NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050712

Metagenome / Metatranscriptome Family F050712

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050712
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 41 residues
Representative Sequence DKSEYDFGFITVKVMKYLGLVKATRTGEEVPKDVPLGALDF
Number of Associated Samples 130
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 95.17 %
% of genes from short scaffolds (< 2000 bps) 88.97 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.241 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.172 % of family members)
Environment Ontology (ENVO) Unclassified
(35.172 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.759 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.99%    β-sheet: 0.00%    Coil/Unstructured: 71.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF04116FA_hydroxylase 86.21
PF00106adh_short 0.69
PF08240ADH_N 0.69
PF00202Aminotran_3 0.69
PF01568Molydop_binding 0.69
PF11218DUF3011 0.69
PF08818DUF1801 0.69
PF11188DUF2975 0.69
PF00326Peptidase_S9 0.69
PF13358DDE_3 0.69
PF01850PIN 0.69
PF01926MMR_HSR1 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 86.21
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.69
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.69
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.69

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.24 %
UnclassifiedrootN/A2.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10193706All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300000955|JGI1027J12803_105503491All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium853Open in IMG/M
3300000955|JGI1027J12803_108706799All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300001305|C688J14111_10149529All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7718Open in IMG/M
3300002568|C688J35102_118523565All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300003203|JGI25406J46586_10163187All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300003224|JGI26344J46810_1001809All Organisms → cellular organisms → Bacteria1465Open in IMG/M
3300004156|Ga0062589_101090313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7754Open in IMG/M
3300004635|Ga0062388_101807750All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005332|Ga0066388_101065739All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300005332|Ga0066388_101235286All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300005454|Ga0066687_10143630All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300005457|Ga0070662_100154763All Organisms → cellular organisms → Bacteria1788Open in IMG/M
3300005471|Ga0070698_100028209All Organisms → cellular organisms → Bacteria5832Open in IMG/M
3300005526|Ga0073909_10579433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7552Open in IMG/M
3300005541|Ga0070733_10250955All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300005548|Ga0070665_101769360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7625Open in IMG/M
3300005563|Ga0068855_100178116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales2404Open in IMG/M
3300005563|Ga0068855_102548438All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300005578|Ga0068854_101399857All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005764|Ga0066903_103882633All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300005841|Ga0068863_100195120All Organisms → cellular organisms → Bacteria1946Open in IMG/M
3300005842|Ga0068858_101650279All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005843|Ga0068860_102624175All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300006041|Ga0075023_100152047All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium854Open in IMG/M
3300006086|Ga0075019_10811037All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300006102|Ga0075015_100029085All Organisms → cellular organisms → Bacteria → Proteobacteria2507Open in IMG/M
3300006163|Ga0070715_10421530All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300006172|Ga0075018_10464636All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300006175|Ga0070712_100149497All Organisms → cellular organisms → Bacteria1792Open in IMG/M
3300006175|Ga0070712_100359903All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300006176|Ga0070765_100943720All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium815Open in IMG/M
3300006893|Ga0073928_10026743All Organisms → cellular organisms → Bacteria → Proteobacteria5678Open in IMG/M
3300006903|Ga0075426_10801041All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300006914|Ga0075436_101431552All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300006954|Ga0079219_11204216All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300007788|Ga0099795_10206742All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium830Open in IMG/M
3300009088|Ga0099830_11878086All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300009090|Ga0099827_10543309All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1000Open in IMG/M
3300009137|Ga0066709_100618337All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales1546Open in IMG/M
3300009143|Ga0099792_10750635All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300009143|Ga0099792_10886308All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300009174|Ga0105241_10765035All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300009176|Ga0105242_11602574All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300009553|Ga0105249_12960512All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300010335|Ga0134063_10168405All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300010361|Ga0126378_10624309All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300010371|Ga0134125_11270381All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300010373|Ga0134128_11379657All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300010396|Ga0134126_10420076All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300010396|Ga0134126_12578742All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300010400|Ga0134122_11369408All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300011120|Ga0150983_10540394All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300011270|Ga0137391_10935226All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300011271|Ga0137393_10880532All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300012202|Ga0137363_10390703All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300012202|Ga0137363_11262309All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300012203|Ga0137399_10787656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium800Open in IMG/M
3300012210|Ga0137378_11284820All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300012212|Ga0150985_119617038All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300012359|Ga0137385_11160014All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300012683|Ga0137398_10452453All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300012917|Ga0137395_11004821All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300012917|Ga0137395_11256666All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012924|Ga0137413_11505860All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300012925|Ga0137419_10227271All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300012930|Ga0137407_10729472All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300012955|Ga0164298_10322288All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300012960|Ga0164301_10307325All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300012984|Ga0164309_10410152All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1013Open in IMG/M
3300012986|Ga0164304_11576979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7546Open in IMG/M
3300013307|Ga0157372_11340430All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300013503|Ga0120127_10073375All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300014166|Ga0134079_10081764All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300014325|Ga0163163_12510301All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300014969|Ga0157376_11438349All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300015197|Ga0167638_1092547All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300015374|Ga0132255_101042802All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300016270|Ga0182036_11122668All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7652Open in IMG/M
3300017972|Ga0187781_10146850All Organisms → cellular organisms → Bacteria1654Open in IMG/M
3300017993|Ga0187823_10236999All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300018433|Ga0066667_10556188All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300018468|Ga0066662_11087000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7798Open in IMG/M
3300018482|Ga0066669_10832984All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300019789|Ga0137408_1301738All Organisms → cellular organisms → Bacteria1607Open in IMG/M
3300019866|Ga0193756_1031291All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300019887|Ga0193729_1024670All Organisms → cellular organisms → Bacteria → Acidobacteria2580Open in IMG/M
3300019999|Ga0193718_1051271All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300020140|Ga0179590_1178906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300020579|Ga0210407_11438509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300020580|Ga0210403_10829217All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300020581|Ga0210399_10210418All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300020581|Ga0210399_10448193All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300020582|Ga0210395_11409959All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300021170|Ga0210400_11282725All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300021181|Ga0210388_11015609All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300021406|Ga0210386_11187676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7645Open in IMG/M
3300021406|Ga0210386_11419830All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300021407|Ga0210383_10081405All Organisms → cellular organisms → Bacteria2711Open in IMG/M
3300021420|Ga0210394_11462026All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300021432|Ga0210384_10703687All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300021432|Ga0210384_11788758All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300021479|Ga0210410_10113482All Organisms → cellular organisms → Bacteria → Proteobacteria2398Open in IMG/M
3300022557|Ga0212123_10837648All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7549Open in IMG/M
3300025901|Ga0207688_11029548All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7520Open in IMG/M
3300025914|Ga0207671_11549170All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300025915|Ga0207693_10288844All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300025916|Ga0207663_10278899All Organisms → cellular organisms → Bacteria1241Open in IMG/M
3300025919|Ga0207657_10853734All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300025949|Ga0207667_12005072All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300026515|Ga0257158_1004293All Organisms → cellular organisms → Bacteria1928Open in IMG/M
3300026515|Ga0257158_1051511All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium761Open in IMG/M
3300026557|Ga0179587_10407064All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300027065|Ga0208489_1006902All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300027174|Ga0207948_1046564All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300027590|Ga0209116_1020135All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300027698|Ga0209446_1180587All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300027812|Ga0209656_10432492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7585Open in IMG/M
3300027853|Ga0209274_10253287All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300027867|Ga0209167_10301369All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300027875|Ga0209283_10014210All Organisms → cellular organisms → Bacteria4768Open in IMG/M
3300027879|Ga0209169_10001271All Organisms → cellular organisms → Bacteria15311Open in IMG/M
3300027898|Ga0209067_10214056All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300027898|Ga0209067_10290763All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300029636|Ga0222749_10185437All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300030842|Ga0075404_11137324All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300031057|Ga0170834_109494457All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300031090|Ga0265760_10084378All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300031231|Ga0170824_111815633All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300031231|Ga0170824_119453955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium893Open in IMG/M
3300031474|Ga0170818_100268111All Organisms → cellular organisms → Bacteria2486Open in IMG/M
3300031525|Ga0302326_10309032All Organisms → cellular organisms → Bacteria2519Open in IMG/M
3300031722|Ga0311351_10358270All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300031962|Ga0307479_10060268All Organisms → cellular organisms → Bacteria3657Open in IMG/M
3300031962|Ga0307479_10574513All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300032174|Ga0307470_11160086All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300032205|Ga0307472_100546570All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1010Open in IMG/M
3300032783|Ga0335079_11161108All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300032893|Ga0335069_11023622All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300032955|Ga0335076_10577211All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300033158|Ga0335077_11312171All Organisms → cellular organisms → Bacteria702Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.21%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.14%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.14%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.45%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.76%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.76%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.07%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.07%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.07%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.07%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.38%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.38%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.38%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.38%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.69%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.69%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.69%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.69%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.69%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.69%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.69%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.69%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.69%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.69%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.69%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300003224Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019866Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027065Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF006 (SPAdes)EnvironmentalOpen in IMG/M
3300027174Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030842Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1019370623300000567Peatlands SoilLRLSHDKSEYDFGFLTIKVMKGLGLVKATPRGELIPADVPLRALDF*
JGI1027J12803_10550349123300000955SoilKSEYDFGFVTVKVMKYLGLVKATRTGAELPKDVLLGALNF*
JGI1027J12803_10870679923300000955SoilLSHDDTEYDFGFLTVKVMRSLGLVKATSRGEKIPHDVPLGALGF*
C688J14111_1014952923300001305SoilGILRLSHDETEYDFGFLTVKVMKALGLVKATARGETIPEDVPLNALGF*
C688J35102_11852356513300002568SoilHHESEYDFGFITVKFMKLFGLVKATSKGAELPKDVPLGVLDF*
JGI25406J46586_1016318723300003203Tabebuia Heterophylla RhizosphereRLSHDESEYDFGFTTVKLMKALGLVQATRKGAEIPKDVPLKSLNF*
JGI26344J46810_100180923300003224Bog Forest SoilDKSEYDFGFITVKFMKLLGVVKATKKGAELPEDVPLGALEF*
Ga0062589_10109031323300004156SoilESEYDFGFLTVKVMKSLGLVKATIVGQKIPEDVALTALGS*
Ga0062388_10180775023300004635Bog Forest SoilLRLSHDKSEYDFGFITVKVMKRLGLVKATRSGAEIPKDVPLDALGF*
Ga0066388_10106573913300005332Tropical Forest SoilLSHDNSEYDFGFLTVKAMKHLGLVKATRKGAEMPKDVPLDALGF*
Ga0066388_10123528623300005332Tropical Forest SoilSHDNSEYDFGFLTVKVMKRLGLVKATASGAQLPKDVPLAALGF*
Ga0066687_1014363013300005454SoilSHDKSEYDFGFITVKVMKHLGLVKATNTGAQLPKDVPLDALGF*
Ga0070662_10015476333300005457Corn RhizosphereLRLSHDESEYDFGLLTVRVMKYLGLVKATTRGAIVPHDVSLDVLGF*
Ga0070698_10002820943300005471Corn, Switchgrass And Miscanthus RhizosphereSHDKSEYDFGLATVKFMKYFGLVKATTKGAELPKDVPLGELNF*
Ga0073909_1057943313300005526Surface SoilHDKSEYDFGFLTVKLMKLFGLVKATATGAQLPKDVPLGALDF*
Ga0070733_1025095513300005541Surface SoilSHDKSEYDFGFITVKIMKTLGLVKATRKGAELPKDVPLAALEF*
Ga0070665_10176936013300005548Switchgrass RhizosphereSHDKSEYDFGFLTVKLMKLFGLVKATATGAQLPKDVPLGALDF*
Ga0068855_10017811613300005563Corn RhizosphereSHDKSEYDFGFLTVKVMKYLGLVKATKTGEEVPKDVPFALEF*
Ga0068855_10254843823300005563Corn RhizosphereFGFLTVKVLKNLGLVTATAKGEEIPKDVPLAALDF*
Ga0068854_10139985713300005578Corn RhizosphereGFVTVKVMKYLGLVKASRTGAEVPNDVPLGTLEF*
Ga0066903_10388263323300005764Tropical Forest SoilRLSHDESEYDFGFLAIKAMKRLGLVRATRTGAELPKDVALASLNF*
Ga0068863_10019512033300005841Switchgrass RhizosphereRLSHDESEYDFGFLTVKVMKSFGLVKATSRGEIIPNDVPLDALGF*
Ga0068858_10165027923300005842Switchgrass RhizosphereLSHDKSEYDFGFVTVKVMKYLGLVKASRTGAEVPKDVPLGALEF*
Ga0068860_10262417523300005843Switchgrass RhizosphereFGFLTVKVMKSLGLVKASSTGALVPKDVPLEALDF*
Ga0075023_10015204713300006041WatershedsLRLSHDKSEYDFGFVTVKLMKYLGLVKATRTGAALPTDVPLGALDF*
Ga0075019_1081103713300006086WatershedsEYDFGFITVKVMKYLGLVKATRTGAEIPKDVALDALGF*
Ga0075015_10002908513300006102WatershedsLRLSHDKSEYDFGFVTVKFMKYLGLVKATRTGEEVPKDAPLGALDF*
Ga0070715_1042153013300006163Corn, Switchgrass And Miscanthus RhizosphereSHDKSEYDFGFVTVKVMKYLGLVQASRTGAEVPNDVPLGALEF*
Ga0075018_1046463623300006172WatershedsLRLSHDKSEYDFGFLTVKLMKSWGLVNATTKGEELPKDVPLGALDF*
Ga0070712_10014949713300006175Corn, Switchgrass And Miscanthus RhizosphereSEYDFGFMTVKVMKYLGLVKATKTGEQVPRDVPLGTLDF*
Ga0070712_10035990313300006175Corn, Switchgrass And Miscanthus RhizosphereEYDFGFLTVKVLKNLGLVTATAKGEEIPKDVPLAALDF*
Ga0070765_10094372023300006176SoilDKSEYDFGFVTVKLMKYFGLVKATTKGAELPKGVPLGALDF*
Ga0073928_1002674383300006893Iron-Sulfur Acid SpringLRLSHDSSEYDFGFITVKFMKGLGLVKATKKGAELPEDVPLGALEF*
Ga0075426_1080104113300006903Populus RhizosphereFGFLTVKVMKHLGLVKATKTGEELPHDVPLRALDF*
Ga0075436_10143155223300006914Populus RhizosphereSHDESEYDFGFMTVKVMKYLGLVKATTTGEQVPKDVPLAALDF*
Ga0079219_1120421623300006954Agricultural SoilDFGFLTVKVMKRLGLVKATKTGEELPKDVPLGALGF*
Ga0099795_1020674213300007788Vadose Zone SoilYDFGFVTVKIMKYFGLVKATTRGADLPNDVPLGALNF*
Ga0099830_1187808623300009088Vadose Zone SoilSEYDFGFVTVKLMKYFGLVKATRTGEEVPKDVPLGALDF*
Ga0099827_1054330923300009090Vadose Zone SoilDFGFVTVKLMKDLGLVKATKTGAEIPKDVRLDALGF*
Ga0066709_10061833713300009137Grasslands SoilDEEYDFGFITVKAMKALGLVKATSTGMQIPKEVPLQAVGF*
Ga0099792_1075063513300009143Vadose Zone SoilLSHDKSEYDFGFITVKVMKHLGLVKATNTGAQLPKDVPLDALGF*
Ga0099792_1088630823300009143Vadose Zone SoilDFGVVTVKIMKYFGLVRATRTGEEMPKDVPLGALDF*
Ga0105241_1076503513300009174Corn RhizosphereGFLTVKVMKSLGLVKASSTGALVPKDVPLEALDF*
Ga0105242_1160257413300009176Miscanthus RhizosphereDFGFLTVKVMRSLGLVTATRSGAEIPKDIPLDALGF*
Ga0105249_1296051213300009553Switchgrass RhizosphereRLSHDESEYDFGFLMVKVMKALGLVKATSTGAELPQDAPLKALNF*
Ga0134063_1016840523300010335Grasslands SoilFGFLTVKVMKALGLVKATARGETIPNDVPLEALGF*
Ga0126378_1062430923300010361Tropical Forest SoilYDFGFLTVRAMKSLGLVKATITGTQIPRDVPLDALNF*
Ga0134125_1127038123300010371Terrestrial SoilSEYDFGFATVKVMKYFGLVKATRTGEVVPKDVPLGALDF*
Ga0134128_1137965713300010373Terrestrial SoilKSEYDFGFVTVKVMKYVGLVKATRTGEDLPKDVPLGALDF*
Ga0136847_1351863923300010391Freshwater SedimentGVSHHPAEYDFGFLTVRAFRALGLVTTSSTGRHLPNDVPLAELGL*
Ga0134126_1042007623300010396Terrestrial SoilLRLSHDESEYDFGFLTVKVLKNLGLVTATAKGEEIPKDVPLAALDF*
Ga0134126_1257874213300010396Terrestrial SoilSEYDFGFLTVKVMKSFGLVKATARGEKIPADVPLAALGF*
Ga0134122_1136940823300010400Terrestrial SoilLRLSHDESEYDFGFLMVKVMKALGLVKATGTGAELPQDVPLKALNF*
Ga0150983_1054039423300011120Forest SoilDNSEYDFGFLTVRVMKQVGLVKATATGAQLPKDVPLNALDF*
Ga0137391_1093522613300011270Vadose Zone SoilFGFVTVKVMKYLGLVKATKTGEQLPKDVPLGALEF*
Ga0137393_1088053223300011271Vadose Zone SoilSHDKSEYDFGFLTVKLMKHLGLVKATSTGATLPKDVPLGALDF*
Ga0137454_101387733300011406SoilLRLSHDPAEYDLGFLTVRCMKALGLVRPSRTGAQLPHDFPLKDLGF*
Ga0137363_1039070313300012202Vadose Zone SoilLSHDKSEYDFGFLTVKVMKHLGLVKATSTGATLPKDVPLDALGF*
Ga0137363_1126230913300012202Vadose Zone SoilLSHDKSEYDFGFVTVKVMKYFGLVKATRTGEEVPKDVPLGALDF*
Ga0137399_1078765623300012203Vadose Zone SoilLSHDKSEYDFGFITVKVMKYLGLVKATRTGAEIPKDVPLDALGF*
Ga0137378_1128482013300012210Vadose Zone SoilSHDKSEYDFGFITVKVMKYLGLVKATRTGEELPKDVPLGALGF*
Ga0150985_11961703813300012212Avena Fatua RhizosphereSEYDFGFLTVKVMKALGLVKATTRGETIPEDVPLGALGF*
Ga0137385_1116001413300012359Vadose Zone SoilLSHDKSEYDFGFVTVKLMKYLGLVKATRTGAEIPKDVPLDALGF*
Ga0137398_1045245313300012683Vadose Zone SoilRLSHEKSEYDFGFVTVKLMKYLGLVKATKTGEEMPKDVPLGALDF*
Ga0137395_1100482113300012917Vadose Zone SoilKSEYDFGFVTVKVMKYFGLVKATRTGEEMPKDVPLGALDF*
Ga0137395_1125666623300012917Vadose Zone SoilEYDFGFVTVKLMKYFGLVKATTRGAELPNDVPLGALNF*
Ga0137413_1150586013300012924Vadose Zone SoilYDFGFVTVKLMKYFGLVKATTNGAELPKDVPLDALNF*
Ga0137419_1022727133300012925Vadose Zone SoilFGFVTVKVMKYFGLVKATRTGEEVPKGVPLGALDF*
Ga0137407_1072947213300012930Vadose Zone SoilFGFLTVKVMKALGLVKATVTGAQLPKDVPLGALEF*
Ga0164298_1032228823300012955SoilDFGFVTVKVMKYLGLVKASRTGAEVPKDVPLGALEF*
Ga0164301_1030732513300012960SoilDESEYDFGFLTVRVMKCLGLVKATTRGAIVPHDVSLDVLGF*
Ga0164309_1041015223300012984SoilLSHDKSEYDFGFVTVKLMKYLGLVKATTKGAELPHDVPLRALDF*
Ga0164304_1157697913300012986SoilESEYDFGFLTVKVMKYFGLVKSTTRGETIPKDVSLSALGF*
Ga0157372_1134043023300013307Corn RhizosphereYDFGFLTVRVMKCLGLVKATTRGAIVPHDVSLDVLGF*
Ga0120127_1007337523300013503PermafrostSHDKSEYDFGFITVKVMKYLGLVKATRTGAEIPRDVPLDALGF*
Ga0134079_1008176413300014166Grasslands SoilLSHDKSEYDFGFITVKAMKYLGLVKATNTGAQLPKDVPLDALGF*
Ga0163163_1251030123300014325Switchgrass RhizosphereSEYDFGFVTVKVMKYLGLVKASRTGAEVPKDVPLGALEF*
Ga0157376_1143834923300014969Miscanthus RhizosphereFLRLSHDKSEYDFGLVTVKTMKYLGLVSATAKGAEIPKDVPLTSLNF*
Ga0167638_109254713300015197Glacier Forefield SoilDKSEYDFGFVTVKLMKYLGLVKATAKGAELPEDVPLGALDF*
Ga0132255_10104280223300015374Arabidopsis RhizosphereDFGFLTVKVMKSLGLVKASSTGALVPKDVPLEALDF*
Ga0182036_1112266823300016270SoilFGFLTVKVMKSLGLVQATTTGAHIPTDVSLDALNF
Ga0187781_1014685013300017972Tropical PeatlandFGFVTVKFLKRLGLVKATARGEQIPADVRLAALDF
Ga0187823_1023699913300017993Freshwater SedimentESEYDFGFITVKAMKHLGLVKATTRGAELPNDVPLGALNF
Ga0066667_1055618813300018433Grasslands SoilFGFLTVKVMKSLGLVKASSTGVLVPKDVPLEALDF
Ga0066662_1108700023300018468Grasslands SoilYDFGFLTVKVMKALGLVKATTRGESIPEDVPLGALGF
Ga0066669_1083298413300018482Grasslands SoilSEYDFGFITVKVMKHLGLVKATNTGAQLPKDVPLDALGF
Ga0137408_130173813300019789Vadose Zone SoilHDKSEYDFGFITVKVMKHLGLVKATNTGAQLPKDVPLDALGF
Ga0193756_103129123300019866SoilYDFGFLTVKVMKSLGLVKASSTGALVPKDVPLEALDF
Ga0193727_113666613300019886SoilHDPAEYDFGFLTVRCMKALGLVRASRTGAQLPKDVPLQDLGF
Ga0193729_102467043300019887SoilRLSHDESEYDFGFVTVKIMKHFGLVKATTKGAELPKDVPLGALDF
Ga0193718_105127123300019999SoilHEKSEYDFGFITVKAMKYLGLVKATSTGAEIPEDVALDALGF
Ga0179590_117890613300020140Vadose Zone SoilDQSEYDFGFATVKIMKYFGLVKATTRGADLPNDVPLGALNF
Ga0210407_1143850913300020579SoilLSHDKSEYDFGFVTVKLMKYFGLVKATRTGAELPKDVPLGALDF
Ga0210403_1082921723300020580SoilKSEYDFGFITVKVMKYLGLVKATRKGAELPSDVPLGALEF
Ga0210399_1021041813300020581SoilLSHDESEYDFGFITVKVMKYLGLVKATRTGEEVPKDVPFGVLDF
Ga0210399_1044819323300020581SoilSEYDFGFLTVKVMKYLGLVKATARGEIVPGDVPLDALGF
Ga0210395_1140995923300020582SoilLRLSHDKSEYDFGFLTVKVMKYLGLVKATRTGEEIPKDVPLGALDF
Ga0210400_1128272513300021170SoilLSHDESEYDFGFLTVKVVKYLGVVKATTRGETIPNEVPLAALDF
Ga0210388_1101560923300021181SoilRLSHHESEYDFGFLTVKVMKAFGLVRATARGREVPKDVPLAALNF
Ga0210386_1118767613300021406SoilLRLSHDKSEYDFGFITVKVMKYLGLVKATSTGAHMPKDVPLGALGF
Ga0210386_1141983023300021406SoilDESEYDFGFLTVKVMKRLGLVKATGRGEIVPNDVPLAALDF
Ga0210383_1008140513300021407SoilLSHDNSEYDFGFLTVKVMKQIGLVKATATGAQLPKDVPLDALDF
Ga0210394_1146202613300021420SoilFGFLTVKVMKSLGLVKATARGVDLPKDVPLGALEF
Ga0210384_1070368723300021432SoilEYDFGFLTVKVMKHLGLVKATTRGEKIPHDVPLEALGF
Ga0210384_1178875823300021432SoilDKSEYDFGFITVKVMKYLGLVKATRTGEEVPKDVPLGALDF
Ga0210410_1011348233300021479SoilEYDFGFITVKVMKYLGLVKATRTGAEIPKDIPLDALGF
Ga0212123_1083764813300022557Iron-Sulfur Acid SpringYDFGFVTVKLMKYCGLVKATTKGAELPKDVPLNALNF
Ga0207688_1102954823300025901Corn, Switchgrass And Miscanthus RhizosphereEYDFGFLTVKVMKYFGLVKSTTRGETIPKDVPLSALGF
Ga0207671_1154917023300025914Corn RhizosphereHHYPGILRLSHDKSEYDFGFATVKVMKYLGLVKATRTGADVPRDVPLGALDF
Ga0207693_1028884413300025915Corn, Switchgrass And Miscanthus RhizosphereEYDFGFLTVKVLKNLGLVTATAKGEEIPKDVPLAALDF
Ga0207663_1027889923300025916Corn, Switchgrass And Miscanthus RhizosphereSHDNSEYDFGFLTVKLMKYLGLVKATRKGEELPKDVPLDALGF
Ga0207657_1085373423300025919Corn RhizosphereEYDFGFITVKAMKALGLVKATSTGLQIPKEVPLQAVGF
Ga0207667_1200507223300025949Corn RhizosphereFGFLTVKVLKNLGLVTATAKGEEIPKDVPLAALDF
Ga0257158_100429313300026515SoilRLSYDKSEYDFGFVTVKLMKYFGLLKATTKGAELPKDVPLDALNF
Ga0257158_105151123300026515SoilLRLSHDESEYDFGFVTVKLMKYFGLVKATTKGAELPKDVPLGALDF
Ga0179587_1040706423300026557Vadose Zone SoilHEKSEYDFGFITVKVMKTLGLVKATSTGAQIPKDIPLDALGF
Ga0208489_100690213300027065Forest SoilSHDKSEYDFGFVTVRLMKYFGLVKATRTGAELPKDVPLGALDF
Ga0207948_104656423300027174Forest SoilRLSHDKSEYDFGFITVKVMKYLGLVKATSTGAQLPKDVPLDALGF
Ga0209116_102013523300027590Forest SoilEYDFGFLTVKVMKYLGLVKATTRGETIPKDVPLAALDF
Ga0209446_118058723300027698Bog Forest SoilHHESEYDFGFLTVKAMKNFGLVKATPNGARMPKDVPLVGLDF
Ga0209656_1043249213300027812Bog Forest SoilRLSHDNSEYDFGFLTVKLMKQLGLVRATRKGQELPKDLPLDALGF
Ga0209274_1025328723300027853SoilLRLSHDKSEYDFGFVTVKVMKSWGLVKATARGASIPADIPLGGLGF
Ga0209167_1030136913300027867Surface SoilHDNSEYDFGFLTVKFMKQLGLVQATRKGQELPKDVPLEALGF
Ga0209283_1001421043300027875Vadose Zone SoilDKSEYDFGFVTVKLMKYFGLVKATRTGEEVPKDVPLGALDF
Ga0209169_1000127113300027879SoilLRLSHHESEYDFGFLTVKVMKAFGLVRATARGREVPKDVPLAALNF
Ga0209067_1021405613300027898WatershedsFGFITVKVMKYLGLVKATSTGGQLPKDVPLDALGF
Ga0209067_1029076323300027898WatershedsEYDFGFITVKVMKYLGLVKATRTGAEIPKDVALDALGF
Ga0222749_1018543713300029636SoilEYDFGFLTVKVMKQIGLVKATSTGTQLPKDVPLDALDF
Ga0075404_1113732413300030842SoilDFGFVTVKIMKHFGLVKATTKGAELPKDVSLGALNF
Ga0170834_10949445723300031057Forest SoilHDDSEYDFGFLTVKVMKNLGLVKATRKGAELPKDVPLGALDF
Ga0265760_1008437823300031090SoilSEYDFGFVTVKIMKALGLVKATARGVDVPNDVPLGALEF
Ga0170824_11181563323300031231Forest SoilRLSHEKSEYDFGFITVKAMKYLGLVKATRTGAEIPKDVALEALGF
Ga0170824_11945395523300031231Forest SoilFGFVTVKAMKYFGLVKATKKGEELPADVPLGALDF
Ga0170818_10026811113300031474Forest SoilDKSEYDFGFVTVKAMKRLGLVQATTKGKELPKDVPLGALEF
Ga0302326_1030903213300031525PalsaLRLSHDESEYDFGFLTVKVMKGLGLVNATARGELKPPDVPLAALDF
Ga0311351_1035827023300031722FenEYDFGFIAVKAMKAMGLVKATRTGLEIPQDVPLASLGF
Ga0307479_1006026853300031962Hardwood Forest SoilLRLSHDESEYDFGFITVKVMKYLGLVKATRTGEEVPKDVPFGALDF
Ga0307479_1057451313300031962Hardwood Forest SoilLRLSHDESEYDFGFITVKVMKYLGLVKATRTGEEVPKDVPFGVLDF
Ga0307470_1116008623300032174Hardwood Forest SoilHDESEYDFGFITVKVMKYLGLVKATRTGEDVPKGVPFGALEF
Ga0307471_10296375433300032180Hardwood Forest SoilDLGFLTVRGLKALGLVRPTRTGAQLPKDFPLRDLGF
Ga0307472_10054657013300032205Hardwood Forest SoilDKSEYDFGFLTVKLMKYVGLVKATTKGAELPKDVPLGTLDF
Ga0335079_1116110823300032783SoilHDESEYDFGFLTVKLMKQLGLVKASKHGAELPKDVPLGALDF
Ga0335069_1102362213300032893SoilLSHDESEYDFGFLTVKVMKAFGLVKASPRGEIVPQDVPLSALDF
Ga0335076_1057721123300032955SoilDESEYDFGFLTVKFMKSLGLVKASRHGAELPKDVPLGAIDF
Ga0335077_1131217113300033158SoilLRLSHDESEYDFGFLTVKLMKQLGLVKASKHGADLPKDVPLGALDF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.