NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051151

Metagenome / Metatranscriptome Family F051151

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051151
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 71 residues
Representative Sequence MKDYNKLADEIITEPEFRVGGFVYKHILEAKSDALVSIKSAVDRMSELYDLERDDIGIVSELILEKFKNK
Number of Associated Samples 109
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 37.76 %
% of genes near scaffold ends (potentially truncated) 20.83 %
% of genes from short scaffolds (< 2000 bps) 65.28 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.76

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (56.250 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(20.139 % of family members)
Environment Ontology (ENVO) Unclassified
(68.750 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(93.750 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.96%    β-sheet: 0.00%    Coil/Unstructured: 52.04%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.76
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.104.1.0: automated matchesd3nc3a_3nc30.63004
e.8.1.3: T7 RNA polymerased1mswd_1msw0.62893
a.3.1.0: automated matchesd2ce0a_2ce00.62687
d.389.1.1: Menin N-terminal domain-liked4gq4a14gq40.62606
a.104.1.0: automated matchesd5xw2a_5xw20.62559

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF01048PNP_UDP_1 43.75
PF00478IMPDH 4.86
PF00149Metallophos 1.39
PF08534Redoxin 1.39
PF04055Radical_SAM 1.39
PF01883FeS_assembly_P 1.39
PF12850Metallophos_2 0.69
PF02540NAD_synthase 0.69
PF13489Methyltransf_23 0.69
PF09834DUF2061 0.69
PF05656DUF805 0.69
PF13508Acetyltransf_7 0.69
PF00005ABC_tran 0.69
PF00440TetR_N 0.69
PF00565SNase 0.69
PF01467CTP_transf_like 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 43.75
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 43.75
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 43.75
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 0.69
COG3152Uncharacterized membrane protein YhaH, DUF805 familyFunction unknown [S] 0.69

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.31 %
UnclassifiedrootN/A25.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10000629All Organisms → cellular organisms → Bacteria → Proteobacteria22401Open in IMG/M
3300000117|DelMOWin2010_c10002742All Organisms → cellular organisms → Bacteria11150Open in IMG/M
3300000117|DelMOWin2010_c10003403All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.9914Open in IMG/M
3300000117|DelMOWin2010_c10006952All Organisms → cellular organisms → Bacteria6735Open in IMG/M
3300000149|LPaug09P1610mDRAFT_c1013170All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1078Open in IMG/M
3300000928|OpTDRAFT_10002169All Organisms → cellular organisms → Bacteria13941Open in IMG/M
3300001589|JGI24005J15628_10018182All Organisms → Viruses → Predicted Viral3088Open in IMG/M
3300001944|GOS2251_1008803All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1823Open in IMG/M
3300004097|Ga0055584_100091510All Organisms → Viruses → Predicted Viral3023Open in IMG/M
3300004097|Ga0055584_100141043All Organisms → cellular organisms → Bacteria2424Open in IMG/M
3300004097|Ga0055584_101805841Not Available630Open in IMG/M
3300004448|Ga0065861_1142754All Organisms → Viruses → Predicted Viral1004Open in IMG/M
3300004457|Ga0066224_1067793All Organisms → Viruses → Predicted Viral2115Open in IMG/M
3300004457|Ga0066224_1088939All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.2384Open in IMG/M
3300004457|Ga0066224_1198517All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.551Open in IMG/M
3300005057|Ga0068511_1038077Not Available761Open in IMG/M
3300005837|Ga0078893_10030728All Organisms → cellular organisms → Bacteria16490Open in IMG/M
3300005837|Ga0078893_10611667All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.985Open in IMG/M
3300005941|Ga0070743_10044575All Organisms → Viruses → Predicted Viral1517Open in IMG/M
3300005942|Ga0070742_10094625All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.823Open in IMG/M
3300005971|Ga0066370_10164272Not Available766Open in IMG/M
3300006403|Ga0075514_1810501All Organisms → Viruses → Predicted Viral3956Open in IMG/M
3300006405|Ga0075510_10862173All Organisms → Viruses → Predicted Viral1970Open in IMG/M
3300006484|Ga0070744_10220309All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.538Open in IMG/M
3300006735|Ga0098038_1048637All Organisms → Viruses → Predicted Viral1535Open in IMG/M
3300006735|Ga0098038_1090615Not Available1063Open in IMG/M
3300006735|Ga0098038_1131303All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.845Open in IMG/M
3300006737|Ga0098037_1140524All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.815Open in IMG/M
3300006749|Ga0098042_1037530All Organisms → cellular organisms → Bacteria1351Open in IMG/M
3300006752|Ga0098048_1025060All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1968Open in IMG/M
3300006752|Ga0098048_1243108Not Available527Open in IMG/M
3300006810|Ga0070754_10011971All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.5391Open in IMG/M
3300006919|Ga0070746_10550541Not Available500Open in IMG/M
3300006922|Ga0098045_1048785All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1053Open in IMG/M
3300007539|Ga0099849_1007937All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.4795Open in IMG/M
3300009001|Ga0102963_1361364All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.570Open in IMG/M
3300009024|Ga0102811_1085165All Organisms → Viruses → Predicted Viral1183Open in IMG/M
3300009071|Ga0115566_10136638All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1542Open in IMG/M
3300009071|Ga0115566_10327677Not Available897Open in IMG/M
3300009420|Ga0114994_10130683All Organisms → Viruses → Predicted Viral1705Open in IMG/M
3300009550|Ga0115013_10000494All Organisms → cellular organisms → Bacteria23894Open in IMG/M
3300009785|Ga0115001_10754042Not Available588Open in IMG/M
3300010148|Ga0098043_1162868All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.627Open in IMG/M
3300012920|Ga0160423_10007232All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.8923Open in IMG/M
3300012920|Ga0160423_10535396Not Available795Open in IMG/M
3300012928|Ga0163110_10070621Not Available2258Open in IMG/M
3300012928|Ga0163110_10091329All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.2015Open in IMG/M
3300012928|Ga0163110_10114884All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1819Open in IMG/M
3300012928|Ga0163110_10186483All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1462Open in IMG/M
3300012953|Ga0163179_11290225All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.649Open in IMG/M
3300012954|Ga0163111_10452474All Organisms → Viruses → Predicted Viral1175Open in IMG/M
3300012954|Ga0163111_12139178Not Available565Open in IMG/M
3300017706|Ga0181377_1004193All Organisms → Viruses → Predicted Viral4006Open in IMG/M
3300017710|Ga0181403_1027638All Organisms → Viruses → Predicted Viral1199Open in IMG/M
3300017719|Ga0181390_1110415All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.726Open in IMG/M
3300017745|Ga0181427_1075629Not Available826Open in IMG/M
3300017746|Ga0181389_1026912All Organisms → Viruses → Predicted Viral1771Open in IMG/M
3300017746|Ga0181389_1081338All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.908Open in IMG/M
3300017751|Ga0187219_1060502Not Available1227Open in IMG/M
3300017758|Ga0181409_1045286Not Available1364Open in IMG/M
3300017758|Ga0181409_1123514Not Available764Open in IMG/M
3300017760|Ga0181408_1202197Not Available504Open in IMG/M
3300017763|Ga0181410_1071251All Organisms → Viruses → Predicted Viral1036Open in IMG/M
3300017763|Ga0181410_1220337All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.515Open in IMG/M
3300017764|Ga0181385_1133154Not Available757Open in IMG/M
3300017773|Ga0181386_1003149All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.5993Open in IMG/M
3300017779|Ga0181395_1240973Not Available554Open in IMG/M
3300017782|Ga0181380_1256923All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.579Open in IMG/M
3300017824|Ga0181552_10002205All Organisms → cellular organisms → Bacteria → Proteobacteria14356Open in IMG/M
3300017950|Ga0181607_10481686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales665Open in IMG/M
3300017956|Ga0181580_10150600Not Available1666Open in IMG/M
3300017967|Ga0181590_10148488Not Available1797Open in IMG/M
3300018416|Ga0181553_10010867All Organisms → cellular organisms → Bacteria → Proteobacteria7214Open in IMG/M
3300020055|Ga0181575_10485023Not Available666Open in IMG/M
3300020173|Ga0181602_10094513All Organisms → Viruses → Predicted Viral1481Open in IMG/M
3300020175|Ga0206124_10049212All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1861Open in IMG/M
3300020175|Ga0206124_10157070All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.914Open in IMG/M
3300020175|Ga0206124_10248203All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.690Open in IMG/M
3300020194|Ga0181597_10481631Not Available501Open in IMG/M
3300020245|Ga0211711_1000265All Organisms → cellular organisms → Bacteria9780Open in IMG/M
3300020282|Ga0211667_1027038All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1490Open in IMG/M
3300020378|Ga0211527_10053332All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1254Open in IMG/M
3300020380|Ga0211498_10033283All Organisms → Viruses → Predicted Viral1907Open in IMG/M
3300020392|Ga0211666_10016406All Organisms → Viruses → Predicted Viral3562Open in IMG/M
3300020397|Ga0211583_10097075All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1110Open in IMG/M
3300020401|Ga0211617_10390893All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.576Open in IMG/M
3300020403|Ga0211532_10015209All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.4509Open in IMG/M
3300020404|Ga0211659_10112915All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1246Open in IMG/M
3300020414|Ga0211523_10301075Not Available656Open in IMG/M
3300020419|Ga0211512_10305260Not Available722Open in IMG/M
3300020419|Ga0211512_10504705All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.539Open in IMG/M
3300020421|Ga0211653_10439383All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.559Open in IMG/M
3300020430|Ga0211622_10268849All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.730Open in IMG/M
3300020433|Ga0211565_10026984All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.2425Open in IMG/M
3300020437|Ga0211539_10124221All Organisms → Viruses → Predicted Viral1045Open in IMG/M
3300020438|Ga0211576_10013970All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.5005Open in IMG/M
3300020438|Ga0211576_10041489All Organisms → Viruses → Predicted Viral2670Open in IMG/M
3300020438|Ga0211576_10055050All Organisms → Viruses → Predicted Viral2265Open in IMG/M
3300020438|Ga0211576_10379919All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.724Open in IMG/M
3300020442|Ga0211559_10035462All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.2485Open in IMG/M
3300020442|Ga0211559_10040835All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.2301Open in IMG/M
3300020442|Ga0211559_10044189Not Available2203Open in IMG/M
3300020463|Ga0211676_10004413All Organisms → cellular organisms → Bacteria → Proteobacteria13281Open in IMG/M
3300020463|Ga0211676_10042579All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.3291Open in IMG/M
3300020465|Ga0211640_10494567Not Available666Open in IMG/M
3300020469|Ga0211577_10080505All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.2294Open in IMG/M
3300020471|Ga0211614_10372523Not Available629Open in IMG/M
3300020474|Ga0211547_10636268All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.526Open in IMG/M
3300021085|Ga0206677_10013450All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.5400Open in IMG/M
3300021085|Ga0206677_10024926All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.3490Open in IMG/M
3300021347|Ga0213862_10130996Not Available882Open in IMG/M
3300021356|Ga0213858_10116824All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1303Open in IMG/M
3300021371|Ga0213863_10035446All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.2711Open in IMG/M
3300021375|Ga0213869_10000777All Organisms → cellular organisms → Bacteria24915Open in IMG/M
3300021375|Ga0213869_10006335All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.7451Open in IMG/M
3300021375|Ga0213869_10222546All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.839Open in IMG/M
3300021375|Ga0213869_10301896All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.682Open in IMG/M
3300021957|Ga0222717_10023481All Organisms → Viruses → Predicted Viral4122Open in IMG/M
3300021957|Ga0222717_10144313All Organisms → Viruses → Predicted Viral1454Open in IMG/M
(restricted) 3300024255|Ga0233438_10009365All Organisms → cellular organisms → Bacteria7156Open in IMG/M
(restricted) 3300024255|Ga0233438_10040683All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.2466Open in IMG/M
(restricted) 3300024324|Ga0233443_1089082All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1206Open in IMG/M
3300025084|Ga0208298_1042805All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.906Open in IMG/M
3300025086|Ga0208157_1140981Not Available539Open in IMG/M
3300025102|Ga0208666_1072855Not Available901Open in IMG/M
3300025108|Ga0208793_1125968All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.696Open in IMG/M
3300025120|Ga0209535_1070321All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1377Open in IMG/M
3300025127|Ga0209348_1106945Not Available862Open in IMG/M
3300025132|Ga0209232_1011873All Organisms → Viruses → Predicted Viral3572Open in IMG/M
3300025137|Ga0209336_10000171Not Available33208Open in IMG/M
3300025138|Ga0209634_1029623All Organisms → Viruses → Predicted Viral2916Open in IMG/M
3300025674|Ga0208162_1081967Not Available996Open in IMG/M
3300025759|Ga0208899_1000243All Organisms → cellular organisms → Bacteria37340Open in IMG/M
3300025890|Ga0209631_10107795All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1589Open in IMG/M
3300025892|Ga0209630_10249074Not Available835Open in IMG/M
3300027752|Ga0209192_10102242All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1183Open in IMG/M
3300027859|Ga0209503_10002219Not Available9621Open in IMG/M
3300028008|Ga0228674_1131314All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.849Open in IMG/M
3300031519|Ga0307488_10311705All Organisms → Viruses → Predicted Viral1009Open in IMG/M
3300031569|Ga0307489_10073810All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.1917Open in IMG/M
3300031851|Ga0315320_10004642All Organisms → cellular organisms → Bacteria11243Open in IMG/M
3300032011|Ga0315316_10889891Not Available730Open in IMG/M
3300032047|Ga0315330_10683450All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp.600Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine20.14%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine18.06%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater10.42%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh6.25%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater5.56%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.56%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.86%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.47%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine3.47%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.78%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.78%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.08%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.08%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.08%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water1.39%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.39%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.39%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.39%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.69%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.69%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.69%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.69%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.69%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.69%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.69%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000149Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10mEnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300001944Marine microbial communities from Cabo Marshall, Isabella Island, Equador - GS036EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300005971Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_AEnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006405Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020194Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020245Marine microbial communities from Tara Oceans - TARA_B100000459 (ERX556111-ERR599135)EnvironmentalOpen in IMG/M
3300020282Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169)EnvironmentalOpen in IMG/M
3300020378Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102)EnvironmentalOpen in IMG/M
3300020380Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058)EnvironmentalOpen in IMG/M
3300020392Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163)EnvironmentalOpen in IMG/M
3300020397Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075)EnvironmentalOpen in IMG/M
3300020401Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020414Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028)EnvironmentalOpen in IMG/M
3300020419Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020430Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160)EnvironmentalOpen in IMG/M
3300020433Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020465Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020471Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)EnvironmentalOpen in IMG/M
3300020474Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024324 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MGEnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_10000629163300000117MarineMKDYQALAEVIMTEPEFRPGGFVYKHIKEAKSDSLVSIKSAVDNMSDLYDLEREDIGQISEIILKKFTDKQQ*
DelMOWin2010_1000274233300000117MarineMKDYTKLAEAILTEPEFKEGGFAYKHIQEAKSDALISIKSAVDNMSDLYDLERNDIGIISELILEHFRNK*
DelMOWin2010_1000340363300000117MarineMKDYKQLAYEILKEPEFRQGGFVYKHIKEAKSDSLVSIKSAVDNMSDLYDLERDDIGQISEIILRKFTDKLQ*
DelMOWin2010_1000695233300000117MarineLKDYDQLARAIITEPEFRKGGFVYKHIHEAKSNALVSIKSAVDNMSDLYDLERDDIGQISERILEMFKNN*
LPaug09P1610mDRAFT_101317023300000149MarineMKDYSKVLEEIITEPEFRENGFVYKHIKEGKSNALVSIQSAVDRMSELYDLERDDIGIVSELILQRFTNK*
OpTDRAFT_1000216933300000928Freshwater And MarineLKDYDQLAKAIIKEPEFREGGFVYKHIHEAKSDALVSIKSAVDRMSDLYDLERDDIGQISQRILDIFKNN*
JGI24005J15628_1001818243300001589MarineMKDYSKVLEEIITEPEFRENGFVYKHIKEGKSNALVSIQSAVDRMSELYDLERDDIGKLSELILQRFTNK*
GOS2251_100880323300001944MarineMKDYQALAEAIMTEPEFRPGGFVYKHIQEAKSDSLVSIKSAVDNMSDLYDLEREDIGQLSEIILKKFTDKQQ*
Ga0055584_10009151023300004097Pelagic MarineLKDYDQLAKAIITEPEFRKGGFVYKHIQEAKSDALVSIKSAVDNMSDLYDLERDDIGQISERILEMFRNN*
Ga0055584_10014104353300004097Pelagic MarineMKDYNKLAQELITEPEFREGGFVYKHIEQNKSNALQSIKSAVDNMSDLYDLEREDIGIVSQIILDKFTSK*
Ga0055584_10180584123300004097Pelagic MarineLKDYDQLARAIITEPEFREGGFVYKHIREAKSDALVSIKSAVDNMSDLYDLERDDIGQISERILEMFKNN*
Ga0065861_114275413300004448MarineMINDYNKLADELLTEPEFREGVFVYKHVKEAKSDALVSIRSAVDRMSDLYDLERNDIGIVSDILLKRLTDN*
Ga0066224_106779323300004457MarineMINDYNKLADELLTEPEFREGGFVYKHVKEAKSDALVSIRSAVDRMSDLYDLERNDIGIVSDILLKRLTDN*
Ga0066224_108893923300004457MarineMKDYNKLAQELITEPEFREGGFVYKHIEQNKSNALQSIKSAVDNMSDLYDLEREEIGIVSQIILDKFTSK*
Ga0066224_119851723300004457MarineLKDYDELARVIIKEPEFREGGFVYKHIQEAKSEALVSIKSAVDRMSDLYDLERDDIGQISERILDMFKNN*
Ga0068511_103807713300005057Marine WaterMKDYNALADAIITEPEFRPGGFVFKHIQEAKSDSLVSIKSAVDNMSDLYDLEKNDIGIISDIILEKIKNK*
Ga0078893_10030728103300005837Marine Surface WaterMKDYKALAEAIITEPEFREGGFVYKHIQEAKSDSLVSIKSAVDNMSDLYDLEKDDIGILSELILDKIRNN*
Ga0078893_1061166723300005837Marine Surface WaterRIHVCISKMKDYNQLAEAILTEPEFRENGFVYKHVQEAKSNALVSIQSAVDRMSDLYDLERDDIGIISDILFKRLTDN*
Ga0070743_1004457523300005941EstuarineMKDFNKLVQEILTEPEFKQGGFVYKHITEAKSDSLISIKSAVDRMSELYDLEQDEIGIVSELILKQFTNK*
Ga0070742_1009462523300005942EstuarineMKDFNKLVQEILTEPEFKQGGFVYKHITEAKSDLLISIKSAVDRMSELYDLEQDEIGIVSELILKQFTNK*
Ga0066370_1016427213300005971MarineKYVLRCTKGKP*LQIYTMNNINDIQKYNNLAMEIMGEPEFRPGGFVFKHIKENKSDPLVSIQSAVDRMSELYDLERDDIGIISNIILEQFKNN*
Ga0075514_181050133300006403AqueousLKDYNQLAKAIMTEPEFREGGFVYKHIREAKSDALVSIKSAVDSMSDLYDLERDDIGQISERIFNFLKNN*
Ga0075510_1086217323300006405AqueousLKDYDQLAKAIITEPEFRKGGFVYKHIQEAKSDALVSIKSAVDNMSDLYDLERDDIGQISERIFNFLKNN*
Ga0070744_1022030923300006484EstuarineMKDFNKLVQEILTEPEFKQGGFVYKHITEAKSDSLISIKSAVDRMSELYDLEQDDIGIVSELILKQFTNK*
Ga0098038_104863723300006735MarineMKDYNKLADDILTEPEFRVGGFVYKHILEAKSDALVSIKSAVDRMSELYDLEQDDIGIVSELILEKFKNK*
Ga0098038_109061523300006735MarineLKDYNKLAEEIITEPEFRVGGFVYKHVQEAKSDALVSIKSAVDRMSDLYDLERDDIGQISNIILDKLKNN*
Ga0098038_113130323300006735MarineLKDYNKLAEAIITEPEFREGGFVYKHIKEAKSESLVSIQSAVDRMSDLYDLERDDIGQISIIILDKLKNN*
Ga0098037_114052423300006737MarineLKDYNKLAEEIITEPEFRVGGFVYKHVQEAKSDALVSIQSAVDRMSDLYDLERDDIGQISNIILDKLKNN*
Ga0098042_103753033300006749MarineMKDYNKLADEILTEPEFRVGGFVYKHIVEAKSDALVSIKSAVDRMSELYDLEQDDIGIVSELILEKFKNK*
Ga0098048_102506023300006752MarineLKDYDQLARAIITEPEFREGGFVYKHIQEAKSDALVSIKSAVDRMSDLYDLERNDIGIISERILNMFKNN*
Ga0098048_124310823300006752MarineMKDYKQLTKEILTVPEFKEGGFVYKHIHEAKSDALISIKSAVDNMSDLYDLERNDIGIISELILKEFTNK*
Ga0070754_1001197133300006810AqueousLKDYDQLAKAIMTEPEFREGGFVYKHIREAKSDALVSIKSAVDSMSDLYDLERDDIGQISERIFNFLKNN*
Ga0070746_1055054113300006919AqueousEPEFKEGGFAYKHIQEAKSDALISIKSAVDNMSDLYDLERNDIGIISELILEHFRNK*
Ga0098045_104878523300006922MarineMKDYKQLTKEILTEPEFKEGGFVYKHIHEAKSDALISIKSAVDNMSDLYDLERNDIGIISELILKEFTNK*
Ga0099849_100793753300007539AqueousLKDYDQLAKAIMTEPEFRKGGFVYKHIREAKSDALVSIKSAVDSMSDLYDLERDDIGQISERIFNFLKNN*
Ga0102963_136136423300009001Pond WaterMKDYNQLAREIITEPEFREGGFVYKHIHEAKSDALISIKSAVDNMSDLYDLERDDIGQISEIILRKFTDKQQ*
Ga0102811_108516523300009024EstuarineMKDFKKLVQEILTEPEFKQGGFVYKHITEAKSDSLISIKSAVDRMSELYDLEQDDIGIVSELILKQFTNK*
Ga0115566_1013663823300009071Pelagic MarineMKDYTKLVQEIMTEPEFRQGGFVYKHITEAKSDSLVSIKSAVDRMSELYDLEQDDIGIVSELILKQFTNK*
Ga0115566_1032767723300009071Pelagic MarineLKDYDQLAREIITEPEFREGGFVYKHIQEAKSESLVSIKSAVDRMSDLYDLERDDIGQISQRILDIFKNN*
Ga0114994_1013068323300009420MarineLKDYDELARAIIKEPEFREGGFVYKHIQEAKSESLVSIKSAVDRMSDLYDLERDDIGQISERILDMFKNN*
Ga0115013_10000494123300009550MarineMKDYNKLAEAIITEPEFREGGFVYKHVKEAKSDALVSIKSAVDRMSDLYDLERDDIGIISDLLFKRLTGN*
Ga0115001_1075404223300009785MarineMKDYNKLAKEILSEAEFKEGGFVTKHISQGKSNALQAIRSAVDNMSDLYDLERDDIGIISNIILKNLTGS*
Ga0098043_116286823300010148MarineMKDYNKLADEILTEPEFRVGGFVYKHIVEAKSDALVSIKSAVDRMSELYDLEQDDIGIVSELILEKFKNK
Ga0160423_1000723243300012920Surface SeawaterMNNINDIQKYNNLAMEIMGEPEFRPGGFVFKHIKENKSDPLVSIQSAVDRMSELYDLERDDIGIISNIILENFKSN*
Ga0160423_1053539623300012920Surface SeawaterMSNKDYNQLAKAILTEPEFREGGFVYKHIKEAKSESLVSIKSAVDRMSDLYDLERDDIGIISELILKEFMNK*
Ga0163110_1007062133300012928Surface SeawaterMKDYNKLAEEIITEPEFRVGGFVYKHVQEAKSDALVSIKSAVDRMSDLYDLERNDIGKISDIILEKLRNK*
Ga0163110_1009132923300012928Surface SeawaterMKDYKALAEEIITEPEFRPGGFVYKHVKEGKSDSLVSIQSAVDRMSDLYDLEKDDIGQVSNIILEIITNK*
Ga0163110_1011488433300012928Surface SeawaterMNNINDIQKYNNLAMEIMGEPEFRPGGFVFKHIKENKSDPLVSIQSAVDRMSELYDLERDDIGIISNIILEQFKNN*
Ga0163110_1018648333300012928Surface SeawaterLKDYDKLALAILTEPEFREGGFVYKHIQEAKSDSLVSIKSAVDNMSDLYDLERDDIGQISNIILDKLKNK*
Ga0163179_1129022523300012953SeawaterMKDYNQLAEAILTEPEFRENGFVYKHVQEAKSNALVSIQSAVDRMSDLYDLERDDIGIISDILLKRLTDN*
Ga0163111_1045247433300012954Surface SeawaterMKDYNKLAEEIITEPEFRVGGFVYKHVQEAKSDALVSIKSAVDRMSDLYDLERDDIGIISDLLLKKLTDN*
Ga0163111_1213917813300012954Surface SeawaterMKDYNKLADEILTEPEFRVGGFVYKHIVEAKSDALVSIKSAVDRMSELYDLEQDDIGIVSELILEKLKNK*
Ga0181377_100419323300017706MarineMKDYKKVLEEIITEPEFRENGFVYKHIKEGKSDALVSIQSAVDRMSELYDLERDDIGIVSELILQRFTNK
Ga0181403_102763823300017710SeawaterMKDYNKLAKEILTEPEFREGGFVFKHIQEAKSDALVSIKSAVDNMSDLYDLERDDIGIISELILEQFRNN
Ga0181390_111041523300017719SeawaterMKDYNQLVEAIITEPEFREEGFVYKHIKESKSDALVSIKSAVDRMSDLYDLERDDIGIVSELILK
Ga0181427_107562923300017745SeawaterNKLAEEIITEPEFRVGGFVYKHILEAKSDALVSIKSAVDRMSELYDLEQDDIGIVSELILEKFKNK
Ga0181389_102691213300017746SeawaterLAEAILTEPEFRENGFVYKHVQEAKSNALVSIQSAVDRMSDLYDLERDDIGIISDILLKRLTDN
Ga0181389_108133833300017746SeawaterLKDYDQLAKAIIKEPEFREGGFVYKHIHEAKSDALVSIKSAVDRMSDLYDLERDDIGQISQRI
Ga0187219_106050213300017751SeawaterIIYYKRIISLKYYYQLANSIIKDPEFREGGFVYKHIHEAKSDALVSIKSAVDRMSDLYDLERDDIGQISQRILDIFKNN
Ga0181409_104528613300017758SeawaterKAIIKEPEFREGGFVYKHIHEAKSDALVSIKSAVDRMSDLYDLERDDIGQISQRILDIFKNN
Ga0181409_112351413300017758SeawaterYNKLAEEIITEPEFRVGGFVYKHVKEAKSDALVSIQSAVDRMSDLYDLERDDIGQISNIILDKLKNN
Ga0181408_120219723300017760SeawaterLKDYNKLAEEIITEPEFRVGGFVYKHVKEAKSDSLVSIQSAVDRMSDLYDLERDDIGQISNIILDKLKNN
Ga0181410_107125123300017763SeawaterVCFCRMINDYNKLADELLTEPEFREGGFVYKHVKEAKSDALVSIRSAVDRMSDLYDLERNDIGIVSDILLKRLTDN
Ga0181410_122033713300017763SeawaterLKDYNKLAEEIITEPEFRVGGFVYKHVKEAKSDALVSIQSAVDRMSDLYDLERDDIGQISNIILDN
Ga0181385_113315413300017764SeawaterDYNKLAEEIITEPEFRVGGFVYKHVKEAKSDALVSIQSAVDRMSDLYDLERDDIGQISNIILDKLKNN
Ga0181386_100314943300017773SeawaterMKDYNKLAEEIITEPEFRVGGFVYKHIKEGKSDPLVSIQSAVDRMSELYDLERDDIGIISKILLEQFKNNL
Ga0181395_124097323300017779SeawaterIYTMKDYNKLAKEILTEPEFREGGFVFKHIQEARSDALVSIKSAVDNMSDLYDLERDDIGIISELILEQFRNN
Ga0181380_125692323300017782SeawaterLKDYNKLAEEIITEPEFRVGGFVYKHVKEAKSDALVSIQSAVDRMSDLYDLERDDIGIVSELILKKFTNK
Ga0181552_10002205143300017824Salt MarshLKDYDQLAKAIMTEPEFREGGFVYKHIREAKSDALVSIKSAVDSMSDLYDLERDDIGQISERIFNFLKNN
Ga0181607_1048168623300017950Salt MarshMKDYTKLAEAILTEPEFKEGGFAYKHIQEAKSDALISIKSAVDNMSDLYDLERNDIGIISELILEHFRNN
Ga0181580_1015060023300017956Salt MarshMKDYQALAEAIMTEPEFRPGGFVYKHIKEAKSDSLVSIKSAVDNMSDLYDLEREDIGQISEIILKKFTDKQH
Ga0181590_1014848823300017967Salt MarshMKDYQALAEAIMTEPEFRPGGFVYKHIKEAKSDSLVSIKSAVDNMSDLYDLEREDIGQISEIILKKFTDKQQ
Ga0181553_10010867103300018416Salt MarshMKDYQELAEAIMTEPEFRPGGFVYKHIKEAKSDSLVSIKSAVDNMSDLYDLEREDIGQISEIILKKFTDKQH
Ga0181568_1054213833300018428Salt MarshLKDYDQLAKAIMTEPEFREGGFVYKHIREAKSDALVSIKSAVDSMSDLYDLERDDI
Ga0181575_1048502313300020055Salt MarshMKDYQALAESILTEPEFRPGGFVYKHIQEAKSDSLVSIKSAVDNMSDLYDLEREDIGQISEIILKKFIDKQH
Ga0181602_1009451333300020173Salt MarshSRIYTYKMKDYTKLAEAILTEPEFKEGGFAYKHIHEAKSDALISIKSAVDNMSDLYDLERNDIGIISELILEHFRNN
Ga0206124_1004921223300020175SeawaterMKDYTKLVQEIMTEPEFRQGGFVYKHITEAKSDSLVSIKSAVDRMSELYDLEQDDIGIVSELILKQFTNK
Ga0206124_1015707023300020175SeawaterLKDYDQLAREIITEPEFREGGFVYKHIQEAKSESLVSIKSAVDRMSDLYDLERDDIGQISQRILDIFKNN
Ga0206124_1024820323300020175SeawaterLKDYDQLARAIITEPEFREGGFVYKHIHEAKSNALVSIKSAVDNMSDLYDLERDDIGQISERILEMFKNN
Ga0181597_1048163113300020194Salt MarshKMKDYTKLAEAILTEPEFKEGGFAYKHIQEAKSDALISIKSAVDNMSDLYDLERNDIGIISELILEHFRNN
Ga0211711_100026593300020245MarineMNNINDIQKYNNLAMEIMGEPEFRPGGFVFKHIKENKSDPLVSIQSAVDRMSELYDLERDDIGIISNIILEQFRNS
Ga0211667_102703833300020282MarineMNNINDIQKYNNLAMEIMGEPEFRPGGFVFKHIKENRSDPLVSIQSAVDRMSELYDLERDDIGIISNIILEKFKSN
Ga0211527_1005333223300020378MarineMKDYKALAEAIITEPEFREGGFVYKHIQEAKSDSLVSIKSAVDNMSDLYDLEKDDIGILSELILDKIRNN
Ga0211498_1003328333300020380MarineQKYNNLAMEIMGEPEFRPGGFVFKHIKENKSDPLVSIQSAVDRMSELYDLERDDIGIISNIILEQFKNN
Ga0211666_1001640653300020392MarineMNNINDIQKYNNLAMEIMGEPEFRPGGFVFKHIKENRSDPLVSIQSAVDRMSELYDLERDDIGIISNIILENFKSN
Ga0211583_1009707523300020397MarineMNNINDIQRYNNLVMEIMCEPEFKPGGFVYKHLEENKSDPLVSIKSAVDRMSELYDLERNDIGIVSELILEKFKNK
Ga0211617_1039089323300020401MarineMSNKDYKKLAEEIMTEPEFRPNGFVYKHIQEAKSDSLVSIKSAVDSKSDLYDLERNDIGIISDIILKTFIDKQL
Ga0211532_1001520953300020403MarineMKDYNKLAEAIITEPEFKEGGFVYKHIKEAKSDSLVSIKSAVDNMSDLYDLERDDIGKISDIILEKLRNK
Ga0211659_1011291523300020404MarineMKNINDIQKYNNLAMEIMGEPEFRTGGFVYKHIKENKSDPLVSIQSAVDRMSELYDLERDDIGIISNIILENFKSN
Ga0211523_1030107523300020414MarineRIYTHTMKDYKALAEAIITEPEFREGGFVYKHIQEAKSDSLVSIKSAVDNMSDLYDLEKDDIGILSELILDKIRNN
Ga0211512_1030526023300020419MarineMKDYNKLADEIITEPEFRVGGFVYKHILEAKSDALVSIKSAVDRMSELYDLERDDIGIVSELILEKFKNK
Ga0211512_1050470523300020419MarineMKDYNQLAEAILTEPEFRENGFVYKHVQEAKSNALVSIQSAVDRMSDLYDLERDDIGIISDILLKRLTDN
Ga0211653_1043938323300020421MarineMKNINDIQKYNNLAMEIMGEPEFRTGGFVYKHIKENKSDPLVSIQSAVDRMSELYDLERDDIGIISNIILENFKS
Ga0211622_1026884923300020430MarineMDIQKYNNLVLEIMQEPEFKPGGFVFKHIKEGKSDPLVSIKSAVDRMSELYDLERNDIGIVSDLILEKFMNK
Ga0211565_1002698423300020433MarineMNNINDIQRYNNLVMEIMGEPEFKPGGFVYKHLVENKSDPLVSIKSAVDRMSELYDLERDDIGIVSELILEKFRNK
Ga0211539_1012422123300020437MarineKYNNLAMEIMGEPEFRPGGFVFKHIKENKSDPLVSIQSAVDRMSELYDLERDDIGIISNIILEQFKNN
Ga0211576_1001397063300020438MarineMINDYNKLADELLTEPEFREGGFVYKHVKEAKSDALVSIRSAVDRMSDLYDLERNDIGIVSDILLKRLTDN
Ga0211576_1004148943300020438MarineMKDFNKLVQEILTEPEFKQGGFVYKHITEAKSDSLISIKSAVDRMSELYDLEQDDIGIVSELILKQFTNK
Ga0211576_1005505023300020438MarineMKDYNQLVEAIITEPEFREEGFVYKHIKESKSDALVSIKSAVDRMSDLYDLERDDIGIVSELILKKFTNK
Ga0211576_1037991923300020438MarineMKDYNKLAEEIITEPEFRVGGFVYKHILEAKSDALVSIKSAVDRMSELYDLEQDDIGIVSELILEKFKNK
Ga0211559_1003546233300020442MarineMKDYNKLAEEIITEPEFRVGGFVYKHVQEAKSDALVSIKSAVDRMSDLYDLERNDIGKISDIILEKLRNK
Ga0211559_1004083523300020442MarineMSNKDYKALAEAIMTEPEFRPNGFVYKHIQEAKSDSLVSIKSAVDNMSDLYDLERDDIGIISDIILKAFTDKQL
Ga0211559_1004418933300020442MarineMKDYQALAEAIMTEPEFRPGGFVYKHIQEAKSDSLVSIKSAVDNMSDLYDLEREDIGQLSEIILKKFTDKQQ
Ga0211676_10004413103300020463MarineMRNINDLQKYNNLAMEIMGEPEFRAGGFVYKHIKEGKSDPLISIKSAVDRMSELYDLERDDIGIISDIILEKFKSN
Ga0211676_1004257933300020463MarineLKDYNKLAEEIITEPEFRVGGFVYKHVKEAKSDALVSIQSAVDRMSDLYDLERDDIGQISNIILDKLKNN
Ga0211640_1049456723300020465MarineMNNINDIQKYNNLAMEIMGEPEFRPGGFVFKHIQENKSDPLVSIQSAVDRMSELYDLERDDIGIISNIILEQFRNS
Ga0211577_1008050533300020469MarineLKDYDQLAKAIIKEPEFREGGFVYKHIHEAKSDALVSIKSAVDRMSDLYDLERDDIGQISQRILDIFKNN
Ga0211614_1037252313300020471MarineMSNKDYKKLAEEIMTEPEFRPNGFVYKHIQEAKSDSLVSIKSAVDSKSDLYDLERNDIGIISDIILKTFIDKQLXLLPHLVSLNPESHRL
Ga0211547_1063626823300020474MarineMKDYNQLAEAILTEPEFRENGFVYKHVQEAKSNALVSIQSAVDRMSDLYDLERDDIGIIS
Ga0206677_1001345023300021085SeawaterLKDYDQLARAIITEPEFREGGFVYKHIQEAKSESLVSIKSAVDRMSDLYDLERNDIGIISERILNMFKNN
Ga0206677_1002492643300021085SeawaterLKDYDQLAKAIITEPEFREGGFVYKHIHEAKSDALVSIKSAVDNMSDLYDLERDDIGQISERILVMFRNN
Ga0213862_1013099623300021347SeawaterMKDYTKLAEAILTEPEFREGGFVYKHIHEAKSDALVSIKSAVDNMSDLYDLEREDIGIISELILKQFRNN
Ga0213858_1011682423300021356SeawaterLKDYEQLALAIMTEPEFREGGFVFKHIQEAKSDSLVSIKSAVDSMSDLYDLERNDIGQISNIILDKLKNN
Ga0213863_1003544623300021371SeawaterMKDYTKLAEAILTEPEFKEGGFAYKHIQEAKSDALISIKSAVDNMSDLYDLERNDIGIISELILEHFRNK
Ga0213869_10000777193300021375SeawaterLKDYDQLARAIITEPEFRKGGFVYKHIHEAKSNALVSIKSAVDNMSDLYDLERDDIGQISERILEMFKNN
Ga0213869_1000633533300021375SeawaterLKDYDQLAKAIITEPEFRKGGFVYKHIQEAKSDALVSIKSAVDNMSDLYDLERDDIGQISERILEMFRNN
Ga0213869_1022254623300021375SeawaterMKDYTKLAEAILTEPEFREGGFVYKHILEAKSDALISIKSAVDNMSDLYDLEREDIGIISELILKQFRNK
Ga0213869_1030189623300021375SeawaterMKDYKQLVQAIITEPEFREEGFVYKHIKESKSDALVSIKSAVDRMSDLYDLERDDIGIISELILKEFTNK
Ga0222717_1002348153300021957Estuarine WaterMKDYQALAEAIITEPEFRPGGFVYKHIQEAKSDSLVSIKSAVDNMSDLYDLEREDIGQISEIILRKFTDKQQ
Ga0222717_1014431323300021957Estuarine WaterMKDYNQLAREIITEPEFREGGFVYKHIHEAKSDALISIKSAVDNMSDLYDLERDDIGQISEIILRKFTDKQQ
(restricted) Ga0233438_1000936533300024255SeawaterMKDFNKLVQEILTEPEFKQGGFVYKHITEAKSDSLISIKSAVDRMSELYDLEQDEIGIVSELILKQFTNK
(restricted) Ga0233438_1004068323300024255SeawaterLKDYDELARAIIKEPEFREGGFVYKHIQEAKSEALVSIKSAVDRMSDLYDLERDDIGQISERILDMFKNN
(restricted) Ga0233443_108908213300024324SeawaterMKDFKKLVQEILTEPEFKQGGFVYKHITEAKSDSLISIKSAVDRMSELYDLEQDEIGIVSELILKQFTNK
Ga0208298_104280523300025084MarineLKDYDQLARAIITEPEFREGGFVYKHIQEAKSDALVSIKSAVDRMSDLYDLERNDIGIISERILNMFKNN
Ga0208157_114098113300025086MarinePWVYTYTMKDYNKLADDILTEPEFRVGGFVYKHILEAKSDALVSIKSAVDRMSELYDLEQDDIGIVSELILEKFKNK
Ga0208666_107285523300025102MarineYTMKDYNKLADDILTEPEFRVGGFVYKHILEAKSDALVSIKSAVDRMSELYDLEQDDIGIVSELILEKFKNK
Ga0208793_112596823300025108MarineLKDYDQLARAIITEPEFREGGFVYKHIQEAKSDALVSIKSAVDRMSDLYDLERNDIGIISERIL
Ga0209535_107032123300025120MarineMKDYSKVLEEIITEPEFRENGFVYKHIKEGKSNALVSIQSAVDRMSELYDLERDDIGQISQRILDIFKNN
Ga0209348_110694523300025127MarineMKDYNKLAEEIITEPEFRVGGFVYKHVQEAKSDALVSIKSAVDRMSDLYDLERNDIGIISDIILKSFIDKQL
Ga0209232_101187353300025132MarineMKDYNKLADDILTEPEFRVGGFVYKHILEAKSDALVSIKSAVDRMSELYDLEQDDIGIVSELILEKFKNK
Ga0209336_10000171473300025137MarineMKDYSKVLEEIITEPEFRENGFVYKHIKEGKSNALVSIQSAVDRMSELYDLERDDIGIVSELILQRFTNK
Ga0209634_102962333300025138MarineMNYELVANELMNEPEFKPGGFVYKHITENKSNALISIKSAVDNMSDLYDLERDDIGILSGLILQKFRNK
Ga0208162_108196713300025674AqueousLKDYDQLAKAIMTEPEFRKGGFVYKHIREAKSDALVSIKSAVDSMSDLYDLERDDIGQISERIFNFLKNN
Ga0208899_1000243193300025759AqueousMKDYQALAEVIMTEPEFRPGGFVYKHIKEAKSDSLVSIKSAVDNMSDLYDLEREDIGQISEIILKKFTDKQQ
Ga0209631_1010779513300025890Pelagic MarineMKDYTKLVQEIMTEPEFRQGGFVYKHITEAKSDSLVSIKSAVDRMSELYDLEQDDIGIVSELILKQF
Ga0209630_1024907413300025892Pelagic MarineTMKDYKQLAYEILKEPEFREGGFVYKHIKEAKSDSLVSIKSAVDNMSDLYDLERDDIGQISEIILRKFTDKLQ
Ga0209192_1010224223300027752MarineMKDYNKLAQELITEPEFREGGFVYKHIEQNKSNALQSIKSAVDNMSDLYDLEREDIGIVSQIILDKFTSK
Ga0209503_1000221943300027859MarineMKDYNKLAEAIITEPEFREGGFVYKHVKEAKSDALVSIKSAVDRMSDLYDLERDDIGIISDLLFKRLTGN
Ga0228674_113131413300028008SeawaterMKDFNKLVQEILTEPEFKQGGFVYKHITEAKSDSLISIKSAVDRMSELYDLEQDDIGIVSELI
Ga0307488_1031170523300031519Sackhole BrineMKDYNKLAKEILSEAEFKEGGFVTKHISQGKSNALQAIRSAVDNMSDLYDLERDDIGIISNIILKNLTGS
Ga0307489_1007381033300031569Sackhole BrineLKDYDELARAIIKEPEFREGGFVYKHIQEAKSESLVSIKSAVDRMSDLYDLERDDIGQISERILDMFKNN
Ga0315320_10004642153300031851SeawaterMINDYNKLADEILTEPEFREGGFVYKHVKEAKSDALVSIRSAVDRMSDLYDLERNDIGIVSDILLKRLTDN
Ga0315316_1088989123300032011SeawaterKLAEEIITEPEFRVGGFVYKHILEAKSDALVSIKSAVDRMSELYDLEQDDIGIVSELILEKFKNK
Ga0315330_1068345013300032047SeawaterMKDYNKLAEEIITEPEFRVGGFVYKHILEAKSDALVSIKSAVDRMSELYDLEQDDIGIVSELIL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.