NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051262

Metagenome / Metatranscriptome Family F051262

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051262
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 189 residues
Representative Sequence IDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Number of Associated Samples 128
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.71 %
% of genes near scaffold ends (potentially truncated) 96.53 %
% of genes from short scaffolds (< 2000 bps) 81.94 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.889 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(18.750 % of family members)
Environment Ontology (ENVO) Unclassified
(55.556 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.500 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.66%    β-sheet: 30.05%    Coil/Unstructured: 56.28%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF06568DUF1127 6.25
PF01467CTP_transf_like 2.08
PF08282Hydrolase_3 1.39
PF07460NUMOD3 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG5457Uncharacterized conserved protein YjiS, DUF1127 familyFunction unknown [S] 6.25
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 1.39
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 1.39
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 1.39
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 1.39
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 1.39

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.22 %
UnclassifiedrootN/A2.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000224|SI34jun09_10mDRAFT_1002819All Organisms → cellular organisms → Bacteria5064Open in IMG/M
3300000864|OpTDRAFT_1008219All Organisms → Viruses → Predicted Viral1878Open in IMG/M
3300001348|JGI20154J14316_10144100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria657Open in IMG/M
3300001948|GOS2228_1005020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1914Open in IMG/M
3300003216|JGI26079J46598_1077471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria625Open in IMG/M
3300003580|JGI26260J51721_1057609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria592Open in IMG/M
3300004097|Ga0055584_100126558All Organisms → Viruses → Predicted Viral2561Open in IMG/M
3300004279|Ga0066605_10055980All Organisms → Viruses → Predicted Viral1761Open in IMG/M
3300004448|Ga0065861_1175479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria724Open in IMG/M
3300005941|Ga0070743_10008781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3580Open in IMG/M
3300005941|Ga0070743_10148035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria780Open in IMG/M
3300006029|Ga0075466_1129172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria664Open in IMG/M
3300006193|Ga0075445_10260942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria592Open in IMG/M
3300006382|Ga0075494_1236143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300006396|Ga0075493_1014010All Organisms → Viruses → Predicted Viral3479Open in IMG/M
3300006802|Ga0070749_10783351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300006803|Ga0075467_10229349All Organisms → Viruses → Predicted Viral1017Open in IMG/M
3300007229|Ga0075468_10208120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300007231|Ga0075469_10082027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria922Open in IMG/M
3300007236|Ga0075463_10023733All Organisms → Viruses → Predicted Viral2009Open in IMG/M
3300007276|Ga0070747_1065288All Organisms → Viruses → Predicted Viral1376Open in IMG/M
3300007276|Ga0070747_1278404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria577Open in IMG/M
3300007540|Ga0099847_1060445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1182Open in IMG/M
3300007550|Ga0102880_1046305All Organisms → Viruses → Predicted Viral1166Open in IMG/M
3300007554|Ga0102820_1131080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria603Open in IMG/M
3300007558|Ga0102822_1003864All Organisms → Viruses → Predicted Viral4118Open in IMG/M
3300007637|Ga0102906_1034332All Organisms → Viruses → Predicted Viral1506Open in IMG/M
3300007653|Ga0102868_1088998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria699Open in IMG/M
3300007681|Ga0102824_1110703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria721Open in IMG/M
3300007962|Ga0102907_1074931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria895Open in IMG/M
3300008961|Ga0102887_1010053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3583Open in IMG/M
3300008961|Ga0102887_1100332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria915Open in IMG/M
3300009003|Ga0102813_1008940All Organisms → Viruses → Predicted Viral3996Open in IMG/M
3300009049|Ga0102911_1035167All Organisms → Viruses → Predicted Viral1484Open in IMG/M
3300009049|Ga0102911_1080818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria936Open in IMG/M
3300009050|Ga0102909_1038039All Organisms → Viruses → Predicted Viral1221Open in IMG/M
3300009059|Ga0102830_1006410All Organisms → Viruses → Predicted Viral3945Open in IMG/M
3300009086|Ga0102812_10113584All Organisms → Viruses → Predicted Viral1485Open in IMG/M
3300009432|Ga0115005_11233386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300009436|Ga0115008_11636794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300009441|Ga0115007_10661168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria699Open in IMG/M
3300009442|Ga0115563_1070406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1580Open in IMG/M
3300009507|Ga0115572_10504149All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria671Open in IMG/M
3300009512|Ga0115003_10180583All Organisms → Viruses → Predicted Viral1273Open in IMG/M
3300010149|Ga0098049_1068443All Organisms → Viruses → Predicted Viral1123Open in IMG/M
3300010318|Ga0136656_1104763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria989Open in IMG/M
3300010368|Ga0129324_10255133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria698Open in IMG/M
3300010368|Ga0129324_10280402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria659Open in IMG/M
3300010368|Ga0129324_10361046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300012969|Ga0129332_1148383All Organisms → Viruses → Predicted Viral1237Open in IMG/M
3300013014|Ga0164295_10715044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria773Open in IMG/M
3300017697|Ga0180120_10003020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria8416Open in IMG/M
3300017727|Ga0181401_1031482All Organisms → Viruses → Predicted Viral1521Open in IMG/M
3300017735|Ga0181431_1108092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria622Open in IMG/M
3300017740|Ga0181418_1111421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria663Open in IMG/M
3300017743|Ga0181402_1024268All Organisms → Viruses → Predicted Viral1716Open in IMG/M
3300017744|Ga0181397_1168970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria554Open in IMG/M
3300017749|Ga0181392_1079369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria990Open in IMG/M
3300017750|Ga0181405_1040089All Organisms → Viruses → Predicted Viral1252Open in IMG/M
3300017751|Ga0187219_1061427All Organisms → Viruses → Predicted Viral1214Open in IMG/M
3300017757|Ga0181420_1176070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria630Open in IMG/M
3300017770|Ga0187217_1168578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria729Open in IMG/M
3300017771|Ga0181425_1241988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria559Open in IMG/M
3300017782|Ga0181380_1198563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria673Open in IMG/M
3300017783|Ga0181379_1103265All Organisms → Viruses → Predicted Viral1042Open in IMG/M
3300017950|Ga0181607_10171441All Organisms → Viruses → Predicted Viral1299Open in IMG/M
3300018420|Ga0181563_10279432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria984Open in IMG/M
3300018682|Ga0188851_1023190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria723Open in IMG/M
3300019122|Ga0188839_1023247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria634Open in IMG/M
3300020185|Ga0206131_10450975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria521Open in IMG/M
3300020194|Ga0181597_10099323All Organisms → Viruses → Predicted Viral1613Open in IMG/M
3300020266|Ga0211519_1090124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria546Open in IMG/M
3300021960|Ga0222715_10024737All Organisms → Viruses → Predicted Viral4420Open in IMG/M
3300021960|Ga0222715_10304003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria905Open in IMG/M
3300021962|Ga0222713_10814642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria520Open in IMG/M
3300021964|Ga0222719_10775134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria531Open in IMG/M
3300022053|Ga0212030_1007147All Organisms → Viruses → Predicted Viral1310Open in IMG/M
3300022164|Ga0212022_1067318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria550Open in IMG/M
3300022929|Ga0255752_10409751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria531Open in IMG/M
3300023693|Ga0232112_1028062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria628Open in IMG/M
3300024247|Ga0228675_1045370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria949Open in IMG/M
3300024294|Ga0228664_1013850All Organisms → Viruses → Predicted Viral2558Open in IMG/M
3300024313|Ga0228624_1025165All Organisms → Viruses → Predicted Viral1329Open in IMG/M
3300024343|Ga0244777_10308157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria998Open in IMG/M
3300024346|Ga0244775_10001921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria23267Open in IMG/M
3300024346|Ga0244775_10645348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria856Open in IMG/M
3300024348|Ga0244776_10269826All Organisms → Viruses → Predicted Viral1175Open in IMG/M
3300025085|Ga0208792_1073282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria617Open in IMG/M
3300025483|Ga0209557_1013362All Organisms → Viruses → Predicted Viral2958Open in IMG/M
3300025543|Ga0208303_1101860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria605Open in IMG/M
3300025543|Ga0208303_1113869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria554Open in IMG/M
3300025570|Ga0208660_1086128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria709Open in IMG/M
3300025617|Ga0209138_1166816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria544Open in IMG/M
3300025636|Ga0209136_1023081All Organisms → Viruses → Predicted Viral2445Open in IMG/M
3300025647|Ga0208160_1049696All Organisms → Viruses → Predicted Viral1197Open in IMG/M
3300025652|Ga0208134_1152062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300025658|Ga0209659_1160994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria663Open in IMG/M
3300025695|Ga0209653_1170957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria620Open in IMG/M
3300025767|Ga0209137_1150827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria845Open in IMG/M
3300025770|Ga0209362_1119746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria959Open in IMG/M
3300025806|Ga0208545_1013002All Organisms → Viruses → Predicted Viral2980Open in IMG/M
3300025810|Ga0208543_1029140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1389Open in IMG/M
3300025870|Ga0209666_1262157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria703Open in IMG/M
3300025870|Ga0209666_1356576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria557Open in IMG/M
3300025896|Ga0208916_10022904All Organisms → Viruses → Predicted Viral2479Open in IMG/M
3300026460|Ga0247604_1132456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300026462|Ga0247568_1110679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria540Open in IMG/M
3300026483|Ga0228620_1014987All Organisms → Viruses → Predicted Viral2054Open in IMG/M
3300027081|Ga0208954_1036896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria636Open in IMG/M
3300027190|Ga0208674_1021839All Organisms → Viruses → Predicted Viral1000Open in IMG/M
3300027191|Ga0208021_1008349All Organisms → Viruses → Predicted Viral1599Open in IMG/M
3300027192|Ga0208673_1003018All Organisms → Viruses → Predicted Viral3517Open in IMG/M
3300027197|Ga0208922_1018890All Organisms → Viruses → Predicted Viral1259Open in IMG/M
3300027198|Ga0208163_1073543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria543Open in IMG/M
3300027229|Ga0208442_1086897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria501Open in IMG/M
3300027231|Ga0208172_1070377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria592Open in IMG/M
3300027253|Ga0208680_1021754All Organisms → Viruses → Predicted Viral1299Open in IMG/M
3300027253|Ga0208680_1072597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria598Open in IMG/M
3300027278|Ga0208439_1051251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria795Open in IMG/M
3300027571|Ga0208897_1108314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria704Open in IMG/M
3300027788|Ga0209711_10457153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300027813|Ga0209090_10257403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria880Open in IMG/M
3300027833|Ga0209092_10081457All Organisms → Viruses → Predicted Viral1946Open in IMG/M
3300027833|Ga0209092_10145262All Organisms → Viruses → Predicted Viral1372Open in IMG/M
3300028008|Ga0228674_1063186All Organisms → Viruses → Predicted Viral1361Open in IMG/M
3300028287|Ga0257126_1011263All Organisms → Viruses → Predicted Viral4719Open in IMG/M
3300028416|Ga0228614_1037708All Organisms → Viruses → Predicted Viral1101Open in IMG/M
3300031519|Ga0307488_10786954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300031519|Ga0307488_10801979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria521Open in IMG/M
3300031621|Ga0302114_10029914All Organisms → Viruses → Predicted Viral2818Open in IMG/M
3300031622|Ga0302126_10234710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria640Open in IMG/M
3300031658|Ga0307984_1007597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4046Open in IMG/M
3300031660|Ga0307994_1068778All Organisms → Viruses → Predicted Viral1342Open in IMG/M
3300031676|Ga0302136_1147835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria725Open in IMG/M
3300031696|Ga0307995_1300656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300031851|Ga0315320_10309160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1124Open in IMG/M
3300031851|Ga0315320_10467884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria857Open in IMG/M
3300031851|Ga0315320_10577748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria742Open in IMG/M
3300031851|Ga0315320_10818384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300032088|Ga0315321_10639251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria625Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine18.75%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.28%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine9.72%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine9.03%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.03%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.25%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.47%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.47%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.47%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.78%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.78%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.08%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.08%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water2.08%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.39%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.39%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.39%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.69%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.69%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.69%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.69%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.69%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000224Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10mEnvironmentalOpen in IMG/M
3300000864Marine plume microbial communities from the Columbia River - Metatranscriptome 25 PSUEnvironmentalOpen in IMG/M
3300001348Pelagic Microbial community sample from North Sea - COGITO 998_met_04EnvironmentalOpen in IMG/M
3300001948Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003580Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007637Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02EnvironmentalOpen in IMG/M
3300007653Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007962Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02EnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018682Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1EnvironmentalOpen in IMG/M
3300019122Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020194Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020266Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951)EnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023693Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024247Seawater microbial communities from Monterey Bay, California, United States - 36D_rEnvironmentalOpen in IMG/M
3300024294Seawater microbial communities from Monterey Bay, California, United States - 78DEnvironmentalOpen in IMG/M
3300024313Seawater microbial communities from Monterey Bay, California, United States - 29DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025658Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025695Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025767Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025770Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026460Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026483Seawater microbial communities from Monterey Bay, California, United States - 23DEnvironmentalOpen in IMG/M
3300027081Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C33A6_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027190Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 (SPAdes)EnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027197Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes)EnvironmentalOpen in IMG/M
3300027198Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes)EnvironmentalOpen in IMG/M
3300027229Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027231Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027253Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027278Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028287Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120mEnvironmentalOpen in IMG/M
3300028416Seawater microbial communities from Monterey Bay, California, United States - 15DEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031660Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261EnvironmentalOpen in IMG/M
3300031676Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20mEnvironmentalOpen in IMG/M
3300031696Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SI34jun09_10mDRAFT_100281913300000224MarineQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
OpTDRAFT_100821933300000864Freshwater And MarineHRGANAGEKFEVRTVKTLDNFFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
JGI20154J14316_1014410023300001348Pelagic MarineDIVLTDNEGSEWFISLKDVNGNTFSSYSGAASLFDKKGTLQPKSAGAEFLNSFGTDLNQVQAGFDERAGINVLRPKLKVERPNPAKIEKIFNRAWGMNYFYVRRMPGKWKVFWLGKKKLDKLCKGVKIDTIRYPSKKSKQITILCSNSVENYVIEVRNSRAGEYPNDTKFKVKK*
GOS2228_100502013300001948MarineLGRIISDISLIDNEGKEWYISLKDINGDTFSSYSGAASLFDKEGNLVPDSKGAEFLNSFGVDLNKVQAGFDERANKKIKRPKLPVKRPNQAEIKKIFERAWGINYFYVRRGVPDWKVFWLDRAKLNKLSERMIIKNVRYPSKSSKQITIVCSTSSQNYIIEIRNSKAGEYPNDTKFKVTK
JGI26079J46598_107747113300003216MarineFFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVI
JGI26260J51721_105760913300003580MarineDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0055584_10012655813300004097Pelagic MarineTDNQGNPWYISLKDINGNTFSSYSGAASLFNSTGDLQPNSAGATFLKTFGVDLNRVQAGFDERGSINKVRPKLAVTKANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVKK*
Ga0066605_1005598013300004279MarineAGEKFEVRTVKTLDNFFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0065861_117547913300004448MarineLKFDIIIARGANAGEKFEVRTVKTLDNYFKTRNDSETSVVVNMMSESYAPFASAEIVGAKQRTGATKKEGVPIDKLGAIIGDIILTDNQNNEWFISLKDINGNTFSSYSGAASLFDKEGNLQEKSAGAQFLNTFGADLNKVQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNS
Ga0070743_1000878173300005941EstuarineATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0070743_1014803523300005941EstuarineNYFKTRNDSETSVVVNMMSESYAPFASAEIVGAKQRTGATKKEGVPIDKLGAIIGDIILTDNQNNEWFISLKDINGNTFSSYSGAASLFDKEGNLQEKSAGAQFLNTFGADLNKVQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0075466_112917213300006029AqueousGAEITSVKQRTGATKKEGVPIEKLGAIIGDIVLNDNRGNSWFISLKDVNGNTFSSYSGAASLFDKNGTLQPKSEGAKFLNSFGVDLNKVQAGFDVRGNINTFRPNIPVSKPNAQELEKIFNRAWGMNYFYVRRLVNSWKVFWLDRAKLDKLSRSIRIDAIRYPSKKSKQITILCSNSVEQYVIEVRNSKAQEYPNDTKFKVKK*
Ga0075445_1026094213300006193MarineNSKGAEFLNSFGVDLNLVQSGFDERGNINKIREKIPVKKLNPKEVEFIFRRAWGMNYFYVRRKVDGWKVFWLGKEKLDKLAKGIKVTAVRYPSKKSKQITIMCSNTIEDYVIEVRNSKAQEYPNDTKFKVKK*
Ga0075494_123614313300006382AqueousVLNDNRGNSWFISLKDVNGNTFSSYSGAASLFDKNGTLQPKSEGAKFLNSFGVDLNKVQAGFDVRGNINTFRPNIPVSKPNAQELEKIFNRAWGMNYFYVRRLVNSWKVFWLDRAKLDKLSRSIRIDAIRYPSKKSKQITILCSNSVEQYVIEVRNSKAQEYPNDTKFKVKK*
Ga0075493_101401043300006396AqueousGQLYDVIIARGANSGEKFETRTVTNLDSFFKIRQGGEMAQVIQQMNESHAPFAGAEITSVKQRTGATKKEGVPIEKLGAIIGDIVLNDNRGNSWFISLKDVNGNTFSSYSGAASLFDKNGTLQPKSEGAKFLNSFGVDLNKVQAGFDVRGNINTFRPNIPVSKPNAQELEKIFNRAWGMNYFYVRRLVNSWKVFWLDRAKLDKLSRSIRIDAIRYPSKKSKQITILCSNSVEQYVIEVRNSKAQEYPNDTKFKVKK*
Ga0070749_1078335113300006802AqueousSESYAPFANAEIVSAVQRTGATKKEGIPIDKLGAIIGDIILTDNQGNPWYISLKDINGNTFSSYSGAASLFDREGNLQPNSAGATFLKTFGVDLNKVQAGFDERGNINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKDKLDKLSQNIKIDDI
Ga0075467_1022934913300006803AqueousGVPIEKLGAIIGDIILNDNRGNSWFISLKDVNGNTFSSYSGAASLFDKAGTLQPRSEGAKFLNAFGVDLNQVQAGFDIRGNINTFRPNIPVSKPNAQELEKIFNRAWGMNYFYVRRLVNSWKVFWLDRAKLDNLSRNIKIDAIRYPSKKSKQITILCSNSVEQYVIEVRNSKAQEYPNDTKFKVKK*
Ga0075468_1020812013300007229AqueousKLGRIISDISLVDNEGTEWYVSLKDINGDTFSSYSGAASLFDKEGNLVPDSKGAEFLNSFGVDLNKVQSGFDDRANKKIKRPKIPVKRPNQTEIRKIFERAWGVNYFYVKRGVPEWKVFWLDKTKLAKLSQRMTIKNIRYPSKSSKQITIVCSTSAQNYIIEIRNSKAGEYPNDTKFKVTR*
Ga0075469_1008202713300007231AqueousTLQPKSEGAKFLNSFGVDLNKVQAGFDVRGNINTFRPNIPVSKPNAQELEKIFNRAWGMNYFYVRRLVNSWKVFWLDRAKLDKLSRSIRIDAIRYPSKKSKQITILCSNSVEQYVIEVRNSKAQEYPNDTKFKVKK*
Ga0075463_1002373333300007236AqueousAIIGDIILTDNQGNPWYISLKDINGNTFSSYSGAASLFDREGNLQPNSAGATFLKTFGVDLNKVQAGFDERGNINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKDKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK*
Ga0070747_106528833300007276AqueousGAKFLNSFGVDLNKVQAGFDVRGNINTFRPNIPVSKPNAQELEKIFNRAWGMNYFYVRRLVNSWKVFWLDRAKLDKLSRSIRIDAIRYPSKKSKQITILCSNSVEQYVIEVRNSKAQEYPNDTKFKVKK*
Ga0070747_127840413300007276AqueousKTPGTTLKEGVALEKLGRIISDISLVDNEGTEWYVSLKDINGDTFSSYSGAASLFDKEGNLVPDSKGAEFLNSFGVDLNKVQSGFDDRANKKIKRPKIPVKRPNQTEIRKIFERAWGVNYFYVKRGVPEWKVFWLDKTKLAKLSQRMTIKNIRYPSKSSKQITIVCSTSAQNYIIEIRNSKAGEYPNDTKFK
Ga0099847_106044523300007540AqueousIDKLGAIIGDIILTDNQGNPWYISLKDINGNTFSSYSGAASLFNSTGDLQPNSAGATFLKTFGVDLNRVQAGFDERGSINKVRPKLAVTKANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVKK*
Ga0102880_104630513300007550EstuarineESVTFNDISPNSSKFPSYGFTFDGLKYDIIIARGANAGEKFEVRTVKTLDNFFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0102820_113108013300007554EstuarineYAPFASAEIVGAKQRTGATKKEGVPIDKLGAIIGDIILTDNQNNEWFISLKDINGNTFSSYSGAASLFDKEGNLQEKSAGAQFLNTFGADLNKVQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNSKAGEYPND
Ga0102822_100386413300007558EstuarineVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0102906_103433213300007637EstuarineIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0102868_108899813300007653EstuarineFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0102824_111070313300007681EstuarineENFELRTVNTLDNFFNTRTDYETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKV
Ga0102951_106554113300007725WaterSKFPSFSFVFDKQKFDVIIARGANNGEKFELKTVKNLDQFFQTRSAPEMRDVVVAMNEAHEPFASREIVKVTQRTGRTQKAGIPIEKLGEIIGDIVLTDSTGDKWFVSLKDVNGNTFSSYSGAASLFDSKGTLQPNSEGAKYLEAFGVDLNKVQAGFDERAGIKKPRKQIPVKRASQSEIEKIFQRGWGMNYFYVRRQVSGWKIFWLDRAKLNKLCKGMRVDEIRYPGPKSKQITIKCSNAYEEYVIELRNSKRGEYPNDTKMKLRK*
Ga0102907_107493113300007962EstuarineLESVTFNDISPNSSKFPSYGFTFDGLKYDIIIARGANAGEKFEVRTVKTLDNFFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0102887_101005363300008961EstuarineGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0102887_110033223300008961EstuarinePIDKLGAIIGDIILTDNQNNEWFISLKDINGNTFSSYSGAASLFDKEGNLQEKSAGAQFLNTFGADLNKVQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0102960_109042223300009000Pond WaterFELKTVKNLDQFFKTRSAPEMRDVVVAMNEAYEPFASREIVKVTQRTGRTQKAGIPIEKLGEIIGDIVLTDSTGDKWFVSLKDINGNTFSSYSGAASLFDSKGTLQPNSEGAKYLEAFGVDLNKVQAGFDERAGIKKPRKQIPVKRASQSEIEKIFQRGWGMNYFYVRRQVSGWKIFWLDRAKLNKLCKGMRVDEIRYPGPKSKQITIKCSNAYEQYVIELRNSKRGEYPNDTKMKLRK*
Ga0102963_105429713300009001Pond WaterNGEKFELKTVKNLDQFFQTRSAPEMRDVVVAMNEAHEPFASREIVKVTQRTGRTQKAGIPIEKLGEIIGDIVLTDSTGDKWFVSLKDVNGNTFSSYSGAASLFDSKGTLQPNSEGAKYLEAFGVDLNKVQAGFDERAGIKKPRKQIPVKRASQSEIEKIFQRGWGMNYFYVRRQVSGWKIFWLDRAKLNKLCKGMRVDEIRYPGPKSKQITIKCSNAYEEYVIELRNSKRGEYPNDTKMKLRK*
Ga0102813_100894083300009003EstuarineIIIARGANAGEKFEVRTVKTLDNFFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYIIELRNSKAGEYPNDTKFKVKK*
Ga0102911_103516733300009049EstuarineIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSSKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0102911_108081813300009049EstuarineRYNDISPNSSKFPSYSFTFDSLKFDIIIARGANAGEKFEVRTVKTLDNYFKTRNDSETSVVVNMMSESYAPFASAEIVGAKQRTGATKKEGVPIDKLGAIIGDIILTDNQNNEWFISLKDINGNTFSSYSGAASLFDKEGNLQEKSAGAQFLNTFGADLNKVQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0102909_103803923300009050EstuarineASLFDKEGNLQEKSAGAQFLNTFGADLNKVQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0102830_100641013300009059EstuarineKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0102812_1011358413300009086EstuarineIIIARGANAGEKFEVRTVKTLDNFFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK*
Ga0115005_1123338613300009432MarineLGAIIGDIVLEDSNKKEWFVSLKDINGNTFSSYSGAASLFDRDGNLQPNSKGAEFLNSFGVDLNLVQAGFDERGNINKIRPKIPVKKLNSQQVELIFKRAWGMNYFYVRRKVNGWKVFWLGKEKLDKLVKGIKVTAIRYPSKKSKQITIICNNAIEDYVIEVRNSKAQEYPNDTKFKVKK
Ga0115008_1163679413300009436MarineMNESYEPFAGREIVKVKQRTGATKKEGVPIAKLGAIIGDIVLTDNEGSEWFISLKDVNGNTFSSYSGAASLFDKTGTLQPKSAGAEFLNSFGADLNQIQAGFDERAGIDIPRPKHKVERPNNAKIEKIFNRAWGMNYFYVRRMPGDWKVFWLGKSKLDKLCRGIRI
Ga0115007_1066116813300009441MarineTQIRYNEVSPNSSKFPSFSFVFDGQMYDIIIARGANAGEKFETRTVTNLDNFFKIRQSSEMSGLIGQMNESNEAFAQSEIVSAKQRTGATKKEGVPIAELGAIIGDIVLQDSNKNEWFVSLKDVNGNTFSSYSGAASLFDKDGNLQSNSKGAEFLNSFGVDLNLVQSGFDERGNINKIRPNIPVKKLNSQQVELIFKRAWGMNYFYVRRKVNGWKVFWLGKEKLDKLVKGIKV
Ga0115563_107040613300009442Pelagic MarineTDNEGSEWFISLKDVNGNTFSSYSGAASLFDKTGTLQPKSAGAEFLNSFGADLNQIQAGFDERAGINIPRPRHKIERPNNAKIEKIFNRAWGMNYFYVRRMPGDWKVFWLGKSKLDKLCRGIRIDTIRYPSKKSKQITILCSNSVENYVIEVRNSRAGEYPNDTKFKVKK*
Ga0115572_1050414913300009507Pelagic MarineGVDLNRVQAGFDERGSINKVRPKLAVTKANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVKK*
Ga0115003_1018058323300009512MarineMSGLIGQMNESNEAFAQSEIVSAKQRTGATKKEGVPIAKLGAIIGDIVLQDSNKNEWFVSLKDVNGNTFSSYSGAASLFDKDGNLQPNSKGAEFLNSFGVDLNLVQSGFDERGNINKIREKIPVKKLNPKEVEFIFRRAWGMNYFYVRRKVDGWKVFWLGKEKLDKLAKGIKVTAVRYPSKKSKQITIMCSNTIEDYVIEVRNSKAQEYPNDTKFKVKK*
Ga0098049_106844323300010149MarineYSGAASLFDREGNLQPKSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKEKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK*
Ga0136656_110476323300010318Freshwater To Marine Saline GradientEKLGSIIGDIVLTDSSGNEWFVSLKDINGYTFSSYSGAASLFDREGTLQLNSEGAVFLQTFGVDLNQVQAGFDERAGKNTPRPTLPVNRANSAKIEKIFNRAWGMNYFYMKKVSSGWKIFWLGKQKLDKLCQSISIDEIRYPSKKSKQITILCSNSNEKYLIEMRNSKGAEYPNDIKFKVRK*
Ga0129324_1025513313300010368Freshwater To Marine Saline GradientQMNESHAPFAGVEITSVKQRTGSTKKEGVAIEKLGAIIGDIVLNDNRGNEWFISLKDVNGNTFSSYSGAASLFDRDGTLQPNSAGADFLNSFGVDLNKVQAGFDERGNINKFRKTIPVSKPNAQEIEKIFNRAWGMNYFYVRRMVNSWKVFWLDKQKLDKLCRGIKIDDIRYPSKKSKQITILCSNSVEDYVIEIRNSKAQEYPNDTKFKVKK*
Ga0129324_1028040213300010368Freshwater To Marine Saline GradientNESHSSFASSEIVSVKQRTGPTRKEGIPIEKLGAIIGDIELKDSNGEKWYISLKDIKGNTFSSYSGAASLFNKDGVLQPKSAGADFLNSFGVDLNKVQAGFDERGNINKLRPKIPVKRANQAEIEKIFNRAWGMNYFYVRRLVSGWKVFWLGKEKMDKLCRGIKVDTIRYPNKDSKQISILCSNSYEDYLIEIRNSSRGEYPNDTKFKVKK*
Ga0129324_1036104613300010368Freshwater To Marine Saline GradientQMNESHAPFAGVEITSVKQRTGSTKKEGVAIEKLGAIIGDIVLNDNRGNEWFISLKDVNGNTFSSYSGAASLFDRDGTLQPNSAGADFLNSFGVDLNKVQSGFDERGNINKFRKTIPVSRPNAQEIEKIFNRAWGMNYFYVRRMVNGWKVFWLDKQKLDKLCRGIKIDDIRYPSKKSKQITILCSNS
Ga0129332_114838323300012969AqueousVDLNRVQAGFDERGSINKVRPKLAVTKANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVKK
Ga0164295_1071504413300013014FreshwaterEKFEMRTVKNLDQFFKIRQDSEMASLIAQMNEAHSPFANSEIISAKQRTGPTRKEGIPIEKLGAVIGDIVLKDNNGEEWFISLKDVKGNTFSAYSGAASLFSKDGTLQTNSAGADLLNSFGVDLNKVQSGFDVRNSINKLRPNIPVKKANQAEIEKIFNRAWGMNYFYVRRLVSGWKVFWLDKDKMNNLCRGIKVDAIRYPNKDSKQISILCSNSYEDYLIEIRNSSRGEYPNDTKFKVKK*
Ga0180120_10003020103300017697Freshwater To Marine Saline GradientGATKKEGIPIDKLGAIIGDIILTDNQGNPWYISLKDINGNTFSSYSGAASLFNSTGDLQPNSAGATFLKTFGVDLNRVQAGFDERGSINKVRPKLAVTKANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVKK
Ga0181401_103148223300017727SeawaterIIIARGANAGEKFEVRTVKTLDNFFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0181431_110809213300017735SeawaterVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKEKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0181418_111142113300017740SeawaterTVKTLDNYFKTRTDNETSEVVTMMSESHAPFANAEIVGAVQRTGATKKEGIPIDKLGAIIGDIILTDNQGNPWYISLKDINGNTFSSYSGAASLFDREGNLQPNSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTIEDYVIELRNSK
Ga0181402_102426813300017743SeawaterTKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0181397_116897013300017744SeawaterEIVGAVQRTGATKKEGIPIDKLGAIIGDIILTDNQGNPWYISLKDINGNTFSSYSGAASLFDREGNLQPNSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTIEDYVIELR
Ga0181392_107936913300017749SeawaterTFDGLKFDIIIARGANAGEKFEVRTVKTLDNYFKTRTDNETSEVVTMMSESYAPFANAEIIGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFDREGNLQPKSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLTVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKEKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0181405_104008913300017750SeawaterPNSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0187219_106142713300017751SeawaterSPNSSKFPSYGFTFDGLKYDIIIARGANAGEKFEVRTVKTLDNFFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYIIELRNSKAGEYPNDTKFKVKK
Ga0181420_117607013300017757SeawaterEGIPIDKLGAIIGDIILTDNQGNPWYISLKDINGNTFSSYSGAASLFDREGNLQPNSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVKK
Ga0187217_116857813300017770SeawaterIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFDREGNLQPKSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKEKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0181425_124198813300017771SeawaterVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILC
Ga0181380_119856313300017782SeawaterGTLQSKSAGAEFLNAFGTDLNQVQAGFDERAGINVPRPKIKVERPNPSKIEKIFNRAWGMNYFYVRRMPGQWKVFWLGKKKLDKLCKGIKIDTIRYPSKKSKQITILCSNSVENYVIEVRNSRAGEYPNDTKFKVKK
Ga0181379_110326513300017783SeawaterATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFDREGNLQPKSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKEKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0181607_1017144113300017950Salt MarshAASLFDREGNLQPNSAGATFLKTFGVDLNKVQAGFDERGNINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKDKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0181563_1027943213300018420Salt MarshGAYFKTRQNGELGQVIGQMNESYAPFADVEIVNVKQRTGATKKEGIPIAQLGAIIGDIVLTDNKGKDWFISLKDVNGNTFSSYSGAASLFDRTGTLQPNSAGAEFLRSFGVDLNKVQEGFDARAGINKPRPRIHIERPSQQKLEKIFNRAWGMNYFYVRRMPGKWKVFWLDKAKLDKLSRNIVINEIRYPNNVGRGSKQITIKCSNAYESYVVELRNSSAGEYPNDIKFKVTK
Ga0188851_102319023300018682Freshwater LakeGNEWFISLKDVNGNTFSSYSGAASLFDRDGTLQPNSAGADFLNSFGVDLNKVQSGFDERGNINKFRKTIPVSKPNAQEIEKIFNRAWGMNYFYVRRMVNSWKVFWLDKQKLDKLCRGIKIDDIRYPNKKSKQITILCSNSVEDYVIEIRNSKAQEYPNDTKFKVKK
Ga0188839_102324723300019122Freshwater LakeAGADFLNSFGVDLNKVQSGFDERGNINKFRKTIPVSKPNAQEIEKIFNRAWGMNYFYVRRMVNSWKVFWLDKQKLDKLCRGIKIDDIRYPNKKSKQITILCSNSVEDYVIEIRNSKAQEYPNDTKFKVKK
Ga0206131_1045097513300020185SeawaterAPFANAEIVSAVQRTGATKKEGIPIDKLGAIIGDIILTDNQGNPWYISLKDINGNTFSSYSGAASLFNSTGDLQPNSAGATFLKTFGVDLNRVQAGFDERGSINKVRPKLAVTKANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQ
Ga0181597_1009932313300020194Salt MarshEGNLQPNSAGATFLKTFGVDLNKVQAGFDERGNINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKDKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0211519_109012413300020266MarineKLGAIIGDIILTDNQGGEWYISLKDINGNTFSSYSGAASLFDREGNLQPNSAGATFLKTFGVDLNKVQAGFDERGNINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSSKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVK
Ga0222715_1002473713300021960Estuarine WaterKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYIIELRNSKAGEYPNDTKFKVKK
Ga0222715_1030400313300021960Estuarine WaterLTDNQGNPWYISLKDINGNTFSSYSGAASLFDREGNLQPNSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0222713_1081464223300021962Estuarine WaterSEGAVFLQTFGVDLNQVQAGFDERAGKNPPRPTLPVNRANSAKIEKIFNRAWGMNYFYMKKESSGWKIFWLGKQKLDKLCQSISIDEIRYPSKKSKQITILCSNSNEKYLIEMRNSKGAEYPNDIKFKVRK
Ga0222719_1077513423300021964Estuarine WaterTFGVDLNQVQAGFDERAGKNTPRPTLPVNRANSAKIEKIFNRAWGMNYFYMKKESSGWKIFWLGKQKLDKLCQSISIDEIRYPSKKSKQITILCSNSNEKYLIEMRNSKGAEYPNDIKFKVRK
Ga0212030_100714723300022053AqueousPSYSFTFDGQMYDVIVARGANAGEKFETRTVQNLDSYFKIRQDSEMANVIQQMNESHAPFAGVEITSVKQRTGSTKKEGVAIEKLGAIIGDIVLNDNRGNEWFISLKDVNGNTFSSYSGAASLFDRDGTLQPNSAGADFLNSFGVDLNKVQAGFDERGNINKFRKTIPVSKPNAQEIEKIFNRAWGMNYFYVRRMVNSWKVFWLDKQKLDKLCRGIKIDDIRYPSKKSKQITILCSNSVEDYVIEIRNSKAQEYPNDTKFKVKK
Ga0212022_106731813300022164AqueousGNTFSSYSGAASLFDKNGTLQPKSEGAKFLNSFGVDLNKVQAGFDVRGNINTFRPNIPVSKPNAQELEKIFNRAWGMNYFYVRRLVNSWKVFWLDRAKLDKLSRSIRIDAIRYPSKKSKQITILCSNSVEQYVIEVRNSKAQEYPNDTKFKVKK
Ga0255752_1040975113300022929Salt MarshWFISLKDVNGNTFSSYSGAASLFDRTGTLQPNSAGAEFLRSFGVDLNKVQEGFDARAGINKPRPRIHIERPSQQKLEKIFNRAWGMNYFYVRRMPGKWKVFWLDKAKLDKLSRNIVINEIRYPNNVGRGSKQITIKCSNAYESYVVELRNSSAGEYPNDIKFKVTK
Ga0232112_102806223300023693SeawaterGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVK
Ga0228675_104537023300024247SeawaterSLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0228664_101385033300024294SeawaterGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYIIELRNSKAGEYPNDTKFKVKK
Ga0228624_102516523300024313SeawaterGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYIIELRNSKAGEYPNDTKFKVKK
Ga0244777_1030815723300024343EstuarineTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0244775_10001921363300024346EstuarineDIIIARGANAGEKFEVRTVKTLDNFFKTRTDNETSEVVTLMSESYAPFASAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0244775_1064534813300024346EstuarineASLFDKEGNLQEKSAGAQFLNTFGADLNKVQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNSKAGEYPNDTKFKVKK
Ga0244776_1026982613300024348EstuarineFEVRTVKTLDNYFKTRNDSETSVVVNMMSESYAPFASAEIVGAKQRTGATKKEGVPIDKLGAIIGDIILTDNQNNEWFISLKDINGNTFSSYSGAASLFDKEGNLQEKSAGAQFLNTFGADLNKVQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208792_107328213300025085MarineAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFDREGNLQPKSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKEKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0209557_101336243300025483MarineSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208303_110186013300025543AqueousSSYSGAASLFNSTGDLQPNSAGATFLKTFGVDLNRVQAGFDERGSINKVRPKLAVTKANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVKK
Ga0208303_111386913300025543AqueousDNRGNEWFISLKDVNGNTFSSYSGAASLFDRDGTLQPNSAGADFLNSFGVDLNKVQAGFDERGNINKFRKTIPVSKPNAQEIEKIFNRAWGMNYFYVRRMVNSWKVFWLDKQKLDKLCRGIKIDDIRYPNKKSKQITILCSNSVEDYVIEIRNSKAQEYPNDTKFKVKK
Ga0208660_108612813300025570AqueousKTLDNYFKTRTDNETSEVVNMMSESYAPFANAEIVSAVQRTGATKKEGIPIDKLGAIIGDIILTDNQGNPWYISLKDINGNTFSSYSGAASLFNSTGDLQPNSAGATFLKTFGVDLNRVQAGFDERGSINKVRPKLAVTKANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVKK
Ga0209138_116681623300025617MarineGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVTKANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSSKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVKK
Ga0209136_102308113300025636MarineISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208160_104969623300025647AqueousVLNDNRGNEWFISLKDVNGNTFSSYSGAASLFDRDGTLQPNSAGADFLNSFGVDLNKVQSGFDERGNINKFRKTIPVSRPNAQEIEKIFNRAWGMNYFYVRRMVNGWKVFWLDKQKLDKLCRGIKIDDIRYPSKKSKQITILCSNGVEDYVIEIRNSKAQEYPNDTKFKVKK
Ga0208134_115206213300025652AqueousKTPGTTLKEGVALEKLGRIISDISLVDNEGTEWYVSLKDINGDTFSSYSGAASLFDKEGNLVPDSKGAEFLNSFGVDLNKVQSGFDDRANKKIKRPKIPVKRPNQTEIRKIFERAWGVNYFYVKRGVPEWKVFWLDKTKLAKLSQRMTIKNIRYPSKSSKQITIVCSTSAQNYIIEIRNSKAGEYPNDTKFKVT
Ga0209659_116099423300025658MarineQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNSKAGEYPNDTKFKVKK
Ga0209653_117095713300025695MarineNAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0209137_115082713300025767MarineNPWYISLKDINGNTFSSYSGAASLFNSTGDLQPNSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVTKANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSSKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVKK
Ga0209362_111974623300025770MarineDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208545_101300213300025806AqueousGAKFLNSFGVDLNKVQAGFDVRGNINTFRPNIPVSKPNAQELEKIFNRAWGMNYFYVRRLVNSWKVFWLDRAKLDKLSRSIRIDAIRYPSKKSKQITILCSNSVEQYVIEVRNSKAQEYPNDTKFKVKK
Ga0208543_102914013300025810AqueousAIIGDIILTDNQGNPWYISLKDINGNTFSSYSGAASLFDREGNLQPNSAGATFLKTFGVDLNKVQAGFDERGNINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKDKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0209666_126215713300025870MarineASLFNSTGDLQPNSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVTKANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSSKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVKK
Ga0209666_135657613300025870MarineIILTDNQNNEWFISLKDINGNTFSSYSGAASLFDKEGNLQEKSAGAQFLNTFGADLNKVQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208916_1002290413300025896AqueousQQMNESHAPFAGAEITSVKQRTGATKKEGVPIEKLGAIIGDIVLNDNRGNSWFISLKDVNGNTFSSYSGAASLFDKNGTLQPKSEGAKFLNSFGVDLNKVQAGFDVRGNINTFRPNIPVSKPNAQELEKIFNRAWGMNYFYVRRLVNSWKVFWLDRAKLDKLSRSIRIDAIRYPSKKSKQITILCSNSVEQYVIEVRNSKAQEYPNDTKFKVKK
Ga0209929_111870713300026187Pond WaterNGEKFELKTVKNLDQFFQTRSAPEMRDVVVAMNEAHEPFASREIVKVTQRTGRTQKAGIPIEKLGEIIGDIVLTDSTGDKWFVSLKDVNGNTFSSYSGAASLFDSKGTLQPNSEGAKYLEAFGVDLNKVQAGFDERAGIKKPRKQIPVKRASQSEIEKIFQRGWGMNYFYVRRQVSGWKIFWLDRAKLNKLCKGMRVDEIRYPGPKSKQITIKCSNAYEEYVI
Ga0247604_113245613300026460SeawaterATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYIIELRNSKAGEYP
Ga0247568_111067923300026462SeawaterFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0228620_101498733300026483SeawaterEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208954_103689623300027081MarineNTFSSYSGAASLFDREGNLQPNSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTIEDYVIELRNSKAGEYPNDTKFKVKK
Ga0208674_102183913300027190EstuarineFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208021_100834923300027191EstuarineFEVRTVKTLDNFFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208673_100301863300027192EstuarineDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208922_101889023300027197EstuarineNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208163_107354313300027198EstuarineKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPN
Ga0208442_108689713300027229EstuarineSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208172_107037713300027231EstuarineNETSEVVTLMSESYAPFASAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVE
Ga0208680_102175423300027253EstuarineYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208680_107259723300027253EstuarineAQFLNTFGADLNKVQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208439_105125113300027278EstuarineKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0208897_110831413300027571EstuarineLFDKEGNLQEKSAGAQFLNTFGADLNKVQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNSKAGEYPNDTKFKVKK
Ga0209711_1045715313300027788MarineNKKEWFVSLKDINGNTFSSYSGAASLFDRDGNLQPNSKGAEFLNSFGVDLNLVQSGFDERGNINKIREKIPVKKLNPKEVEFIFRRAWGMNYFYVRRKVDGWKVFWLGKEKLDKLAKGIKVTAVRYPSKKSKQITIICNNAIEDYVIEVRNSKAQEYPNDTKFKVKK
Ga0209090_1025740313300027813MarineIRYNEVSPNSSKFPSFSFVFDGQMYDIIIARGANAGEKFETRTVTNLDNFFKIRQSSEMSGLIGQMNESNEAFAQSEIVSAKQRTGATKKEGVPIAKLGAIIGDIVLQDSNKNEWFVSLKDVNGNTFSSYSGAASLFDKDGNLQSNSKGAEFLNSFGVDLNLVQSGFDERGNINKIREKIPVKKLNPKEVEFIFRRAWGMNYFYVRRKVDGWKVFWLGKEKLDKLAKGIKVTAVRYPSKKSKQITIMCSNTIEDYVIEVRNSKAQEYPNDTKFKVKK
Ga0209092_1008145733300027833MarineNDSETSVVVNMMSESYAPFASAEIVGAKQRTGATKKEGVPIDKLGAIIGDIILTDNQNNEWFISLKDINGNTFSSYSGAASLFDKEGNLQEKSAGAQFLNTFGADLNKVQAGFDERGNINKVRPKLKVAKSNAREIEKIFNRAWGMNYFYVRRMTTGWKVFWLGKTKLDKLSQNIRIDDIRYPSKKSKQITILCSNSVENYVIELRNSKAGEYPNDTKFKVKK
Ga0209092_1014526223300027833MarineEGVPIADLGAIIGDIILTDSQRNTWYISLKDIKGNTFSSYSGAASLFDKEGNLQPDSEGATFLNTFGVDLNKVQSGFDERGNINTASIGRPKLSVSRVNAREIEKIFNRAWGMNYFYVRRLTSGWKVFWLGKTKLDKLSKNIRVNSIRYPTKTSKQITILCSNDVEDYVIELRNSKAGEYPNDTKFKVKR
Ga0228674_106318623300028008SeawaterSLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYIIELRNSKAGEYPNDTKFKVKK
Ga0257126_101126313300028287MarineDIIIARGANAGEKFEVRTVKTLDNFFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0228614_103770813300028416SeawaterKTLDNFFKTRTDNETSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0307488_1078695413300031519Sackhole BrineQQMNEAHSPFANSEIISVKQRTGPTKKEGVAIEKLGAIIGDIELKDSNGEKWFISLKDVNGNTFSSYSGAASLFDRDGTLQPNSAGADFLNSFGVDLNKVQAGFDERGNINKFRKTIPVSRPNAQEIEKIFNRAWGMNYFYVRRMVNSWKVFWLDKQKLDKLCRGIKIDDIRYPSK
Ga0307488_1080197913300031519Sackhole BrineVDLNKVQAGFDERGNINKFRKTIPVSKPNAQEIEKIFNRAWGMNYFYVRRMVNSWKVFWLDKQKLDKLCRGIKIDDIRYPSKKSKQITILCSNSVENYVIEIRNSKAQEYPNDTKFKVKK
Ga0302114_1002991413300031621MarineGANAGEKFETRTVTNLDNFFKIRQSSEMSGLIGQMNESNEDFAHSEIIGAKQRTGATKKEGVPIAQLGAIIGDIVLEDSNKKEWFVSLKDINGNTFSSYSGAASLFDRDGNLQPNSKGAEFLNSFGVDLNLVQAGFDERGNINKIRPKIPVKKLNSQQVELIFKRAWGMNYFYVRRKVNGWKVFWLGKEKLDKLVKGIKVTAIRYPSKKSKQITIICNNAIEDYVIEVRNSKAQEYPNDTKFKVKK
Ga0302126_1023471013300031622MarineIARGANAGEKFETRTVTNLDNFFKIRQSSEMSGLIGQMNESNEDFAHSEIIGAKQRTGATKKEGVPIAQLGAIIGDIVLEDSNKKEWFVSLKDINGNTFSSYSGAASLFDRDGNLQPNSKGAEFLNSFGVDLNLVQAGFDERGNINKIRPKIPVKKLNSQQVELIFKRAWGMNYFYVRRKVNGWKVFWLGKEKLDKLVKGIKVTAIRYPSKKS
Ga0307984_100759713300031658MarineIRYNEVSPNSSKFPSFSFVFDGQMYDIIIARGANAGEKFETRTVTNLDNFFKIRQSSEMSGLIGQMNESNEAFAQSEIVSAKQRTGATKKEGVPIAKLGAIIGDIVLQDSNKNEWFVSLKDVNGNTFSSYSGAASLFDKDGNLQPNSKGAEFLNSFGVDLNLVQSGFDERGNINKIREKIPVKKLNPKEVEFIFRRAWGMNYFYVRRKVDGWKVFWLGKEKLDKLAKGIKVTAVRYPSKKSKQITIMCSNTIEDYVIEVRNSKAQEYPNDTKFKVKK
Ga0307994_106877813300031660MarineAGEKFETRTVTNLDNFFKIRQSSEMSGLIGQMNESNEAFAQSEIVSAKQRTGATKKEGVPIAKLGAIIGDIVLQDSNKNEWFVSLKDVNGNTFSSYSGAASLFDKDGNLQPNSKGAEFLNSFGVDLNLVQSGFDERGNINKIREKISVKKLNPKEVEFIFRRAWGMNYFYVRRKVDGWKVFWLGKEKLDKLAKGIKVTAVRYPSKKSKQITIMCSNTIEDYVIEVRNSKAQEYPNDTKFKVKK
Ga0302136_114783513300031676MarineKFPSYSFVFDGQMYDIIIARGANAGEKFETRTVTNLDNFFKIRQSSEMSGLIGQMNESNEDFAHSEIIGAKQRTGATKKEGVPIAQLGAIIGDIVLEDSNKKEWFVSLKDINGNTFSSYSGAASLFDRDGNLQPNSKGAEFLNSFGVDLNLVQAGFDERGNINKIRPKIPVKKLNSQQVELIFKRAWGMNYFYVRRKVNGWKVFWLGKEKLDKLVKGIKVTAIRYPSKKSKQITIICNNA
Ga0307995_130065613300031696MarineNLDNFFKIRQSSEMSGLIGQMNESNEAFAQSEIVSAKQRTGATKKEGVPIAKLGAIIGDIVLQDSNKNEWFVSLKDVNGNTFSSYSGAASLFDKDGNLQPNSKGAEFLNSFGVDLNLVQSGFDERGNINKIREKIPVKKLNPKEVEFIFRRAWGMNYFYVRRKVDGWKVFWLGKEKL
Ga0315320_1030916013300031851SeawaterDIIIARGANAGEKFEVRTVKTLDNYFKTRTDNETSEVVTMMSESHAPFANAEIVGAVQRTGATKKEGIPIDKLGAIIGDIILTDNQGNPWYISLKDINGNTFSSYSGAASLFDREGNLQPNSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0315320_1046788413300031851SeawaterTSEVVTLMSESYAPFANAEIVGAKQRTGATKKEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFNSAGDLQPNSAGAKFLNTFGVDLNRVQEGFDERGSINKVRPKLAVSKASAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVENYVIELRNSKAGEYPNDTKFKVKK
Ga0315320_1057774813300031851SeawaterEGIPIDKLGAIIGDIILTDNQNNEWYISLKDINGNTFSSYSGAASLFDREGNLQPKSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKEKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0315320_1081838423300031851SeawaterATFLKTFGVDLNKVQAGFDERGSINKVRPKLTVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKEKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK
Ga0315321_1063925123300032088SeawaterFSSYSGAASLFDREGNLQPKSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKEKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.