Basic Information | |
---|---|
Family ID | F051142 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 144 |
Average Sequence Length | 41 residues |
Representative Sequence | DLGDTSDVTLSVDISGGNMRLRATTTSDDWSVKSLIRAI |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 144 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 86.11 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (36.111 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (22.222 % of family members) |
Environment Ontology (ENVO) | Unclassified (73.611 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (65.972 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.88% Coil/Unstructured: 76.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 144 Family Scaffolds |
---|---|---|
PF13385 | Laminin_G_3 | 79.17 |
PF07460 | NUMOD3 | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.89 % |
Unclassified | root | N/A | 36.11 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10146449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300000101|DelMOSum2010_c10147535 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 869 | Open in IMG/M |
3300000117|DelMOWin2010_c10018697 | All Organisms → Viruses → Predicted Viral | 3666 | Open in IMG/M |
3300000121|TDF_OR_ARG04_113mDRAFT_c1009176 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1261 | Open in IMG/M |
3300000121|TDF_OR_ARG04_113mDRAFT_c1034800 | Not Available | 592 | Open in IMG/M |
3300000125|TDF_MC_ARG01_113mDRAFT_c1002276 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1700 | Open in IMG/M |
3300000929|NpDRAFT_10011970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1602 | Open in IMG/M |
3300001450|JGI24006J15134_10118723 | Not Available | 917 | Open in IMG/M |
3300001450|JGI24006J15134_10127912 | Not Available | 865 | Open in IMG/M |
3300001460|JGI24003J15210_10089235 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 910 | Open in IMG/M |
3300001460|JGI24003J15210_10095508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 863 | Open in IMG/M |
3300001589|JGI24005J15628_10054066 | All Organisms → Viruses → Predicted Viral | 1531 | Open in IMG/M |
3300001589|JGI24005J15628_10128479 | Not Available | 803 | Open in IMG/M |
3300001720|JGI24513J20088_1014665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
3300004279|Ga0066605_10154823 | Not Available | 908 | Open in IMG/M |
3300004448|Ga0065861_1017123 | Not Available | 579 | Open in IMG/M |
3300006467|Ga0099972_10795980 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → unclassified Ignavibacteriota → Ignavibacteriae bacterium HGW-Ignavibacteriae-4 | 601 | Open in IMG/M |
3300006789|Ga0098054_1006876 | All Organisms → Viruses → Predicted Viral | 4872 | Open in IMG/M |
3300006789|Ga0098054_1279521 | Not Available | 599 | Open in IMG/M |
3300006793|Ga0098055_1016090 | All Organisms → Viruses → Predicted Viral | 3255 | Open in IMG/M |
3300006793|Ga0098055_1119126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1025 | Open in IMG/M |
3300006810|Ga0070754_10042624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 | 2448 | Open in IMG/M |
3300006916|Ga0070750_10284147 | Not Available | 711 | Open in IMG/M |
3300006920|Ga0070748_1044542 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1779 | Open in IMG/M |
3300006990|Ga0098046_1074787 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 768 | Open in IMG/M |
3300007345|Ga0070752_1096355 | Not Available | 1272 | Open in IMG/M |
3300007542|Ga0099846_1262789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 597 | Open in IMG/M |
3300008050|Ga0098052_1213606 | Not Available | 746 | Open in IMG/M |
3300008267|Ga0114364_1010230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 | 4339 | Open in IMG/M |
3300009052|Ga0102886_1189078 | Not Available | 609 | Open in IMG/M |
3300009076|Ga0115550_1132217 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 888 | Open in IMG/M |
3300009149|Ga0114918_10308220 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 883 | Open in IMG/M |
3300009423|Ga0115548_1156285 | Not Available | 717 | Open in IMG/M |
3300009433|Ga0115545_1145470 | Not Available | 830 | Open in IMG/M |
3300009434|Ga0115562_1277524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300009435|Ga0115546_1122589 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Magasanikbacteria → Candidatus Magasanikbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_38_6 | 930 | Open in IMG/M |
3300009436|Ga0115008_10215773 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1372 | Open in IMG/M |
3300009438|Ga0115559_1303238 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 560 | Open in IMG/M |
3300009442|Ga0115563_1042986 | All Organisms → Viruses → Predicted Viral | 2212 | Open in IMG/M |
3300009467|Ga0115565_10110753 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1291 | Open in IMG/M |
3300009467|Ga0115565_10142699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1119 | Open in IMG/M |
3300009472|Ga0115554_1190128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
3300009496|Ga0115570_10068845 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1813 | Open in IMG/M |
3300009505|Ga0115564_10195368 | Not Available | 1058 | Open in IMG/M |
3300009505|Ga0115564_10253901 | Not Available | 895 | Open in IMG/M |
3300009507|Ga0115572_10067576 | All Organisms → Viruses → Predicted Viral | 2210 | Open in IMG/M |
3300009507|Ga0115572_10067907 | Not Available | 2202 | Open in IMG/M |
3300009785|Ga0115001_10598297 | Not Available | 674 | Open in IMG/M |
3300010392|Ga0118731_108869827 | Not Available | 751 | Open in IMG/M |
3300010392|Ga0118731_114525104 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1796 | Open in IMG/M |
3300010430|Ga0118733_104406038 | Not Available | 752 | Open in IMG/M |
3300010430|Ga0118733_104501036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
3300010430|Ga0118733_104991291 | Not Available | 703 | Open in IMG/M |
3300010430|Ga0118733_109078996 | Not Available | 512 | Open in IMG/M |
3300012920|Ga0160423_10454287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 873 | Open in IMG/M |
3300017733|Ga0181426_1052856 | Not Available | 804 | Open in IMG/M |
3300017741|Ga0181421_1058309 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1022 | Open in IMG/M |
3300017759|Ga0181414_1057950 | Not Available | 1034 | Open in IMG/M |
3300017772|Ga0181430_1006643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4156 | Open in IMG/M |
3300017776|Ga0181394_1046564 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1469 | Open in IMG/M |
3300017776|Ga0181394_1055800 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1319 | Open in IMG/M |
3300020166|Ga0206128_1143968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 → Synechococcus phage S-SKS1 | 969 | Open in IMG/M |
3300020169|Ga0206127_1060287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1834 | Open in IMG/M |
3300020175|Ga0206124_10161009 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 900 | Open in IMG/M |
3300020175|Ga0206124_10346109 | Not Available | 560 | Open in IMG/M |
3300021169|Ga0206687_1802012 | Not Available | 725 | Open in IMG/M |
3300021185|Ga0206682_10025874 | All Organisms → cellular organisms → Bacteria | 3593 | Open in IMG/M |
3300022074|Ga0224906_1026000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2046 | Open in IMG/M |
3300022187|Ga0196899_1100020 | Not Available | 860 | Open in IMG/M |
3300022187|Ga0196899_1164292 | Not Available | 609 | Open in IMG/M |
(restricted) 3300023089|Ga0233408_10061686 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 708 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10507351 | Not Available | 503 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10088474 | All Organisms → Viruses | 986 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10125073 | Not Available | 831 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10215406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10217493 | Not Available | 831 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10375790 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 634 | Open in IMG/M |
3300023567|Ga0228694_135491 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 516 | Open in IMG/M |
3300024185|Ga0228669_1054192 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 814 | Open in IMG/M |
3300024228|Ga0228633_1017685 | Not Available | 1989 | Open in IMG/M |
3300024236|Ga0228655_1013865 | All Organisms → Viruses → Predicted Viral | 2081 | Open in IMG/M |
3300024262|Ga0210003_1247767 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 705 | Open in IMG/M |
3300024262|Ga0210003_1313557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 596 | Open in IMG/M |
(restricted) 3300024264|Ga0233444_10198486 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → Candidatus Prometheoarchaeum → Candidatus Prometheoarchaeum syntrophicum | 928 | Open in IMG/M |
3300024281|Ga0228610_1073421 | Not Available | 509 | Open in IMG/M |
3300024313|Ga0228624_1051700 | Not Available | 816 | Open in IMG/M |
3300024326|Ga0228652_1006001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3977 | Open in IMG/M |
3300024508|Ga0228663_1099653 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 526 | Open in IMG/M |
(restricted) 3300024519|Ga0255046_10138803 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1068 | Open in IMG/M |
(restricted) 3300024519|Ga0255046_10167744 | Not Available | 982 | Open in IMG/M |
3300025070|Ga0208667_1035033 | All Organisms → Viruses | 875 | Open in IMG/M |
3300025071|Ga0207896_1020287 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1154 | Open in IMG/M |
3300025071|Ga0207896_1031158 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300025083|Ga0208791_1062235 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 630 | Open in IMG/M |
3300025085|Ga0208792_1063340 | Not Available | 676 | Open in IMG/M |
3300025108|Ga0208793_1072581 | All Organisms → Viruses | 1008 | Open in IMG/M |
3300025108|Ga0208793_1082577 | Not Available | 925 | Open in IMG/M |
3300025120|Ga0209535_1044855 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1939 | Open in IMG/M |
3300025120|Ga0209535_1153254 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 723 | Open in IMG/M |
3300025120|Ga0209535_1179169 | Not Available | 627 | Open in IMG/M |
3300025137|Ga0209336_10075677 | All Organisms → Viruses | 990 | Open in IMG/M |
3300025138|Ga0209634_1031895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2780 | Open in IMG/M |
3300025138|Ga0209634_1127855 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1073 | Open in IMG/M |
3300025138|Ga0209634_1134333 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
3300025168|Ga0209337_1061248 | Not Available | 1898 | Open in IMG/M |
3300025168|Ga0209337_1119385 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1192 | Open in IMG/M |
3300025276|Ga0208814_1015441 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2633 | Open in IMG/M |
3300025626|Ga0209716_1097845 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300025658|Ga0209659_1208881 | Not Available | 541 | Open in IMG/M |
3300025769|Ga0208767_1065533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1605 | Open in IMG/M |
3300025809|Ga0209199_1116080 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
3300025874|Ga0209533_1009066 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 7957 | Open in IMG/M |
3300026211|Ga0208132_1113381 | Not Available | 608 | Open in IMG/M |
(restricted) 3300027837|Ga0255041_10113920 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 908 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10135809 | All Organisms → Viruses → Predicted Viral | 1107 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10115011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300028109|Ga0247582_1008415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2290 | Open in IMG/M |
3300028125|Ga0256368_1009212 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1639 | Open in IMG/M |
3300028129|Ga0228634_1106277 | Not Available | 610 | Open in IMG/M |
3300028134|Ga0256411_1212000 | Not Available | 609 | Open in IMG/M |
3300028196|Ga0257114_1028999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 → Synechococcus phage S-SKS1 | 2623 | Open in IMG/M |
3300028280|Ga0228646_1059014 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 949 | Open in IMG/M |
3300029448|Ga0183755_1025874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1827 | Open in IMG/M |
3300031140|Ga0308024_1027811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1580 | Open in IMG/M |
3300031141|Ga0308021_10130283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
3300031253|Ga0307490_1006871 | Not Available | 810 | Open in IMG/M |
3300031519|Ga0307488_10307387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 → Synechococcus phage S-SKS1 | 1018 | Open in IMG/M |
3300031519|Ga0307488_10367265 | Not Available | 901 | Open in IMG/M |
3300031569|Ga0307489_10379242 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 936 | Open in IMG/M |
3300031569|Ga0307489_10394890 | Not Available | 919 | Open in IMG/M |
3300031602|Ga0307993_1045615 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
3300031631|Ga0307987_1075610 | Not Available | 961 | Open in IMG/M |
3300031658|Ga0307984_1015926 | All Organisms → Viruses → Predicted Viral | 2623 | Open in IMG/M |
3300031658|Ga0307984_1096086 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 864 | Open in IMG/M |
3300031658|Ga0307984_1099523 | Not Available | 845 | Open in IMG/M |
3300031660|Ga0307994_1025586 | All Organisms → Viruses | 2553 | Open in IMG/M |
3300031660|Ga0307994_1060690 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1458 | Open in IMG/M |
3300031696|Ga0307995_1097039 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
3300031705|Ga0308003_1119970 | Not Available | 828 | Open in IMG/M |
3300031706|Ga0307997_10094499 | Not Available | 1195 | Open in IMG/M |
3300032088|Ga0315321_10324706 | Not Available | 975 | Open in IMG/M |
3300032274|Ga0316203_1204621 | Not Available | 543 | Open in IMG/M |
3300033742|Ga0314858_109270 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 704 | Open in IMG/M |
3300033742|Ga0314858_132235 | Not Available | 639 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.22% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 11.81% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 8.33% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 8.33% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 6.94% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.94% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.56% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.78% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.78% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 2.78% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.78% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.08% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 2.08% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 2.08% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.08% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.39% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.39% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.69% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.69% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.69% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.69% |
Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.69% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.69% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.69% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.69% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.69% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.69% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
3300000125 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 01_11.3m | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
3300023567 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
3300024281 | Seawater microbial communities from Monterey Bay, California, United States - 11D | Environmental | Open in IMG/M |
3300024313 | Seawater microbial communities from Monterey Bay, California, United States - 29D | Environmental | Open in IMG/M |
3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
3300024508 | Seawater microbial communities from Monterey Bay, California, United States - 77D | Environmental | Open in IMG/M |
3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
3300025658 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
3300026211 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV199 (SPAdes) | Environmental | Open in IMG/M |
3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
3300028109 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
3300028129 | Seawater microbial communities from Monterey Bay, California, United States - 42D | Environmental | Open in IMG/M |
3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
3300028280 | Seawater microbial communities from Monterey Bay, California, United States - 58D | Environmental | Open in IMG/M |
3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
3300031140 | Marine microbial communities from water near the shore, Antarctic Ocean - #420 | Environmental | Open in IMG/M |
3300031141 | Marine microbial communities from water near the shore, Antarctic Ocean - #351 | Environmental | Open in IMG/M |
3300031253 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3U | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
3300031631 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
3300031660 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261 | Environmental | Open in IMG/M |
3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
3300031705 | Marine microbial communities from water near the shore, Antarctic Ocean - #36 | Environmental | Open in IMG/M |
3300031706 | Marine microbial communities from David Island wharf, Antarctic Ocean - #36 | Environmental | Open in IMG/M |
3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_101464493 | 3300000101 | Marine | TQDLGDTSDVTLSVDISGGSMRLRATTTSDDWSVKSLIRAI* |
DelMOSum2010_101475352 | 3300000101 | Marine | STQDLGDTSDVTLSVDISGGNMRLLATVTSDDWSIKSLIRAI* |
DelMOWin2010_100186976 | 3300000117 | Marine | ETSTVDLGDTSDVTLTVAIDSSNMMFKATTTSNDWSVKSLIRAI* |
TDF_OR_ARG04_113mDRAFT_10091761 | 3300000121 | Marine | HDGTNVEFTETSTNDLGDTSDVVLSVDKTSTKLRLIATVTSDDWIIKSLIRAI* |
TDF_OR_ARG04_113mDRAFT_10348002 | 3300000121 | Marine | DGTNVEFTETSTNDLGDTSDVVLSVDKTSTKLRLIATVASDDWSVKSLIRAI* |
TDF_MC_ARG01_113mDRAFT_10022765 | 3300000125 | Marine | QDLGDTSDVVLSVDISGANMRLLATVASDDWSVKSLVKAI* |
NpDRAFT_100119701 | 3300000929 | Freshwater And Marine | DTSDVTLSVDISGTNMRLRATTTSSTWTIKSLTRLI* |
JGI24006J15134_101187231 | 3300001450 | Marine | TQDLGDTSDVTLSVDISGGNMRLRATTTSDNWSVKSLIRAI* |
JGI24006J15134_101279123 | 3300001450 | Marine | TQDLGDTSDVTLSVDISGGNMRLRATTTSDNWSIKSLIRAI* |
JGI24003J15210_100892351 | 3300001460 | Marine | STQDLGDTSDVTLNVVISTIYLQLQATTTSDNWSVKSLIRAI* |
JGI24003J15210_100955083 | 3300001460 | Marine | SDVTLSVDISGGNMRLRATTTSDNWSIKSLIRAI* |
JGI24005J15628_100540663 | 3300001589 | Marine | STVDLGDTSDVTLAVDISGANMRLRATTTSSTWTIKSLIRAI* |
JGI24005J15628_101284791 | 3300001589 | Marine | NTSDVTLSVDISGGNMRLRATSLSESWSVKSLIRAI* |
JGI24513J20088_10146651 | 3300001720 | Marine | QDLGDTSDVTLSVDISGGNMRLRATTTSDNWSVKSLIRAI* |
Ga0066605_101548232 | 3300004279 | Marine | DLGDTSDVTLSVDISGGNMRLQATTTSDNWSVKSLIRAI* |
Ga0065861_10171231 | 3300004448 | Marine | FAETSTVDLGDTSDVTLAVDISGTNMRLRATTTSSTWTIKSLIRAI* |
Ga0099972_107959802 | 3300006467 | Marine | GDTSDVTLSVDKSGTNLRLIATVTSDDWSVKSLIRAI* |
Ga0098054_10068766 | 3300006789 | Marine | DTSDVTLTVDISGADMRLRATTTSSTWTIKSLIRAI* |
Ga0098054_12795211 | 3300006789 | Marine | SDVTLTVDISGADMRLRATTTSSTWTIKSLIRAI* |
Ga0098055_10160901 | 3300006793 | Marine | NVEYAETSTVDLGDTSDVTLTVDISGADMRLRATTTSSTWTIKSLIRAI* |
Ga0098055_11191263 | 3300006793 | Marine | GDTSDVVLSVDKTGSGGGSKMRLLATVASDDWSIKTLIRAI* |
Ga0070754_100426241 | 3300006810 | Aqueous | DLGDTSDVTLSVDKSGTNLRLIATVTSDDWIIKSLIRAI* |
Ga0070750_102841472 | 3300006916 | Aqueous | SDVSLAVDISGSNMRLRATTTSNNWSVKSLVRAI* |
Ga0070748_10445421 | 3300006920 | Aqueous | QDLGDTSDVTLSVDKSGTNLRLIATVTSDDWIIKSLIRAI* |
Ga0098046_10747871 | 3300006990 | Marine | ETSTQDLGDTSDVVLSVDISGANMRLLATVASDDWSVKSLIRAI* |
Ga0070752_10963551 | 3300007345 | Aqueous | GDTSDVSLAVDISGTNMRLRATTTSNNWSVKSLVRAI* |
Ga0099846_12627891 | 3300007542 | Aqueous | TSDLQLSVDISGTDMRLQATAASDNWSVKTLVRAL* |
Ga0098052_12136061 | 3300008050 | Marine | DLGNTSDVTLTVDISGADMRLRATTTSSTWTIKSLIRAI* |
Ga0114364_10102307 | 3300008267 | Freshwater, Plankton | TTSALTLSVDLSTPYMRLLATATTDNWSVKTLVRAL* |
Ga0102886_11890782 | 3300009052 | Estuarine | FTETSTNDLGDTSDVTLSVDISGTHMRLLATVTSDDWSVKSLIRAI* |
Ga0115550_11322173 | 3300009076 | Pelagic Marine | VEFTETSTNDLGDTSDVTLSVDKTSTNLRLIATVTSDDWSVKSLIRAI* |
Ga0114918_103082203 | 3300009149 | Deep Subsurface | STNDLGDTSDVTLSVDISGGNMRLLATTTSNDWSVKSLIRAI* |
Ga0115548_11562852 | 3300009423 | Pelagic Marine | TSTQDLGDTSDVTLSVDISGGNMRLRATTTSDDWSIKSLIRAI* |
Ga0115545_11454701 | 3300009433 | Pelagic Marine | TSDVTLSVDISGGNMRLQATTTSDDWSVKSLIRAI* |
Ga0115562_12775241 | 3300009434 | Pelagic Marine | TVDLGDTSDVTLSSNISGTAIRLIATSTSSTWTIKSLIRAI* |
Ga0115546_11225891 | 3300009435 | Pelagic Marine | DLGDTSDVTLSVDISGGNMRLRATTTSDDWSVKSLIRAI* |
Ga0115008_102157734 | 3300009436 | Marine | TSDVTLSVDISGTNMRLLATVTSDDWSVKSLIRAI* |
Ga0115559_13032381 | 3300009438 | Pelagic Marine | SRVTLSVDISGADMRLRATATSDDWIVKSLVRAI* |
Ga0115563_10429864 | 3300009442 | Pelagic Marine | DLGNTSRVTLSVDISGADMRLRATATSDDWIVKSLVRAI* |
Ga0115565_101107531 | 3300009467 | Pelagic Marine | TSTNDLGDTSDVTLSVDKTSTKLRLLATVTSDAWSVKSLIRAI* |
Ga0115565_101426991 | 3300009467 | Pelagic Marine | QDLGDTSDVTLSVDISGGNMRLRATTTSDDWSVKSLIRAI* |
Ga0115554_11901282 | 3300009472 | Pelagic Marine | GDTSDVTLSVDISGTDMRLRATTTSDNWSVKSLIRAI* |
Ga0115570_100688451 | 3300009496 | Pelagic Marine | TETSTRDLGDTSDVTLSVDKTSTQLRLLATVTSDGWSVKSLIRAI* |
Ga0115564_101953682 | 3300009505 | Pelagic Marine | HDGGTPPVIEFTETSTNDLGDTSDVTLSVDITGSGGGSKMRLLATTTSDDWSVKSLIRAI |
Ga0115564_102539011 | 3300009505 | Pelagic Marine | DLGDTSDVTLSVDISGGNMRLLATVTSDDWSVKSLIRAI* |
Ga0115572_100675761 | 3300009507 | Pelagic Marine | TQDLGDTSDVTLSVDISGGNMRLRATTTSDDWSVKSLIRAI* |
Ga0115572_100679071 | 3300009507 | Pelagic Marine | SDVTLSVDISGGNMRLRATTTSDDWSVKSLIRAI* |
Ga0115001_105982971 | 3300009785 | Marine | STNDLGDTSDVTLSVDISGGNMRLQATTTSDDWSIKSLIRAI* |
Ga0118731_1088698271 | 3300010392 | Marine | TSDVTLSVDKSGTNLRLIATVTSDDWSVKSLIRAI* |
Ga0118731_1145251044 | 3300010392 | Marine | LGDTSDVVLSVDISGGDMRLMATVASDDWSVKSLIRAI* |
Ga0118733_1044060381 | 3300010430 | Marine Sediment | TSTQDLGDTSDVTLSVDISGGNMRLLATVTSDDWSIKSLIRAI* |
Ga0118733_1045010361 | 3300010430 | Marine Sediment | TSTQDLGDTSDVTLSVDISGGNMRLLATVTSDDWSVKSLIRAI* |
Ga0118733_1049912911 | 3300010430 | Marine Sediment | DLGDTSDVTLSVDISGGNMRLLATVTSDDWSIKSLIRAI* |
Ga0118733_1090789962 | 3300010430 | Marine Sediment | GDTSDVTLSVDKSGTNLRLIATVTSDDWIIKSLIRAI* |
Ga0160423_104542871 | 3300012920 | Surface Seawater | DLGDTSAVTLSVDISGSNMRLRATTTSDNWIVKANIRGIKV* |
Ga0181426_10528561 | 3300017733 | Seawater | TSTVDLGDTSDVTLSITIDSTNMMLKATTTSNDWSVKSLIRAI |
Ga0181421_10583091 | 3300017741 | Seawater | TSDVTLSVDISGGNMRLRATTTSDNWSIKSLIRAI |
Ga0181414_10579501 | 3300017759 | Seawater | VDLGDTSDVTLSITMDSTNMMLRATTTSNDWSVKSLIRAI |
Ga0181430_10066431 | 3300017772 | Seawater | LGDTSDVTLAVDLSSSNFRLRATTASSTWNIKALTRAI |
Ga0181394_10465641 | 3300017776 | Seawater | STQDLGDTSDVTLSVDISGGNMRLRATTTSDDWSIKSLIRAI |
Ga0181394_10558001 | 3300017776 | Seawater | TSDVTLSVDISGGNMRLRATTTSDDWSVKSLIRAI |
Ga0206128_11439681 | 3300020166 | Seawater | DLGDTSDVTLSVDKSGTNLRLIATVTSDDWIIKSLIRAI |
Ga0206127_10602871 | 3300020169 | Seawater | NDLGDTSDVTLSVDKTSTNLRLRATTTSDDWSVKSLIRAI |
Ga0206124_101610093 | 3300020175 | Seawater | TSDVTLSVDKSGTNLRLIATVTSDDWIIKSLIRAI |
Ga0206124_103461092 | 3300020175 | Seawater | DLGDTSDVTLSVDISGGNMRLLATVTSDDWSIKSLIRAI |
Ga0206687_18020121 | 3300021169 | Seawater | QDLGDTSDVVLSVDKTGSGGGSKMRLLATVTSDDWSVKSLIRAI |
Ga0206682_100258746 | 3300021185 | Seawater | DTSDVTLNVVISTIYLQLQATTTSDDWSVKSLIRAI |
Ga0224906_10260001 | 3300022074 | Seawater | IGDTSGVTFSVDISGTDLRLRATTTSDNWIIKSLVRSI |
Ga0196899_11000202 | 3300022187 | Aqueous | TQDLGDTSDVTLSVDISGGNMRLLATVTSDDWSVKSLIRAI |
Ga0196899_11642922 | 3300022187 | Aqueous | TQDLGDTSDVTLSVDISGGNMRLLATVTSDDWSIKSLIRAI |
(restricted) Ga0233408_100616862 | 3300023089 | Seawater | GDTSDVTLSVDISGGNMRLLATVTSDDWSIKSLIRAI |
(restricted) Ga0233432_105073511 | 3300023109 | Seawater | LGDTSDVTLSVDISGANMRLLATVTSDDWSVKSLIRAI |
(restricted) Ga0233411_100884743 | 3300023112 | Seawater | GDTSDVTLSVDKSGTNMRLIATVTSDDWSVKSLIRAI |
(restricted) Ga0233411_101250732 | 3300023112 | Seawater | NDLGDTSDVTLSVDISGTNMRLLATVTSDDWSVKSLIRAI |
(restricted) Ga0233412_102154061 | 3300023210 | Seawater | LGDTSDVTLSVDISGGNMRLRATTTSDDWSIKSLIRAI |
(restricted) Ga0233412_102174931 | 3300023210 | Seawater | DTSDVTLSVDISGANMRLLATVTSDDWSVKSLIRAI |
(restricted) Ga0233412_103757901 | 3300023210 | Seawater | LGDTSDVTLSVDISGTDMRLRATVTSDDWIIKSLIRAI |
Ga0228694_1354911 | 3300023567 | Seawater | NDLGDTSGVTLSVDKTSTNLRLIATVASDDWSVKSLIRAI |
Ga0228669_10541921 | 3300024185 | Seawater | GDTSDVVLSVDISGGYMRLLATVASDNWSVKSLIKAI |
Ga0228633_10176853 | 3300024228 | Seawater | DTSDVTLSVDISGTDMRLRATTTSDNWIIKSLVRTI |
Ga0228655_10138651 | 3300024236 | Seawater | TSTNDLGDTSDVTLSVDISGTDMRLRATTTTDNWIIKSLVRTI |
Ga0210003_12477672 | 3300024262 | Deep Subsurface | DLGDTSDVTLSVDISGGNMRLLATTTSNDWSVKSLIRAI |
Ga0210003_13135571 | 3300024262 | Deep Subsurface | YTETSTNDLGDTSDVTLSVDISGANMRLLATTTSNDWSVKSLIRAI |
(restricted) Ga0233444_101984861 | 3300024264 | Seawater | DTSDVTLSVDITGSGGGSKMRLLATTTSDDWSVKSLIRAI |
Ga0228610_10734212 | 3300024281 | Seawater | DTSDVTLAVDLSSSNFRLRATTASSTWNIKALTRAI |
Ga0228624_10517001 | 3300024313 | Seawater | STNDLGDTSDVTLSVDISGANMRLLATVTSDDWSVKSLIRAI |
Ga0228652_10060016 | 3300024326 | Seawater | TETSTNDLGDTSDVTLSVDISGANMRLLATVTSDDWSVKSLIRAI |
Ga0228663_10996531 | 3300024508 | Seawater | ETSTNDLGDTSDVTLSVDISGANMRLLATVTSDDWSVKSLIRAI |
(restricted) Ga0255046_101388033 | 3300024519 | Seawater | TSTNDLGDTSDVTLSVDISGANMRLVATVTSDDWSVKSLIRAI |
(restricted) Ga0255046_101677443 | 3300024519 | Seawater | TSTQDLGDTSDVTLSVDISGGNMRLRATTTSDNWSIKSLIRAI |
Ga0208667_10350332 | 3300025070 | Marine | STQDLGDTSDVVLSVDISGANMRLLATVASDDWSVKSLIRAI |
Ga0207896_10202873 | 3300025071 | Marine | DTSDVTLSVDISGGNMRLRATTTSDNWSIKSLIRAI |
Ga0207896_10311583 | 3300025071 | Marine | TQDLGDTSDVTLSVDISGGNMRLRATTTSDNWSIKSLIRAI |
Ga0208791_10622351 | 3300025083 | Marine | TSTQDLGDTSDVTLSVDISGANMRLVATVASDDWSVKSLTRAI |
Ga0208792_10633403 | 3300025085 | Marine | DLGDTSDVTLSVDISGTDMRLRATTTSDNWVIKSLVRTI |
Ga0208793_10725811 | 3300025108 | Marine | GDTSDVVLSVDKTGSGGGSKMRLLATVASDDWSIKTLIRAI |
Ga0208793_10825772 | 3300025108 | Marine | YAETSTVDLGDTSDVTLTVDISGADMRLRATTTSSTWTIKSLIRAI |
Ga0209535_10448551 | 3300025120 | Marine | DLGDTSDVTLSVDISGGNMRLRATTTSDNWSVKSLIRAI |
Ga0209535_11532541 | 3300025120 | Marine | TSDVTLSVDISGGNMRLRATTTSDDWSIKSLIRAI |
Ga0209535_11791691 | 3300025120 | Marine | TNDLGDTSDVTLSVDLGSTTMRLLATTTSDDWSVKSLIRAI |
Ga0209336_100756773 | 3300025137 | Marine | TQDLGDTSDVTLSVDISGGNMRLRATTTSDNWSVKSLIRAI |
Ga0209634_10318951 | 3300025138 | Marine | TPLIEFAETSTVDLGDTSDVTLAVDISGANMRLRATTTSSTWTIKSLIRAI |
Ga0209634_11278553 | 3300025138 | Marine | QDLGDTSDVTLSVDISGGNMRLRATTTSDDWSIKSLIRAI |
Ga0209634_11343333 | 3300025138 | Marine | QDLGDTSDVTLSVDISGGNMRLRATTTSDNWSIKSLIRAI |
Ga0209337_10612484 | 3300025168 | Marine | QDLGNTSDVTLSVDISGGNMRLRATSLSESWSVKSLIRAI |
Ga0209337_11193853 | 3300025168 | Marine | GDTSDVTLSVDISGGNMRLRATTTSDNWSIKSLIRAI |
Ga0208814_10154414 | 3300025276 | Deep Ocean | TNVKFTETSTQDLGDTSDVVLSVNISGTQMRLLADAVTPATGVWSVKTLIRAI |
Ga0209716_10978451 | 3300025626 | Pelagic Marine | DTSDVTLSVDISGGNMRLRATTTSDDWSVKSLIRAI |
Ga0209659_12088813 | 3300025658 | Marine | TSTNDLGDTSDVTLSVDISGTDMRLRATTTTDNWIIKSLVRTL |
Ga0208767_10655331 | 3300025769 | Aqueous | GDTSDVTLTVDISGANMRLRATTTSSTWTIKSLTRAI |
Ga0209199_11160801 | 3300025809 | Pelagic Marine | NDLGDTSDVTLSVDKTSTNLRLIATVTSDDWSVKSLIRAI |
Ga0209533_10090661 | 3300025874 | Pelagic Marine | TSTNDLGDTSDVTLSVDISGGNMRLLATVTSDDWSVKSLIRAI |
Ga0208132_11133812 | 3300026211 | Marine | FSETATTDLGNTTDVVLDVDISGADMRLIATVASDDWIIKSLVRAI |
(restricted) Ga0255041_101139202 | 3300027837 | Seawater | TSTQDLGDTSDVTLSVDISGGNMRLLATVTSDDWSIKSLIRAI |
(restricted) Ga0233415_101358091 | 3300027861 | Seawater | ETSTQDLGDTSDVTLSVDKSGTNLRLIATVTSDDWIIKSLIRAI |
(restricted) Ga0233413_101150111 | 3300027996 | Seawater | FTETSTNDLGDTSDVTLSVDKTSINLRLIATTTSDDWSVKSLIRAI |
Ga0247582_10084155 | 3300028109 | Seawater | DTSDVTLSVDKTSTNLRLIATVTSDNWSVKSLIRAI |
Ga0256368_10092121 | 3300028125 | Sea-Ice Brine | TQDLGDTSDVTLSVDISGGNMRLRATTTSDDWSVKSLIRAI |
Ga0228634_11062772 | 3300028129 | Seawater | TSDVTLAVDLSSSNFRLRATTASSTWNIKALTRAI |
Ga0256411_12120002 | 3300028134 | Seawater | STNDLGDTSDVVLSVDISGANMRLLATVTSDDWSVKSLIRAI |
Ga0257114_10289996 | 3300028196 | Marine | NDLGDTSDVTLSVDISGGNMRLLATVTSDDWSVKSLIRAI |
Ga0228646_10590143 | 3300028280 | Seawater | TETSTQDLGDTSDVVLSVDISGGYMRLLATVASDNWSVKSLIKAI |
Ga0183755_10258744 | 3300029448 | Marine | DLGNTSDVTLSVDISSGNMRLLATVTSDDWSVKTLVRAI |
Ga0308024_10278114 | 3300031140 | Marine | TSDVVLSVDKTSTNLRLIATVASDDWSVKSLIRAI |
Ga0308021_101302833 | 3300031141 | Marine | VDLGDTSDLVLTVDISAGNMRLLGTAASVDWSVKSLIRAL |
Ga0307490_10068711 | 3300031253 | Sea-Ice Brine | DLGDTSDVTLSVDISGTDMRLRATVTSDDWIIKSLIRAI |
Ga0307488_103073871 | 3300031519 | Sackhole Brine | SVEFTETSTNDLGDTSDVTLSVDKTSTNLRLIATVTSDDWSVKSLIRAI |
Ga0307488_103672651 | 3300031519 | Sackhole Brine | ETSTNDLGDTSDVTLSVDISGTAMRLRATVTSDDWIIKSLIRAI |
Ga0307489_103792423 | 3300031569 | Sackhole Brine | HDGTNVVYTETSTNDLGDTSDVTLSVDILGTDMRLRATVTSDDWIIKSLIRAI |
Ga0307489_103948901 | 3300031569 | Sackhole Brine | LGDTSDVTLSVDISGTNMRLLATVTSDDWSVKSLIRAI |
Ga0307993_10456151 | 3300031602 | Marine | TETSTQDLGDTSDVVLSVDKTSTNLRLIATVASDNWSVKSLIRAI |
Ga0307987_10756102 | 3300031631 | Marine | VDLGDTSDLVLTVDISAGNMRLLGTATSDDWSVKSLIRAL |
Ga0307984_10159261 | 3300031658 | Marine | STVDLGDTSDLVLTVDISAGNMRLLGTAASVDWSVKSLIRAL |
Ga0307984_10960862 | 3300031658 | Marine | TSDVVLSVDKTSTNLRLIATVASNDWSVKSLIRAI |
Ga0307984_10995231 | 3300031658 | Marine | FTETSTQDLGDTSDVVLSVDKTSTNLRLIATVASDDWSVKSLIRAI |
Ga0307994_10255866 | 3300031660 | Marine | EFTETSTQDLGDTSDVVLSVDKTSTNLRLIATVTSDDWSVKSLIRAI |
Ga0307994_10606904 | 3300031660 | Marine | TETSTQDLGDTSDVVLSVDKTSTNLRLIATVASDDWSVKSLIRAI |
Ga0307995_10970391 | 3300031696 | Marine | TQDLGDTSDVVLSVDISGTQMRLIATVTSDDWSVKSLIRAL |
Ga0308003_11199701 | 3300031705 | Marine | GNTSDVALSVDISGGQMRLLANAATTSWSVKSLIRAI |
Ga0307997_100944991 | 3300031706 | Marine | TSDVTLSVDISGTNMRLLATVTSNDWSVKSLIRAI |
Ga0315321_103247062 | 3300032088 | Seawater | STTDLGDTSDVTLAVDLSSSNFRLRATTASSTWNIKALTRAI |
Ga0316203_12046212 | 3300032274 | Microbial Mat | TSTQDLGNTSDVTLSVDISGGNMRLRATSLSESWSVKSLIRAI |
Ga0314858_109270_1_141 | 3300033742 | Sea-Ice Brine | YTETSTNDLGDTSDVTLSVDISGTDMRLRATVTSDDWIIKSLIRAI |
Ga0314858_132235_529_639 | 3300033742 | Sea-Ice Brine | DTSDVTLSVDISGTDMRLRATVTSDDWIIKSLIRAI |
⦗Top⦘ |