Basic Information | |
---|---|
Family ID | F050728 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 145 |
Average Sequence Length | 43 residues |
Representative Sequence | QAYYQTEQTDKLHEAEAKLRGTNVPTMEQALVVPAARAKRPNI |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 145 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.39 % |
% of genes near scaffold ends (potentially truncated) | 48.28 % |
% of genes from short scaffolds (< 2000 bps) | 45.52 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.483 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.862 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.207 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.172 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.66% β-sheet: 0.00% Coil/Unstructured: 56.34% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 145 Family Scaffolds |
---|---|---|
PF07238 | PilZ | 88.28 |
PF00589 | Phage_integrase | 1.38 |
PF02518 | HATPase_c | 1.38 |
PF07715 | Plug | 0.69 |
PF13181 | TPR_8 | 0.69 |
PF09411 | PagL | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.48 % |
All Organisms | root | All Organisms | 45.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573000|GPBTN7E01CNTIL | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300000789|JGI1027J11758_12456739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300001471|JGI12712J15308_10149779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101519793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300004092|Ga0062389_101989869 | Not Available | 758 | Open in IMG/M |
3300004152|Ga0062386_101519872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300005176|Ga0066679_11000459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300005445|Ga0070708_101361555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
3300005541|Ga0070733_10678180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300005591|Ga0070761_10938136 | Not Available | 548 | Open in IMG/M |
3300005602|Ga0070762_10096046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1708 | Open in IMG/M |
3300005602|Ga0070762_10484400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
3300005764|Ga0066903_104222481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
3300006086|Ga0075019_10085226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1803 | Open in IMG/M |
3300006162|Ga0075030_100288259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
3300006162|Ga0075030_101427381 | Not Available | 542 | Open in IMG/M |
3300006174|Ga0075014_100895792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300006755|Ga0079222_12183862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300006797|Ga0066659_10597618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
3300009143|Ga0099792_10083609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1640 | Open in IMG/M |
3300009792|Ga0126374_10876607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300009839|Ga0116223_10344279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
3300010379|Ga0136449_101641803 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300012096|Ga0137389_10506920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
3300012469|Ga0150984_118459416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
3300012474|Ga0157356_1021337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300012917|Ga0137395_10769261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300012924|Ga0137413_10188653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1377 | Open in IMG/M |
3300012924|Ga0137413_11033077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300016445|Ga0182038_10268932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1380 | Open in IMG/M |
3300017934|Ga0187803_10141037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
3300018012|Ga0187810_10471318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300018021|Ga0187882_1137170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
3300018026|Ga0187857_10473838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300018042|Ga0187871_10804979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300018085|Ga0187772_11048155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300018086|Ga0187769_11411814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300018090|Ga0187770_11118326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300020021|Ga0193726_1043094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2182 | Open in IMG/M |
3300020583|Ga0210401_11018676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300021405|Ga0210387_10643359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
3300021432|Ga0210384_11682032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300021861|Ga0213853_10546266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
3300022522|Ga0242659_1048914 | Not Available | 743 | Open in IMG/M |
3300022532|Ga0242655_10004163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2365 | Open in IMG/M |
3300022722|Ga0242657_1208218 | Not Available | 544 | Open in IMG/M |
3300022730|Ga0224570_109935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300022734|Ga0224571_105075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
3300022873|Ga0224550_1064690 | Not Available | 526 | Open in IMG/M |
3300024187|Ga0247672_1094489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300025494|Ga0207928_1003285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2977 | Open in IMG/M |
3300026025|Ga0208778_1003217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1491 | Open in IMG/M |
3300026304|Ga0209240_1282188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300027590|Ga0209116_1030813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300027767|Ga0209655_10297028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300027884|Ga0209275_10575017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300027889|Ga0209380_10722682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300027911|Ga0209698_10314594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1237 | Open in IMG/M |
3300028882|Ga0302154_10191492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
3300029914|Ga0311359_10163526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2019 | Open in IMG/M |
3300030659|Ga0316363_10412595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300030991|Ga0073994_12020096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
3300031249|Ga0265339_10361255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300031474|Ga0170818_104867060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300031718|Ga0307474_11001297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300031720|Ga0307469_11419119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300031754|Ga0307475_10053139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3048 | Open in IMG/M |
3300031962|Ga0307479_10704972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
3300032160|Ga0311301_11076745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
3300032783|Ga0335079_11179131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300032897|Ga0335071_10088360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3038 | Open in IMG/M |
3300034163|Ga0370515_0203800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.86% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.52% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.83% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.83% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.83% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.83% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.45% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.76% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.76% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.76% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.07% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.07% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.07% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.07% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.07% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.07% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.07% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.38% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.38% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.38% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.38% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.69% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.69% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.69% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.69% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.69% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.69% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.69% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.69% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001635 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026025 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N55_04384870 | 2189573000 | Grass Soil | LLVQAYYQDVQTEKLHEVEAKLRGTNVPTIEQALVVPGVRAKRPNM |
FG2_07777660 | 2189573004 | Grass Soil | YYQTEQTDKLHEVEAKLRGTNVPTMEQALVVPVVRAKRPNI |
JGI1027J11758_110387132 | 3300000789 | Soil | EKLHAIEARLRGTNVPTMEQALVVPVARSKRPNI* |
JGI1027J11758_124567392 | 3300000789 | Soil | TMELLVQAHYQTMQTAKLHAAEAKLRGNNLPTMEQAIVVPAARSKRPNI* |
JGI12712J15308_101497792 | 3300001471 | Forest Soil | MQLLVQAYYETGKTEQLYEIEERLRGTNVPTMEQALVVPAVRAKLPIM* |
JGI12659J15293_101235671 | 3300001546 | Forest Soil | KTDKLYEIEEKLRGTNLPTMEQALVVPAARAKLPIM* |
JGI20243J16304_1011572 | 3300001635 | Forest Soil | SDKLAEVEGKLRGTNVPTMEQALVVPAARLRRPEI* |
JGIcombinedJ26739_1005023502 | 3300002245 | Forest Soil | QTDKLHAAEAKLRGTNVPTMEQALVVPAMRAKRPII* |
JGIcombinedJ26739_1015197931 | 3300002245 | Forest Soil | LLVQAYYETGKTEQLYEIEERLRGTNVPTMEQALVVPAVRAKLPIM* |
Ga0062389_1019898691 | 3300004092 | Bog Forest Soil | LVQAYYQTNQSDKLAQAEATLRGTNVPTIEQALVVPAARLRRPQM* |
Ga0062386_1015198722 | 3300004152 | Bog Forest Soil | LELLVQAYYQTNQSDKLHQAEAILRGTNVPTMEQALVVPAARSRRPEI* |
Ga0066679_110004592 | 3300005176 | Soil | VQAYYLTMQTEKLHTAEAKLRGYNMPTMEQALVVPAARSKRPNI* |
Ga0070708_1013615552 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ELLVQAYYQTAQTDKLHELEAKLRGTNVPTMEQALVVPAVRAKRPNI* |
Ga0070733_102465791 | 3300005541 | Surface Soil | YYQTEQVDKLHEVEAKLRGTNVPTMEQALVVPAARAKRPVI* |
Ga0070733_106781801 | 3300005541 | Surface Soil | PFTMELLVQAYYESGATEKLHEIEARLRGTNLPTMEQALVVPGLRLKRPTM* |
Ga0070732_101657924 | 3300005542 | Surface Soil | AYYQTSQPDKVHEIEVKLRGTNVPTMEQALVVPAARTRKPTS* |
Ga0070761_109381362 | 3300005591 | Soil | LLVQAYYQTNQSDKLAEAEAKLRGTNVATMEQALVVAAARLRRPEM* |
Ga0070762_100960464 | 3300005602 | Soil | LVQAYYQTMQTEKLHEVEARLRGTNVPTMEQALVVPAARAKRPVI* |
Ga0070762_104844003 | 3300005602 | Soil | FTMELLVQAYYQTAQTDKLHAAEAKLRGTNVPTMEQALVVPAMRAKRPII* |
Ga0066903_1042224811 | 3300005764 | Tropical Forest Soil | ELLVQAYYQTMQADKLHEAEAKLRSTNVPTMEQALVVPGARSKRPNI* |
Ga0070717_119279621 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QTEQTEKLHAIEARLRGTNVPTMEQALVVPVARSKRPNI* |
Ga0070717_120953651 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QTDKLHEVEAKLRGTNVPTIEQALVVPGARAKRPVI* |
Ga0075019_100852261 | 3300006086 | Watersheds | ELLVQAYYQTMQIDKLHEAEAKLRGTNVPTMEQALVVPGIRSKRPNI* |
Ga0075030_1002882591 | 3300006162 | Watersheds | MDLLIQAYYQTMQTDKLHAAEAKLRGTNVPTMEQALVVPAARSKRPNI* |
Ga0075030_1003235711 | 3300006162 | Watersheds | MQTDKLHELEARLRGTNVPTMEQALVVPAARAKRPVI* |
Ga0075030_1014273812 | 3300006162 | Watersheds | MELLVQAYYQTMQTDKLHELEAKLRGTNLPTMEQALVVPAARAKRPII* |
Ga0070715_100813461 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ASDKRHEVEVKLRASNAPTMEQALVVPAARARRPDGL* |
Ga0075014_1008957922 | 3300006174 | Watersheds | TMELLVQAYYQTLQTDKLHEVEARLRGTNMPTMEQALVVPAARAKRPNI* |
Ga0079222_121838622 | 3300006755 | Agricultural Soil | LLVQAYYQTSQPEKLHEVEVRLRGTNVPTMEQALVVPAARARRPTI* |
Ga0066659_105976183 | 3300006797 | Soil | TMELLVQAYYQTMQTEKLHTAEAKLRGNNMPTMEQALVVPAARSKRPNI* |
Ga0079219_118413581 | 3300006954 | Agricultural Soil | QTEKLHEVEAKLRGTNVPTMEQALVVPVARAKRPVI* |
Ga0099792_100836091 | 3300009143 | Vadose Zone Soil | LLVQAYYQTNQSDKLHEVEAKLRGTNVATMEQAVVVPTIRLQRPQI* |
Ga0116222_12606711 | 3300009521 | Peatlands Soil | PDKLHEVEVRLRGTNVPTMEQALVVPAARARKPTS* |
Ga0116105_10076421 | 3300009624 | Peatland | NQSEKLHEAEAILRGTNVPTMEQALVVPAARSRRPEI* |
Ga0116217_103083222 | 3300009700 | Peatlands Soil | VQAYYQTFQPDKLHDIEVRIRGTNVPTMEQALVVPAARARRPTS* |
Ga0126374_108766071 | 3300009792 | Tropical Forest Soil | MELLVQAYYQTLQTDKLHEAEVKLRGTNVPTMEQALVVPAARSKRPNI* |
Ga0116223_103442791 | 3300009839 | Peatlands Soil | MELLVQAYYQTFQPEKLHDVEVKLRGTNVPTMEQALVVPAARARRPTS* |
Ga0126372_100795781 | 3300010360 | Tropical Forest Soil | TEKLHEAEAKLRSTNVPTMEQALVVPAARSKRPNI* |
Ga0126381_1014745431 | 3300010376 | Tropical Forest Soil | QTDKLHEAEAKLRGTNVPTMEQAIVVPAARSKRPNI* |
Ga0136449_1016418032 | 3300010379 | Peatlands Soil | FTMELLVQAYYQTFQPDKLHDIEVRIRGTNVPTMEQALVVPAARARRPTS* |
Ga0126361_105243031 | 3300010876 | Boreal Forest Soil | QAYYQTAQTDKLHEVEAKLRGTNVPTMEQALVVPAIRAKRPVI* |
Ga0137391_103368331 | 3300011270 | Vadose Zone Soil | DKLHEIEAKLRATNVPTMEQALVVPAARSKRPYI* |
Ga0137389_105069203 | 3300012096 | Vadose Zone Soil | YQTNQSEKLHEAEARLRGTNVPTMEQALVVPAARSRRPQI* |
Ga0150984_1184594161 | 3300012469 | Avena Fatua Rhizosphere | DNPFSMELLVQAYYQTSQPEKVHEMEVKLRGTNMPTMEQALVVPAARSRKPTS* |
Ga0157356_10213372 | 3300012474 | Unplanted Soil | ELLVQAYYQTMQTDKLHAAEAKLRGNNMPTMEQALVVPAARSKRPNI* |
Ga0137395_107692612 | 3300012917 | Vadose Zone Soil | ELLVQAYYQTNQSDKLHAIEAKLRGTNVATMEQAVVVPAVRLQRPQI* |
Ga0137396_107156023 | 3300012918 | Vadose Zone Soil | YYQTNQPDKLHEVEAKLRGTNVPTMEQALVVPAARSRRPAI* |
Ga0137413_101886533 | 3300012924 | Vadose Zone Soil | FTMELLVQAYYQTNQLEKLHEAEAKLRGTNVPTMEQALVVPAARSRRPQI* |
Ga0137413_110330772 | 3300012924 | Vadose Zone Soil | ELLVQAYYQTNQSDKLHEVEAKLRGTNVATMEQAVVVPTIRLQRPQI* |
Ga0181537_112005712 | 3300014201 | Bog | YYQTGQAEKLNQIEAKLRGTNVPTIEQALVVPAARLRRPEM* |
Ga0181525_103997213 | 3300014654 | Bog | QAYYQTEQTDKLHEAEAKLRGTNVPTMEQALVVPAARAKRPNI* |
Ga0181519_105598421 | 3300014658 | Bog | DKLHDMEAKLRGTNVATMEQALVVPAARAKRPQT* |
Ga0182037_121537151 | 3300016404 | Soil | QVEKLHQIEAKLRGTNVPTMEQALVVPAERTKRPNI |
Ga0182038_102689321 | 3300016445 | Soil | FTMELLVQAYYQTMQTEKLHEAEVKLRGTNVPTMEQALVGPAARTKRPNI |
Ga0187803_101410371 | 3300017934 | Freshwater Sediment | MELLVQAYYQTMQTDKLHAAEAKLRGTNVPTMEQALVVPAARSKRPNI |
Ga0187808_104550541 | 3300017942 | Freshwater Sediment | ETSQPDKLHEVEVKLRGTNVPTMEQALVVPAARARRPVI |
Ga0187817_106332791 | 3300017955 | Freshwater Sediment | QAYYQTMQTEKLHAAEAKLRGTNVPTMEQALVVPAARSKRPNI |
Ga0187776_110986421 | 3300017966 | Tropical Peatland | AYFETGQMDKKDEIEVKLRGTNVPTMEQALIVPGVRSKPPASM |
Ga0187810_104713182 | 3300018012 | Freshwater Sediment | TMELLVQAYYQTMQTEKLHEVEAKLRGTNVPTMEQALVVPAIRAKRPNI |
Ga0187882_11371703 | 3300018021 | Peatland | YYQSSQTEKLAEAEAKLRSTNVPTMEQALVVPAARLRRPEI |
Ga0187857_104738382 | 3300018026 | Peatland | FTMELLVQAYYETGLTDKLHEIEGKLRGTNLPTMEQALVVPAMRSSRPII |
Ga0187871_108049792 | 3300018042 | Peatland | FTMELLVQAYYQTNQPDKLAEAEAKLRGTNVPTMEQAIVVPAARLRRPEM |
Ga0187772_107891611 | 3300018085 | Tropical Peatland | TNQSDKLVQAEAKLRGTNVPTMEQALVVPAARLRRPEM |
Ga0187772_110481551 | 3300018085 | Tropical Peatland | LLVQAYYQTLQTDRLHDMEAKLRSTNVPTVEQAVVVPSIRAKQPSL |
Ga0187769_114118141 | 3300018086 | Tropical Peatland | LLVQAYYQTLDTEKLHEMEVKLRGTNVPTMEQALVVPAARAKRPTI |
Ga0187770_111183261 | 3300018090 | Tropical Peatland | LELLAQAYYQTSQPDKLHEVEVKLRGTNVPTMEQALIVPAARSRRPVI |
Ga0187798_11889311 | 3300019275 | Peatland | LETEKLHEIEAKLRATNVPTIEQALVVPVIRAKRPNT |
Ga0193726_10430942 | 3300020021 | Soil | LLVQAYYQTDQPEKLHEVEGKLRGTNVPTMEQALVVPAARAKRPII |
Ga0210407_101477764 | 3300020579 | Soil | GLTDKLHEIEGKLRGTNLPTMEQALVVPAMRSSRPII |
Ga0210401_110186762 | 3300020583 | Soil | QAYYQSGQSDKLAQAEARLRGTNVPTMEQAIVVPAARLRRPEM |
Ga0210401_113855222 | 3300020583 | Soil | VQAYYKTYQPDKLHEVEVKLRGTNVPTMEQALVVPAARARRPTI |
Ga0210404_107781632 | 3300021088 | Soil | YQTAQTDKLHEAEEKLRGTNVPTMEQALVVPAVRATRPHM |
Ga0210396_100439781 | 3300021180 | Soil | YKTYQPDKLHEVEVKLRGTNVPTMEQALVVPAARARRPTI |
Ga0210388_108659292 | 3300021181 | Soil | TEKLHELEAKLRGTNVPTLEQALVVPAARARRPVI |
Ga0210393_112729152 | 3300021401 | Soil | VQAYYKTYQPDKLHEVEVKLRGTNMPTMEQALVVPAARARRPTI |
Ga0210389_101627281 | 3300021404 | Soil | AYYQTEQTDKLHETEAKLRGTNVPTMEQALVVPAARAKRPNI |
Ga0210387_106433591 | 3300021405 | Soil | FTMELLVQAYYQTGQTDKLHQTEAKLRGTNVATMEQALVVPAARLRRPQI |
Ga0210386_109344313 | 3300021406 | Soil | YYKTYQPDKLHEVEVKLRGTNVPTMEQALVVPAARARRPTI |
Ga0210384_116820321 | 3300021432 | Soil | TMELLVQAYYQTNQSEKLHQAEARLRGTNVPTMEQAIVVPAARLRRPEI |
Ga0210402_106843383 | 3300021478 | Soil | QAYYQTEQTDKLHEIEAKLRGTNVPTMEQALVVPAARAKRPVI |
Ga0126371_114741453 | 3300021560 | Tropical Forest Soil | LVQAYYETSQPDRLHEVEVKLRGTNVPTMEQALVVPVARSRRPVI |
Ga0213853_105462662 | 3300021861 | Watersheds | LVQAYYQTYQPEKVHEMEVKLRGTNVPTMEQALVVPAARAKRPTS |
Ga0242659_10489144 | 3300022522 | Soil | LVQAYYQTNQSEKLHEAESQLRGTNVPTMEQALVVPAARLRRPEI |
Ga0242655_100041631 | 3300022532 | Soil | FTMELLVQAYYQTTQPEKLHAAEAKLRGYNMPTMEQALVVPAARSKRPNI |
Ga0242662_100882901 | 3300022533 | Soil | QTNQSDKLHEAEGKLRGTNVPTMEQALVVPAARSRRPEI |
Ga0242657_12082182 | 3300022722 | Soil | ELLVQAYYQTNQSDKLHEAESLLRGTNVPTMEQALVVPAARLRRPEI |
Ga0242654_102572512 | 3300022726 | Soil | QAYYQTEQPEKLHEVEAKLRGTNVPTMEQALVVPEARAKRPII |
Ga0224570_1099352 | 3300022730 | Rhizosphere | LLVQAYYQTNQSDKLAEVEARLRGTNVPTMEQALVVPAARLRRPEM |
Ga0224571_1050752 | 3300022734 | Rhizosphere | LLVQAYYQTNQSDKLHEVEAKLRSTNVPTMEQALVVPAARLRRPEI |
Ga0224550_10646901 | 3300022873 | Soil | LLVQAYYQTNQSDKLAEAEAKLRGTNVATMEQALVVAAARLRRPEM |
Ga0247672_10944892 | 3300024187 | Soil | VQAYYQTEQTEKLHAIEARLRGTNVPTMEQALVVPVARSKRPNI |
Ga0208935_10618001 | 3300025414 | Peatland | TNQSEKLHEAEAILRGTNVPTMEQALVVPAARSRRPEI |
Ga0207928_10032856 | 3300025494 | Arctic Peat Soil | ELLVQAYYQTEQTDKLHEVEAKLRGTNMPTMEQALVVPAARAKRPVI |
Ga0207695_110300081 | 3300025913 | Corn Rhizosphere | QAYYQTSQPEKVHEIEVKLRGMNVPTMEQALVVPAARLRKPTS |
Ga0208778_10032171 | 3300026025 | Rice Paddy Soil | FSMELLVQAYYHTSQPEKVHEIEVKLRGNNMPTMEQALVVPAARSRKPTS |
Ga0209240_12821882 | 3300026304 | Grasslands Soil | PYTMELLVQAYYETSQTDKLHEIEAKLRGTNVPTMEQALVVPAARSKRPAI |
Ga0209116_10308131 | 3300027590 | Forest Soil | EQVDKLHEVEAKLRGTNVPTMEQALVVPAARAKRPVI |
Ga0209655_102970282 | 3300027767 | Bog Forest Soil | SLELLVQAYYQTNQTEKLHQAEATLRGTNVPTMEQALVVPAARLRRPQI |
Ga0209580_105796741 | 3300027842 | Surface Soil | YYQTEQTDKLHEIEAKLRGTNVPTMEQALVVPAARAKRPVI |
Ga0209693_101312671 | 3300027855 | Soil | TYQTDKLHEVEVKLRGTNVPTMEQALVVPAARARRPTI |
Ga0209693_105004332 | 3300027855 | Soil | TMQTEKLHTAEAKLRGYNMPTMEQALVVPAARSKRPNI |
Ga0209169_102490562 | 3300027879 | Soil | QSDKLAEAEARLRGTNVPTMEQAIVVPAARLRRPEM |
Ga0209275_105750171 | 3300027884 | Soil | FTLELLVQAYYKTYQPDKLHEVEVKLRGTNMPTMEQALVVPAARARRPTI |
Ga0209380_107226822 | 3300027889 | Soil | ELLVQAYYQTNQSDKLAEAEARLRGTNVPTMEQAIVVPAARLRRPEM |
Ga0209415_105966691 | 3300027905 | Peatlands Soil | QPDKLHEVEVKLRGTNMPTMEQALVVPAARARRPTI |
Ga0209006_112774212 | 3300027908 | Forest Soil | DLQTDKLHEVESRLRGTNIPTIEQAVVVPAVRAQRPHM |
Ga0209698_103145941 | 3300027911 | Watersheds | ELLVQAYYQTMQIDKLHEAEAKLRGTNVPTMEQALVVPGIRSKRPNI |
Ga0209698_107630691 | 3300027911 | Watersheds | SNQPEKLHELEVRLRSTNVPTLEQALIVPAARARVPQS |
Ga0265354_10078663 | 3300028016 | Rhizosphere | YYQTNQSDKLAEAEATLRGTNVPTMEQALVVPAVRLRRPEM |
Ga0302232_104361651 | 3300028789 | Palsa | YYQTNQSDKLAQAEGRLRGTNVPTMEQALVVPAARLRRPEM |
Ga0302154_101914923 | 3300028882 | Bog | PFTLELLVQAYYQTNQSENLAQAEARLRGTNVPTMEQALVVPAARSRRPQI |
Ga0311359_101635265 | 3300029914 | Bog | FSMELLVQAYYQTDQSDKLHDIEARLRGTNVPTMEQALVVPAARLRRPEI |
Ga0302188_101482171 | 3300029986 | Bog | SDKLHDIEARLRGTNVPTMEQALVVPAARLRRPEI |
Ga0311337_100940545 | 3300030000 | Fen | AFDKMHEAQAKLRATNLPTMEQALVVPAARAKRPE |
Ga0316363_104125952 | 3300030659 | Peatlands Soil | FTMELLVQAYYQTGQSDKLAEAEAKLRGTNVPTMEQALVVPAARLRRPEI |
Ga0265460_111883752 | 3300030740 | Soil | LVQAYYQTEQTEKLHALEAKLRGPNVPTMDQALVVPAARARRPVI |
Ga0265746_10192031 | 3300030815 | Soil | TNQSDKLAEAESKLRATNVPTMEQAIVVPAARLRRPEI |
Ga0265770_10945772 | 3300030878 | Soil | QAYYQTYQPDKLHEVEVRLRGTNVPTMEQALVVPAARARRPTI |
Ga0265770_11494922 | 3300030878 | Soil | GKTDKLNEIEERLRGTNMPTMEQALVVPAVRAKLPIM |
Ga0075399_114410291 | 3300030967 | Soil | YQTEQSEKLHETEAKLRGMNVPTMEQALVVPAARAKRPNI |
Ga0073994_120200961 | 3300030991 | Soil | MELLARAYYQTNQPEKLHEVEAKLRGTNVPTMEQALVVPAARSRRPAI |
Ga0170824_1018192573 | 3300031231 | Forest Soil | AYYQTEKPEKLHEAEAKLRGTNTPTMEQALVVPAARAKRPNI |
Ga0302325_122450712 | 3300031234 | Palsa | YYETGKTDKLNEIEERLRGTNLPTMEQALVVPAVRAKLPIM |
Ga0265325_103202412 | 3300031241 | Rhizosphere | YYQTEKTDKLHETEAKLRGTNVPTMEQALVVPALRAKRPII |
Ga0265339_103612552 | 3300031249 | Rhizosphere | MELLVQAYYQTYQPDKVHEMEVKLRGTNVPTMEQALVVPAARSKRPTS |
Ga0170820_135249393 | 3300031446 | Forest Soil | YQTEKPEKLHEAEAKLRGTNTPTMEQALVVPALRAKRPNI |
Ga0170818_1048670602 | 3300031474 | Forest Soil | VQAYYQTEKPEKLHEAEAKLRGTNTPTMEQALVVPALRAKRPNI |
Ga0310915_108067011 | 3300031573 | Soil | GSSDKMHEVEAKLRGTNVPTIEQALVVPAARSRKPSTI |
Ga0307474_101075571 | 3300031718 | Hardwood Forest Soil | AYYQTNQSDKLAQAEAVLRSTNVPTMEQAVVVPAARLRRPEI |
Ga0307474_110012972 | 3300031718 | Hardwood Forest Soil | SMELLVQAYYQTNKSDKLAEAEAKLRGTNVPTMEQALVVPAARLRRPQI |
Ga0307469_114191192 | 3300031720 | Hardwood Forest Soil | LELLVQAYYQTEKLEKLHEAEAKLRGTNVPTMEQALVVPAARAKRPVI |
Ga0307475_100531398 | 3300031754 | Hardwood Forest Soil | LLVRAYYQTSQTDKLHEVEARLRGTNVPTMEQALVVPAARSKRPAI |
Ga0318568_105131212 | 3300031819 | Soil | YQTTQTEKLHEVEAKLRGFNMPTMEQALVVPEIRSKRPNM |
Ga0307479_107049721 | 3300031962 | Hardwood Forest Soil | SDKLHQAEAKLRGTNVPTMEQALVVPAARLRRPEI |
Ga0307479_108162941 | 3300031962 | Hardwood Forest Soil | AYYQTGQSDKLHQTEATLRGTNVPTMEQALVVPAARSRRPEI |
Ga0311301_110767452 | 3300032160 | Peatlands Soil | MELLVQAYYQDLQTDKLHEVEARLRGTNVPTMEQALVVPALRSKRPNM |
Ga0311301_125463301 | 3300032160 | Peatlands Soil | QPEKLHETEAKLRGTNVPTMEQALVVPAARAKRPVI |
Ga0307471_1020490031 | 3300032180 | Hardwood Forest Soil | YYQTMQTDKLHTAETKLRGNNLPTMEQAIVVPAARSKRPNI |
Ga0335079_111791312 | 3300032783 | Soil | LVQAYYQDLQTDKLHEVEAKLRGTNVPTMEQALVVPAVRAKRPNM |
Ga0335078_105278361 | 3300032805 | Soil | ASDKMHAVEAKLRGTNVPTIEQALVVPAARSRKPETI |
Ga0335080_112610522 | 3300032828 | Soil | YQTIETEKMHEMEARLRGTNVPTMEQALVVPAIRAKKPNM |
Ga0335071_100883601 | 3300032897 | Soil | ELLVQAYYQTEQMEKLHAIEARLRGTNVPTMEQALVVPAERMKRPII |
Ga0370515_0062110_3_119 | 3300034163 | Untreated Peat Soil | TNQSDKLAQAEGRLRGTNVPTMEQALVVPAARLRRPEM |
Ga0370515_0105368_1074_1214 | 3300034163 | Untreated Peat Soil | LLVQAYYETGATDKLHEIEGKLRGTNLPTMEQALVVPAMRSSRPII |
Ga0370515_0203800_695_841 | 3300034163 | Untreated Peat Soil | LELLVQAYYQTSQSDKLHQAEARLRGTNVPTMEQALVVPAARSRRPEI |
⦗Top⦘ |