acidobacteria	551	Open in IMG/M
3300016270\|Ga0182036_10471949	All Organisms → cellular organisms → Bacteria → Proteobacteria	990	Open in IMG/M
3300017948\|Ga0187847_10670298	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300018086\|Ga0187769_10601075	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	831	Open in IMG/M
3300018482\|Ga0066669_12159829	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300019377\|Ga0190264_11470106	All Organisms → cellular organisms → Bacteria	589	Open in IMG/M
3300021170\|Ga0210400_10246034	All Organisms → cellular organisms → Bacteria	1462	Open in IMG/M
3300021401\|Ga0210393_11309978	Not Available	581	Open in IMG/M
3300021407\|Ga0210383_11491540	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29	560	Open in IMG/M
3300021420\|Ga0210394_11313547	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15	618	Open in IMG/M
3300021559\|Ga0210409_10804431	All Organisms → cellular organisms → Bacteria	813	Open in IMG/M
3300022899\|Ga0247795_1045521	Not Available	732	Open in IMG/M
3300025898\|Ga0207692_11056227	Not Available	537	Open in IMG/M
3300025903\|Ga0207680_11259710	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	526	Open in IMG/M
3300025907\|Ga0207645_10445513	Not Available	874	Open in IMG/M
3300025911\|Ga0207654_10018350	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3670	Open in IMG/M
3300025911\|Ga0207654_11435220	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300025916\|Ga0207663_10248563	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1308	Open in IMG/M
3300025920\|Ga0207649_10615004	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300025926\|Ga0207659_10461511	All Organisms → cellular organisms → Bacteria → Proteobacteria	1071	Open in IMG/M
3300025926\|Ga0207659_11417055	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300025933\|Ga0207706_10378068	All Organisms → cellular organisms → Bacteria	1229	Open in IMG/M
3300025934\|Ga0207686_10054361	All Organisms → cellular organisms → Bacteria	2508	Open in IMG/M
3300025935\|Ga0207709_10389983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1062	Open in IMG/M
3300025939\|Ga0207665_10245030	Not Available	1322	Open in IMG/M
3300025942\|Ga0207689_10013188	All Organisms → cellular organisms → Bacteria	7053	Open in IMG/M
3300025949\|Ga0207667_10082915	All Organisms → cellular organisms → Bacteria	3320	Open in IMG/M
3300025960\|Ga0207651_11274582	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	660	Open in IMG/M
3300025961\|Ga0207712_11493292	Not Available	605	Open in IMG/M
3300026035\|Ga0207703_10385387	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1297	Open in IMG/M
3300026078\|Ga0207702_10135079	All Organisms → cellular organisms → Bacteria	2224	Open in IMG/M
3300026095\|Ga0207676_10711291	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	974	Open in IMG/M
3300026095\|Ga0207676_11380511	All Organisms → cellular organisms → Bacteria	700	Open in IMG/M
3300026118\|Ga0207675_101763419	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	638	Open in IMG/M
3300026319\|Ga0209647_1005194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	9593	Open in IMG/M
3300026326\|Ga0209801_1135175	All Organisms → cellular organisms → Bacteria	1049	Open in IMG/M
3300027879\|Ga0209169_10342379	Not Available	786	Open in IMG/M
3300027909\|Ga0209382_10106458	All Organisms → cellular organisms → Bacteria → Acidobacteria	3281	Open in IMG/M
3300028380\|Ga0268265_12254441	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	551	Open in IMG/M
3300028381\|Ga0268264_11869395	Not Available	610	Open in IMG/M
3300028812\|Ga0247825_10677522	All Organisms → cellular organisms → Bacteria	741	Open in IMG/M
3300028819\|Ga0307296_10235431	Not Available	996	Open in IMG/M
3300028828\|Ga0307312_10520884	Not Available	785	Open in IMG/M
3300031231\|Ga0170824_101149029	Not Available	526	Open in IMG/M
3300031446\|Ga0170820_17542372	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300031524\|Ga0302320_11285248	Not Available	740	Open in IMG/M
3300031538\|Ga0310888_10633251	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	651	Open in IMG/M
3300031561\|Ga0318528_10264222	All Organisms → cellular organisms → Bacteria	923	Open in IMG/M
3300031716\|Ga0310813_11843728	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	568	Open in IMG/M
3300031768\|Ga0318509_10194810	All Organisms → cellular organisms → Bacteria	1126	Open in IMG/M
3300031847\|Ga0310907_10239781	All Organisms → cellular organisms → Bacteria	887	Open in IMG/M
3300031896\|Ga0318551_10025421	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	2810	Open in IMG/M
3300031902\|Ga0302322_103765565	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300031903\|Ga0307407_10649657	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18	790	Open in IMG/M
3300031940\|Ga0310901_10601496	Not Available	503	Open in IMG/M
3300031942\|Ga0310916_11233977	Not Available	617	Open in IMG/M
3300031944\|Ga0310884_10981507	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300031954\|Ga0306926_12927872	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300032000\|Ga0310903_10620823	All Organisms → cellular organisms → Bacteria	577	Open in IMG/M
3300032003\|Ga0310897_10681439	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	514	Open in IMG/M
3300032010\|Ga0318569_10303302	All Organisms → cellular organisms → Bacteria	743	Open in IMG/M
3300032013\|Ga0310906_10249947	All Organisms → cellular organisms → Bacteria	1106	Open in IMG/M
3300032025\|Ga0318507_10340358	All Organisms → cellular organisms → Bacteria	653	Open in IMG/M
3300032144\|Ga0315910_10282508	All Organisms → cellular organisms → Bacteria	1257	Open in IMG/M
3300032157\|Ga0315912_10020605	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	5402	Open in IMG/M
3300032160\|Ga0311301_12396619	Not Available	596	Open in IMG/M
3300032180\|Ga0307471_100529137	All Organisms → cellular organisms → Bacteria → Acidobacteria	1331	Open in IMG/M
3300032828\|Ga0335080_10064032	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	4074	Open in IMG/M
3300033412\|Ga0310810_10304438	All Organisms → cellular organisms → Bacteria	1710	Open in IMG/M
3300033412\|Ga0310810_10315659	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1668	Open in IMG/M
3300033551\|Ga0247830_10486845	All Organisms → cellular organisms → Bacteria	969	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	54.48%
Host-Associated	Host-Associated	45.52%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	51.72%
Plants	Host-Associated → Plants	45.52%
Aquatic	Environmental → Aquatic	2.76%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	50.34%
Rhizosphere	Host-Associated → Plants → Rhizosphere	26.21%
Rhizoplane	Host-Associated → Plants → Rhizoplane	17.93%
Freshwater	Environmental → Aquatic → Freshwater	2.07%
Peat	Environmental → Terrestrial → Peat	1.38%
Roots	Host-Associated → Plants → Roots	1.38%
Sediment	Environmental → Aquatic → Sediment	0.69%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	41.38%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	14.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.48%
Soil	Host-Associated → Plants → Rhizosphere → Soil	11.72%
Loam	Environmental → Terrestrial → Soil → Loam	7.59%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.76%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.38%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.38%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.38%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.38%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.69%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.69%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.24%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	14.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	11.72%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	11.03%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	6.21%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.83%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.14%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.76%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.07%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.07%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.38%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.38%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.38%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.38%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.69%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.69%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.69%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.69%

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	10.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	7.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	6.21%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	6.21%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.83%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.14%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.14%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.45%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.76%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.07%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.07%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.38%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.38%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.38%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.38%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.38%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.38%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.38%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.38%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.38%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.38%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.38%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.69%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.69%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.69%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.69%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.69%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.69%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.69%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.69%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.69%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.69%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.69%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.69%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.69%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.69%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.69%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.69%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.69%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.69%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.69%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300004092	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006638	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A	Environmental	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009839	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011398	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2	Environmental	Open in IMG/M
3300012022	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012897	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1	Environmental	Open in IMG/M
3300012911	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300017948	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10	Environmental	Open in IMG/M
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental	Open in IMG/M
3300022899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental	Open in IMG/M
3300026326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)	Environmental	Open in IMG/M
3300027879	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028812	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031524	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031768	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22	Environmental	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031896	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated	Open in IMG/M
3300031940	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032010	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032025	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.31
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.31
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F050493

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiDRAFT_08384111	3300000033	Soil	SDDYFDPKRVPDDAIGRIKSALTVVDGKVVHDTMPGPTGK*
F24TB_105819733	3300000550	Soil	SDDYFDPKRVPDDAIRKLKSAMTVVDGKVVHNTMTP*
JGI10214J12806_129976031	3300000891	Soil	TDDYFDPKRVPDEAIKKLKSVLTVVDGKVVHNTMN*
Ga0062389_1011747931	3300004092	Bog Forest Soil	VVVLSDDYFDARKVSDEAIKQLKSVLTVVDGKVVYDKLH*
Ga0063356_1027456812	3300004463	Arabidopsis Thaliana Rhizosphere	LADLVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK*
Ga0063356_1056857061	3300004463	Arabidopsis Thaliana Rhizosphere	DLVVLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMN*
Ga0070676_113674521	3300005328	Miscanthus Rhizosphere	VVVLSEDYFDAAKVPDEAIKRLKSVLTVVDGRVVHDETKAPR*
Ga0068869_1018561172	3300005334	Miscanthus Rhizosphere	ADVVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDMISGPSGK*
Ga0070666_103937402	3300005335	Switchgrass Rhizosphere	VVVLSEDYFNPMRVPDDKIRSLRSVLTVVDGKVVHDTLAK*
Ga0070687_1004260302	3300005343	Switchgrass Rhizosphere	VVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK*
Ga0070669_1008896831	3300005353	Switchgrass Rhizosphere	VVVLSDDYFDQKRVPDDAIKTLKSVLTVVDGKIVHNTLPSTP*
Ga0070671_1019812272	3300005355	Switchgrass Rhizosphere	DLVVLSDDYFSPTRVPDDKIRSLRSVLTVVDGRVVHDALPRR*
Ga0070688_1015947681	3300005365	Switchgrass Rhizosphere	DLVVLSDDYFDPMRVPDDKIRALRSVLTVVDGKVVHDALPRR*
Ga0070667_1000618181	3300005367	Switchgrass Rhizosphere	LSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDMISGPSGK*
Ga0070694_1004005981	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	VVLSDDYFDPKRVPDDAIGRIKSALTVVDGKVVHDTMPGPAGK*
Ga0070678_1014013561	3300005456	Miscanthus Rhizosphere	LADVVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK*
Ga0070665_1001560294	3300005548	Switchgrass Rhizosphere	KFGDVVVLSDDYFNPVKVPDESIRKLHPVLTVVDGKVVYNLLGP*
Ga0070665_1011603461	3300005548	Switchgrass Rhizosphere	PMRVPDDAIKKIKAVLTVVDGKVVHDMISGPSGK*
Ga0070665_1016631841	3300005548	Switchgrass Rhizosphere	SADFFDSRSVPDDAIRTLKSVLTVVDGRAVYNDLR*
Ga0068859_1007365311	3300005617	Switchgrass Rhizosphere	GDIVVLSDDYFDASKVSDEGMKKIKSVLTVVDRKVIYNQLR*
Ga0068859_1014007571	3300005617	Switchgrass Rhizosphere	VVVLSDDYFDPKRVPDDAIKRLKSVLTVVDGRIVHNTLPSTP*
Ga0068859_1017621831	3300005617	Switchgrass Rhizosphere	VVLSDDYFDPKRVPDDAIKKLRSVLTVVDGKVVHNTMN*
Ga0068859_1031108071	3300005617	Switchgrass Rhizosphere	VLSDDYFDPAKVPDDAIRRLRSVLTVVGGKVVHDEMK*
Ga0068864_1016612131	3300005618	Switchgrass Rhizosphere	FDPMRVPDDAIRKIKSVLTVVDGKVVHDTISGPSGK*
Ga0068864_1019533131	3300005618	Switchgrass Rhizosphere	LSGDYFDSAKVPDDAIRRLKSVLTVVDGRVTYNDLH*
Ga0068861_1018741822	3300005719	Switchgrass Rhizosphere	DPKRVPDDAIGRIKSALTVVDGKVVHDTMPGPAGK*
Ga0066903_1033154531	3300005764	Tropical Forest Soil	ADYFDPAKVPDEGIKKLKSVLTVVDGKVIHDETK*
Ga0068863_1020225092	3300005841	Switchgrass Rhizosphere	IVVLSDDYFDSAKVSDEGIKKIKSVLTVVDGKIVYNQLR*
Ga0068860_1018584022	3300005843	Switchgrass Rhizosphere	VLSDDYLDPAKVPDEAIKKLKSVLTVVDGKVVHDQLR*
Ga0070717_106033631	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	LSDDYFDEYRVPDVRKIHSVLTVVDGKVVHNLMGR*
Ga0066651_102971832	3300006031	Soil	VLSDDYFDSAKVSDEGLKKLRSVLTVVDGKVVHDGTR*
Ga0075417_102891522	3300006049	Populus Rhizosphere	VLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMN*
Ga0070765_1012270262	3300006176	Soil	LVVLSDDYLDPKKVPDEGIKRLKSVLTVVDGKVVYNQMK*
Ga0068871_1021703282	3300006358	Miscanthus Rhizosphere	VVVLSDDYFDPAKVPDEAIKRLKSVLTVVDGRVVHDETRAAR*
Ga0075522_100871181	3300006638	Arctic Peat Soil	LNSDYFSATKVPDEAIKKLKSVMTVVDGRIVHNELK*
Ga0075431_1012174622	3300006847	Populus Rhizosphere	VVLSDDYFDPKRVPDDAIRKLKSAMTVVDGKVVHNTMTP*
Ga0075434_1020775551	3300006871	Populus Rhizosphere	LSEDYFDPAKVSDEGIKKIKSVYTVVDGKAVYDRLH*
Ga0075436_1012209942	3300006914	Populus Rhizosphere	AVLSDDYLDPTKVPDEAIKKLKSALTVVDGKVVHDELR*
Ga0079219_110266942	3300006954	Agricultural Soil	DLVVLSDDYFDPMRVPDDKIRSLRSVLTVVDGKVVHDALSRR*
Ga0079218_114399071	3300007004	Agricultural Soil	GDLVVLSENYFDPMRVPDDKIRSLRSVLTVVDGKVVYDTLTKK*
Ga0099827_108145321	3300009090	Vadose Zone Soil	LSEDFFDPQKVADQEIKKLKSVLTVVDGKVVYDAMR*
Ga0105245_102492144	3300009098	Miscanthus Rhizosphere	LSADYFDAARVSDEGIKKLKSVLTVVDGKVVHDETK*
Ga0105245_110110851	3300009098	Miscanthus Rhizosphere	VPVYGDLVVLSGDYFDPSKVPDDAIRWLKSVLTVVDG
Ga0075418_106866131	3300009100	Populus Rhizosphere	DLVALSDDYFDAAKVPDEAIKKLKSVLTVVDGKVVYEDLK*
Ga0114129_107053591	3300009147	Populus Rhizosphere	SDDYFDPMRVPDDAIRKIKSVLTVVDGKVVHNTMN*
Ga0105092_103301152	3300009157	Freshwater Sediment	LSDDYFDPMRVPDDAIRRIKSVLTVVDGKVVHNTMP*
Ga0105241_100370751	3300009174	Corn Rhizosphere	DVAVLSEDYLDPAKVSEEGIKQLRSVLTVVDGKVVHEDAR*
Ga0105242_108467171	3300009176	Miscanthus Rhizosphere	SGDYFDAAKVPDEAIKKLKSVLTVVDGKVVYEDLK*
Ga0105248_118952471	3300009177	Switchgrass Rhizosphere	VAVLSDDYLDPAKVSDEGIKKLKSVLTVVDGKVVHEETR*
Ga0116223_101291241	3300009839	Peatlands Soil	SGDYTDPKKVPDEAIKGLKSVLTVVDGRVVYDGMK*
Ga0126376_109962623	3300010359	Tropical Forest Soil	DDYFDPARVPDDKIRSLRSVLTVVDGKVVHDTLSAR*
Ga0126379_131411752	3300010366	Tropical Forest Soil	AVLSDDYFDPKLVPDERIKTIRSVLTIVDGKVVHDSLKTSR*
Ga0126379_133210011	3300010366	Tropical Forest Soil	VGKFGDVVVLSDDYFNEVRVPDVRKLYSVLTVVNGKVVHNLLSR*
Ga0126381_1015147342	3300010376	Tropical Forest Soil	GKLGDIVVLSDDYFNPVRVPDEAIRKLHPVLTIIDGKVAYSSLH*
Ga0126381_1047014212	3300010376	Tropical Forest Soil	SADYFDAAKVSDEGIKKLTSVLTVVDGKVVHDETK*
Ga0126383_110775671	3300010398	Tropical Forest Soil	VLSAGYFDTTKVSDEGIRKLTSVLTVVDGKIVHNELK*
Ga0137348_10482802	3300011398	Soil	VLSDDYFSPTRVPDDKIRSLRSVLTVVDGKVVHDAMAKR*
Ga0120191_101327471	3300012022	Terrestrial	DDYFDPKRVPDDAIRKLRSVLTVVDGKIVHNTMSR*
Ga0137378_117317311	3300012210	Vadose Zone Soil	KYGDMVVLNEDFLDPEKVPDEGIKGLKSLLTVVDGKVVHDQMH*
Ga0137385_111711451	3300012359	Vadose Zone Soil	DLVVLSDDFFDPRKVSDEAIKKLKSVLTVVDGKVVHNEMTQGR*
Ga0137361_112232422	3300012362	Vadose Zone Soil	VLSDDYFDAYRVPDVRKIHSVLTVVDGKVVHNLLSR*
Ga0150984_1102352971	3300012469	Avena Fatua Rhizosphere	SDDYFDPAKVSDEGIKKIKSVYTVVDGKAVYDRLH*
Ga0157285_100995322	3300012897	Soil	DLVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK*
Ga0157301_101116471	3300012911	Soil	LVVLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMGP*
Ga0137404_108740332	3300012929	Vadose Zone Soil	ADYFDPAKVPDEAIKKLKSVLTVVDGKVVYEDLR*
Ga0157375_136308931	3300013308	Miscanthus Rhizosphere	DDYFNAVRVPDESIRKLHPVLTIVNGKVVYSSLGQ*
Ga0163163_107212491	3300014325	Switchgrass Rhizosphere	VALSDDYFDPAKVPDEAIKKLKSALTVVDGKVVYDDLK*
Ga0157377_113599092	3300014745	Miscanthus Rhizosphere	LSDDYFSPMRVPDGKIRSLRSVLTVVDGKVVHDEMPKR*
Ga0157376_118319722	3300014969	Miscanthus Rhizosphere	ALSGDYFDAAKVSDEGIKKLKSVLTVVDGRVVHDETK*
Ga0137412_100769363	3300015242	Vadose Zone Soil	SDDYFNPVRVPDESIRKLHSVLTVVDGKVVHNLLGE*
Ga0132258_112760381	3300015371	Arabidopsis Rhizosphere	SDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK*
Ga0132256_1023794711	3300015372	Arabidopsis Rhizosphere	NDDYFNPARVPDESIRKLHPVLTIVDGKVVYSTLGQ*
Ga0132255_1001293261	3300015374	Arabidopsis Rhizosphere	KLADVVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK*
Ga0132255_1049690401	3300015374	Arabidopsis Rhizosphere	KLADVVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDMMSGPSGK*
Ga0132255_1051887111	3300015374	Arabidopsis Rhizosphere	EDYFDTAKVSDEGIKKLKSVYTVVDGKAVYDRLH*
Ga0182036_104719491	3300016270	Soil	VLSADYFDPAKVADADIRKLKSVLTVVGGKVVYNNLK
Ga0187847_106702982	3300017948	Peatland	KFGDLVVLSDDYLDPKKVPDEGIKHLKSVLTVVDGKVVYDHMK
Ga0187769_106010752	3300018086	Tropical Peatland	LVVLSEDYFDPKKVSDEGIKKLRSVLTIVGGKVVYDQTH
Ga0066669_121598292	3300018482	Grasslands Soil	VVLSDDYFDSAKVSDEGLKKLRSVLTVVDGKVVHDGTR
Ga0190264_114701061	3300019377	Soil	GDLVVLSDNYFDPMQVPDDKIRSLRSVLTVVDGKVVHDQLPRR
Ga0210400_102460341	3300021170	Soil	KLADLAALSDDYLDPAKVPDEAIKKLKSVLTVVDGKVVVDELR
Ga0210393_113099781	3300021401	Soil	VLSGDYLDPKKVPDEAIRSLKSVLTVVDGRVVFDGTK
Ga0210383_114915401	3300021407	Soil	SDDYLDPKKVSDEGIKRLKSVLTVVDGKVVWNQMK
Ga0210394_113135471	3300021420	Soil	DVVVLSDDYFDARKVSDEAIKQLKSVLTVVDGRVVYDNLR
Ga0210409_108044312	3300021559	Soil	ERGKLGDVVVLSDDFVDPKKVSDEGIKKLQSVLTVVDGKVIYDRMR
Ga0247795_10455211	3300022899	Soil	TNDYFDPKLVPDDMIRSLHSVLTVVDGKVVHNELPQR
Ga0207692_110562271	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	DDYFNAVRVPDESIRKLHPVLTIVDGKVVYSLLGR
Ga0207680_112597101	3300025903	Switchgrass Rhizosphere	KLADVVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDMISGPSGK
Ga0207645_104455131	3300025907	Miscanthus Rhizosphere	SDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK
Ga0207654_100183501	3300025911	Corn Rhizosphere	VAVLSEDYLDPAKVSEEGIKQLRSVLTVVDGKVVHEDAR
Ga0207654_114352202	3300025911	Corn Rhizosphere	LSGDYFDAAKVPNEAIRKLKSVLTVVDGKVVYDDLH
Ga0207663_102485633	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	AVLSDDYLDPAKVPDEAIKKLKPALTVVDGKVVHDELR
Ga0207649_106150041	3300025920	Corn Rhizosphere	DLVALSDDYFDPAKVPDEAIKKLKSVLTVVDGKVVYDDLK
Ga0207659_104615113	3300025926	Miscanthus Rhizosphere	LSDDYFNPARVPDDAIRKLTSVLTVVGGRVVYEGSTR
Ga0207659_114170552	3300025926	Miscanthus Rhizosphere	DLVVLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTLN
Ga0207706_103780681	3300025933	Corn Rhizosphere	SDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMN
Ga0207686_100543613	3300025934	Miscanthus Rhizosphere	GDVVVLSGDYLDAAKVSDEGIKKLKSVMTIVDGKVIFDELR
Ga0207709_103899831	3300025935	Miscanthus Rhizosphere	LIALSDDYFDPAKVPDEAIKKLKSVLTVVDGKVVYDDLK
Ga0207665_102450302	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	SDDYFDAAKVSDEGIKKLKSVLTVVDGKVVLNELR
Ga0207689_1001318810	3300025942	Miscanthus Rhizosphere	SDDYFSPTRVPDDKIRSIRSVLTVVDGRVVHDALPRR
Ga0207667_100829151	3300025949	Corn Rhizosphere	VVALSADYFDPAKVPDEAIKKLKSVLTVVDGKVVYEDLK
Ga0207651_112745822	3300025960	Switchgrass Rhizosphere	LSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK
Ga0207712_114932922	3300025961	Switchgrass Rhizosphere	LVVLSDDYFSPTRVPDDKIRSLRSVLTVVDGRVVHDALPRR
Ga0207703_103853871	3300026035	Switchgrass Rhizosphere	GDVVVLSEDYFNPMRVPDDKIRSLRSVLTVVDGKVVHDTLAK
Ga0207702_101350791	3300026078	Corn Rhizosphere	VALSDDYFDAAKVPDEAIKKLKSVLTVVDGKVVYEDFK
Ga0207676_107112912	3300026095	Switchgrass Rhizosphere	SDDYFDPKQVPDDAIRKIKSVLTVVDGKVVHNTMN
Ga0207676_113805112	3300026095	Switchgrass Rhizosphere	VLSGDYFDSAKVPDDAIRRLKSVLTVVDGRVTYNDLH
Ga0207675_1017634191	3300026118	Switchgrass Rhizosphere	DPKRVPDDAIGRIKSALTVVDGKVVHDTMPGPAGK
Ga0209647_10051949	3300026319	Grasslands Soil	VVVLSDDYFNVLRVPDESIRKLHSVLTVVDGKVVYNLLGR
Ga0209801_11351751	3300026326	Soil	DLVVLSDDYFDTTKVSDERLKKLRSVLTVVDGKVVHDTTK
Ga0209169_103423792	3300027879	Soil	FDPKKVPDEEIKRLKSVLTVVDGKIVHNTMTDGHTR
Ga0209382_101064581	3300027909	Populus Rhizosphere	VVLSADYTDAAKVPDQEIRNLKSVLTVVDGKVVWDTMGR
Ga0268265_122544412	3300028380	Switchgrass Rhizosphere	VVLSDDYFDPKQVPDDAIRKIKSVLTVVDGKVVHNTMN
Ga0268264_118693952	3300028381	Switchgrass Rhizosphere	LSGDYLDPVKVPDEAIRKLKSVLTVVDGKVVFDETAGAR
Ga0247825_106775221	3300028812	Soil	LSDDYFDPKRVPDDVIKKLKSVLTVVDGRVVHNTIN
Ga0307296_102354311	3300028819	Soil	DDYFDPKRVPDDAIKRLKSVLTVVDGKIVHNTLPSTP
Ga0307312_105208841	3300028828	Soil	VVVLSDDYFDPKRVPDDAIKRLKSVLTVVDGKIVHNTLPSTP
Ga0170824_1011490291	3300031231	Forest Soil	DYFDPAKVPDEAIRKLKSVMTVVDGKVVFDGTAGAR
Ga0170820_175423722	3300031446	Forest Soil	DLVVLSDDYFDPAKVSDEAIKKLKSVLTVVDGKVIYDNLR
Ga0302320_112852482	3300031524	Bog	GKLGDVVVLGADYFDPKQVPDDAIRKVLPVLTIVDGKVIYDATK
Ga0310888_106332511	3300031538	Soil	VLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMN
Ga0318528_102642222	3300031561	Soil	DLVVLNADYFDANKVSDERIKKLKSVLTVIGGRIVYDQMR
Ga0310813_118437281	3300031716	Soil	SDDYFDPVKVPDEAIKKLKSVLTVVDGKVVYDDLK
Ga0318509_101948101	3300031768	Soil	VVLNADYFDANKVSDERIKKLKSVLTVIGGRIVYDQMR
Ga0310907_102397811	3300031847	Soil	DLVVLTDDYFDPKRVPDDMIRSLRSALTVVDGKVVHDELPKR
Ga0318551_100254211	3300031896	Soil	LVVLNADYFDANKVSDERIKKLKSVLTVIGGRIVYDQMR
Ga0302322_1037655652	3300031902	Fen	KLGDLVVLSDDYFDTAKVPDVAIRRLKSALTVVDGRVVFDALQR
Ga0307407_106496571	3300031903	Rhizosphere	VVLSDNYFDPMRVPDDKIRSLRSVLTVVDGKVVHDRVPRR
Ga0310901_106014962	3300031940	Soil	ADLVVLTDDYFDPKRVPDDMIRSLRSALTVVDGKVVHDELPKR
Ga0310916_112339772	3300031942	Soil	LSDDYFDQLRVPDESLRELHSVLTVVDGKVVHNRLGR
Ga0310884_109815071	3300031944	Soil	LVVLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTLN
Ga0306926_129278722	3300031954	Soil	ESRKLGDVAVLSDDFLDPNKVSDEGIKKLRSVLTVVDGKVVYDQMK
Ga0310903_106208232	3300032000	Soil	YFDPKRVPDEAIRKITSALTVVDGKVMHDTISGAAK
Ga0310897_106814391	3300032003	Soil	DLVVLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMN
Ga0318569_103033021	3300032010	Soil	LGDLVVLNADYFDANKVSDERIKKLKSVLTVIGGRIVYDQMR
Ga0310906_102499471	3300032013	Soil	ADLVVLSDDYFDPKRVPDDAIRKIKSALTIVDGKVVHDAMTP
Ga0318507_103403582	3300032025	Soil	GDLVVLNADYFDANKVSDERIKKLKSVLTVIGGRIVYDQMR
Ga0315910_102825081	3300032144	Soil	DLVVLSDDYFDPMRVPDDKIRSLRSVLTVVDGKVVYDRLAAR
Ga0315912_100206056	3300032157	Soil	DYFDPKRVPDDAIRKLTSALTVVDGKVVYDTMSGK
Ga0311301_123966192	3300032160	Peatlands Soil	LGDVVVLSDDFLDSKKVSDEGIKKLQSVLTVVDGKVIYDRMQ
Ga0307471_1005291372	3300032180	Hardwood Forest Soil	VLSDDYFDPKRVPDDAIRKLKSVMTVVDGKVVHNTMN
Ga0335080_100640326	3300032828	Soil	LGDVVVLSDDFLDPRKVSDEGIKKLHSVLTVVDGKVVYDGLGQ
Ga0310810_103044382	3300033412	Soil	VLSDDYFNVLRVPDESIRKLQSVLTIVDGKVVHNLLGR
Ga0310810_103156591	3300033412	Soil	DVVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK
Ga0247830_104868451	3300033551	Soil	SADYFDAARVRDDAIKTLHSVLTVVDGRVVHDAMR

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign