NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051379

Metagenome / Metatranscriptome Family F051379

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051379
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 42 residues
Representative Sequence GSAEDKQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPGEG
Number of Associated Samples 126
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.69 %
% of genes near scaffold ends (potentially truncated) 97.22 %
% of genes from short scaffolds (< 2000 bps) 95.83 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.361 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(14.583 % of family members)
Environment Ontology (ENVO) Unclassified
(27.083 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.472 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 27.54%    Coil/Unstructured: 72.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF04657DMT_YdcZ 33.33
PF01266DAO 20.83
PF02481DNA_processg_A 9.03
PF02738MoCoBD_1 4.17
PF03721UDPG_MGDP_dh_N 2.78
PF00892EamA 2.08
PF00903Glyoxalase 1.39
PF01979Amidohydro_1 0.69
PF12399BCA_ABC_TP_C 0.69
PF02588YitT_membrane 0.69
PF07045DUF1330 0.69
PF01842ACT 0.69
PF00378ECH_1 0.69
PF01061ABC2_membrane 0.69
PF07883Cupin_2 0.69
PF00370FGGY_N 0.69
PF04185Phosphoesterase 0.69
PF03793PASTA 0.69
PF13335Mg_chelatase_C 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG3238Uncharacterized membrane protein YdcZ, DUF606 familyFunction unknown [S] 33.33
COG0758Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptakeReplication, recombination and repair [L] 18.06
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 2.78
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 2.78
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 2.78
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 2.78
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 2.78
COG1284Uncharacterized membrane-anchored protein YitT, contains DUF161 and DUF2179 domainsFunction unknown [S] 0.69
COG2364Uncharacterized membrane protein YczEFunction unknown [S] 0.69
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.69
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.69

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.36 %
UnclassifiedrootN/A7.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c0572744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c1930746All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_13728729All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300000891|JGI10214J12806_11387104All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300000956|JGI10216J12902_101721654All Organisms → cellular organisms → Bacteria2281Open in IMG/M
3300000956|JGI10216J12902_101833393All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300000956|JGI10216J12902_101839473All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300000956|JGI10216J12902_108845083All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300001538|A10PFW1_10386118All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300002568|C688J35102_118363590All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300002568|C688J35102_118414000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300002568|C688J35102_118499619All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300002568|C688J35102_118519812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300003324|soilH2_10302105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1494Open in IMG/M
3300005093|Ga0062594_100417793All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300005093|Ga0062594_100837180All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300005172|Ga0066683_10066181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2155Open in IMG/M
3300005172|Ga0066683_10613854All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005180|Ga0066685_10527974All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300005183|Ga0068993_10380229All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005184|Ga0066671_10850473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300005186|Ga0066676_11094319All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005187|Ga0066675_11375052All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005329|Ga0070683_102197220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300005337|Ga0070682_101075091All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005338|Ga0068868_101694154All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005353|Ga0070669_100346620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1205Open in IMG/M
3300005364|Ga0070673_100191228All Organisms → cellular organisms → Bacteria1758Open in IMG/M
3300005434|Ga0070709_11264573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300005437|Ga0070710_10872891All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300005439|Ga0070711_101273384All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300005440|Ga0070705_100687945All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300005445|Ga0070708_102187802All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005445|Ga0070708_102241288All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005455|Ga0070663_100567826All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300005458|Ga0070681_12027516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis vancoresmycina504Open in IMG/M
3300005466|Ga0070685_11590044All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005526|Ga0073909_10601404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300005529|Ga0070741_10150693All Organisms → cellular organisms → Bacteria2338Open in IMG/M
3300005529|Ga0070741_11118181All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300005542|Ga0070732_10562739All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300005557|Ga0066704_10628742All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300005564|Ga0070664_100313453All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300005575|Ga0066702_10947023All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005614|Ga0068856_100205227All Organisms → cellular organisms → Bacteria1985Open in IMG/M
3300005719|Ga0068861_101953033All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300005764|Ga0066903_108764564All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005841|Ga0068863_101944030All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300005874|Ga0075288_1058495All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300005985|Ga0081539_10123928All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300006032|Ga0066696_10025755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3085Open in IMG/M
3300006173|Ga0070716_101466463All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300006175|Ga0070712_100496197All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300006175|Ga0070712_101573199All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300006578|Ga0074059_10019175All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300006796|Ga0066665_10258222All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300006796|Ga0066665_11116075All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300006797|Ga0066659_11410626All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300006852|Ga0075433_10553225All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300006914|Ga0075436_100554542All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300007076|Ga0075435_100614484All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300007076|Ga0075435_101734713All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300009101|Ga0105247_10414954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia962Open in IMG/M
3300009137|Ga0066709_101814303All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300009147|Ga0114129_11162503All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300009176|Ga0105242_12227191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300009177|Ga0105248_13234832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300009553|Ga0105249_13376140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300009840|Ga0126313_10736030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria800Open in IMG/M
3300009840|Ga0126313_11473743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300010036|Ga0126305_11091705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300010037|Ga0126304_10182667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1367Open in IMG/M
3300010038|Ga0126315_10456734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium810Open in IMG/M
3300010039|Ga0126309_10021325All Organisms → cellular organisms → Bacteria2834Open in IMG/M
3300010044|Ga0126310_11294490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300010045|Ga0126311_10225038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1380Open in IMG/M
3300010325|Ga0134064_10336253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300010366|Ga0126379_11382892All Organisms → cellular organisms → Bacteria → Terrabacteria group810Open in IMG/M
3300010366|Ga0126379_12030976All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300010373|Ga0134128_10593177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1233Open in IMG/M
3300010373|Ga0134128_11688919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300010397|Ga0134124_10302973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1490Open in IMG/M
3300010398|Ga0126383_12437093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300010398|Ga0126383_13342326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300010400|Ga0134122_10609488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1010Open in IMG/M
3300010403|Ga0134123_11171881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium797Open in IMG/M
3300011106|Ga0151489_1674194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300012212|Ga0150985_107241857All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300012351|Ga0137386_10945304Not Available615Open in IMG/M
3300012356|Ga0137371_10067696All Organisms → cellular organisms → Bacteria2766Open in IMG/M
3300012502|Ga0157347_1033148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria655Open in IMG/M
3300012530|Ga0136635_10055957All Organisms → cellular organisms → Bacteria1199Open in IMG/M
3300012902|Ga0157291_10253439Not Available587Open in IMG/M
3300012912|Ga0157306_10466528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300012923|Ga0137359_11617652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300012927|Ga0137416_11423259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300012943|Ga0164241_10564888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300012958|Ga0164299_10476508Not Available824Open in IMG/M
3300012971|Ga0126369_13249258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300012988|Ga0164306_10375771All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300013102|Ga0157371_11183418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300013102|Ga0157371_11319472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300014058|Ga0120149_1052947All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300014487|Ga0182000_10350085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter636Open in IMG/M
3300014969|Ga0157376_12860955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300015374|Ga0132255_102918675All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300017659|Ga0134083_10398140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300018071|Ga0184618_10279004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300018076|Ga0184609_10350757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300018083|Ga0184628_10434543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300018482|Ga0066669_12303226Not Available514Open in IMG/M
3300018920|Ga0190273_10865203All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300019875|Ga0193701_1079771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300020015|Ga0193734_1045230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium815Open in IMG/M
3300020215|Ga0196963_10232898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300021560|Ga0126371_12635639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300022756|Ga0222622_10228426Not Available1250Open in IMG/M
3300023071|Ga0247752_1073957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300025146|Ga0209322_10383955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300025898|Ga0207692_10201049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1171Open in IMG/M
3300025899|Ga0207642_10283006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria954Open in IMG/M
3300025910|Ga0207684_10301242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1382Open in IMG/M
3300025911|Ga0207654_10973013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300025919|Ga0207657_11471761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300025939|Ga0207665_10334430All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300025944|Ga0207661_11663872Not Available583Open in IMG/M
3300026067|Ga0207678_10618440Not Available950Open in IMG/M
3300026078|Ga0207702_10960692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria847Open in IMG/M
3300027748|Ga0209689_1266593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium685Open in IMG/M
3300027765|Ga0209073_10500164Not Available512Open in IMG/M
3300027821|Ga0209811_10438112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300028710|Ga0307322_10236724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300028722|Ga0307319_10058988Not Available1209Open in IMG/M
3300028793|Ga0307299_10067346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1326Open in IMG/M
3300028807|Ga0307305_10305052All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300028811|Ga0307292_10347542Not Available626Open in IMG/M
3300028819|Ga0307296_10478749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300028884|Ga0307308_10480555All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300030993|Ga0308190_1134558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300031234|Ga0302325_10978686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1160Open in IMG/M
3300031731|Ga0307405_11756857Not Available551Open in IMG/M
3300031996|Ga0308176_11943022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300033551|Ga0247830_11414749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300034377|Ga0334931_163658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil14.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.11%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.33%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil5.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.17%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.47%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.47%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.08%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.08%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.39%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.39%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.39%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.39%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.39%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.69%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.69%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.69%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.69%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.69%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.69%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.69%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.69%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.69%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.69%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere0.69%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012502Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610Host-AssociatedOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020215Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300025146Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034377Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_057274422228664022SoilVREFGGKADDKTPIPHVGWFSHCVDTEGINFSLFESDESVTG
ICChiseqgaiiDRAFT_193074613300000033SoilPIPQTGWFAKCKDTEGNAFSLFQADESVPGDFSES*
ICChiseqgaiiFebDRAFT_1372872913300000363SoilQPIPQTGWFAKCKDTEGNAFSLFQADESVPGDFSES*
JGI10214J12806_1138710433300000891SoilQPIPSIGWFARCRDTEGNEFSLFQADESVPAPGEG*
JGI10216J12902_10172165413300000956SoilARARELGGSAEDKQPIPGGGWFARCGDTEGNNFWLFQSDESVPAPTEG*
JGI10216J12902_10183339333300000956SoilDKQPIPHVGWFARCKDNEGTEFSLFQSDESVQPPS*
JGI10216J12902_10183947313300000956SoilDDKQPIPHVGWFARCKDPAGNAFSFFQSDESVQMPEGAETPGQ*
JGI10216J12902_10884508313300000956SoilDDKQPIPSIGWFARCKDSEGNEFSLYQSDENAPMPEQ*
A10PFW1_1038611833300001538PermafrostKEPIPHVGWFARCKDTEGNPFSLFQSDESVAPPQ*
C688J35102_11836359023300002568SoilGGQADEKQPIPGVGWFAGVTDPEGNHWSFFQSDESVAPPGADARER*
C688J35102_11841400013300002568SoilLGGQAEDKQPIPHVGWFARCQDTEGNTFSLFQSDESVSAE*
C688J35102_11849961913300002568SoilGGSADDKQPIPTIGWFARCVDTEGNRFSLFQPDDSVPAPGEA*
C688J35102_11851981213300002568SoilELGGNAEQKQPIPHVGWFARCQDTEGNPFSLFQTDESVAPPSQ*
soilH2_1030210533300003324Sugarcane Root And Bulk SoilENGGRADDKQPIPHVGWFARCTDTEGNGFSLFQSDESVTG*
Ga0062594_10041779343300005093SoilGGEADDKQPIPGIGWFSRCKDSEGNDFSLYQSDENAPGGE*
Ga0062594_10083718013300005093SoilLGGRAEDKMPIPHVGWFTPCSDPEGNAFSLFQSDESVTG*
Ga0066683_1006618113300005172SoilGGKAEDRQPIPHVGWFARCEDTEGNKFSLFQSDESVPPPSA*
Ga0066683_1061385413300005172SoilGSAEDKQPIPTVGWFARCTDTEGNDFSLFQMDESVTVPG*
Ga0066685_1052797413300005180SoilELGGDDGEKQPIPNIGWFARCKDSEGNEFSLFQSDESAPMPEGMPGQ*
Ga0068993_1038022913300005183Natural And Restored WetlandsEEKQPIPQTGWFARCKDTEGNSFSLFQSDESVPGSSLAFF*
Ga0066671_1085047323300005184SoilGQAEDKQPIPGVGWFAGCKDPEGNAFSLFQSDESIPAPSA*
Ga0066676_1109431923300005186SoilLGRVREFGGSAQEKQPIPTIGWFARCQDTEGNGFSLFQSDESVPMPG*
Ga0066675_1137505213300005187SoilELGGQADDKQPIPGVGWFTAAKDPDGNEFSLFQADESAAPPAG*
Ga0070683_10219722023300005329Corn RhizosphereDDKQPIPGVGWFARCTDSEGNSFSLFQGDESVTMPEGAPGA*
Ga0070682_10107509113300005337Corn RhizosphereGSADDKQPIPSIGWFARCVDTEGNRFSLFQADESVPAPGEG*
Ga0068868_10169415413300005338Miscanthus RhizosphereGGSADDKQPIPSIGWFARCVDTEGNRFSLFQADESVPAPGEG*
Ga0070669_10034662013300005353Switchgrass RhizosphereLGGKADDKQPIPGVGWFARCTDSEGNSFSLFQGDESVTMPEGAPGA*
Ga0070673_10019122833300005364Switchgrass RhizosphereSIARARELGGSAEDKQPIPTIGWFARCVDTEGNPFSLFQPDDSVPAPGES*
Ga0070709_1126457323300005434Corn, Switchgrass And Miscanthus RhizosphereADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES*
Ga0070710_1087289123300005437Corn, Switchgrass And Miscanthus RhizosphereIGASISKVRELGGSADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES*
Ga0070711_10127338423300005439Corn, Switchgrass And Miscanthus RhizosphereSISKVRELGGSADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES*
Ga0070705_10068794513300005440Corn, Switchgrass And Miscanthus RhizosphereRELGGSAEDKQPIPTIGWFARCVDTEGNPFSLFQPDDSVPAPGES*
Ga0070708_10218780213300005445Corn, Switchgrass And Miscanthus RhizosphereGGKAEDKQPIPTVGWFARGEDSEGNSFSLFQSDESVPMPS*
Ga0070708_10224128823300005445Corn, Switchgrass And Miscanthus RhizosphereRELGGSADDKQPIPSVGWFARCADTEGNDFSLFQSDESVPSPG*
Ga0070663_10056782613300005455Corn RhizosphereELGGSAEDKQPIPTIGWFARCVDTEGNPFSLFQPDDSVPAPGES*
Ga0070681_1202751613300005458Corn RhizosphereKQPIPGVGWFARCTDSEGNSFSLFQGDESVTMPEGAPGA*
Ga0070685_1159004413300005466Switchgrass RhizosphereSIAKARELGGSADDKQPIPSIGWFARCVDPEGNRFSLFQPDESVPAPGEG*
Ga0073909_1060140413300005526Surface SoilEKQPIPQTGWFARCKDTEGNAFSLFQGDDSVPGDFS*
Ga0070741_1015069313300005529Surface SoilAGEKQPIPTIGWFARCKDTEGNAFSLFQADDSVPGDAGQG*
Ga0070741_1111818113300005529Surface SoilKQPIPTIGWFARCRDTEGNAFSLFQGDENAPGSFG*
Ga0070732_1056273913300005542Surface SoilGTSDDKQPIPHVGWFAHAKDTEGNAFSLFQSDESVAG*
Ga0066704_1062874223300005557SoilKQPIPHVGWFARCKDTEGNRFSLFQSDESVAPPQ*
Ga0070664_10031345333300005564Corn RhizosphereRDAGGSADEKQPIPQTGWFARCKDTEGNAFSLFQGDQSVPGDLG*
Ga0066702_1094702323300005575SoilEDREPIPHVGWFARCEDTEGNKFSLFQSDESVPPPSA*
Ga0068856_10020522713300005614Corn RhizosphereRARELGGSAEDKQPIPTIGWFARCVDTEGNPFSLFQPDDSVPAPGES*
Ga0068861_10195303323300005719Switchgrass RhizosphereRARELGGSAEDKQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPGEG*
Ga0066903_10876456423300005764Tropical Forest SoilAEDKMPIPHVGWFTHCVDTEGIKFSLFQSDESVTG*
Ga0068863_10194403023300005841Switchgrass RhizosphereDDKQPIPQTGWLARCKDTEGNTFSLYQSDESVPGDLSEG*
Ga0075288_105849523300005874Rice Paddy SoilDDKQPIPTIGWFARCVDTEGNRFSLFQPDDSVPAPGES*
Ga0081539_1012392843300005985Tabebuia Heterophylla RhizosphereGEAEDKQPIPSIGWFARCKDSEGNEFSLYQSDENAPGGS*
Ga0066696_1002575513300006032SoilPKIGWFARCKDSEGNEFSLFQSDENAPMPEGMPG*
Ga0070716_10146646323300006173Corn, Switchgrass And Miscanthus RhizosphereQAEDKQPIPGIGWFAGCKDPDGNSFSFFQSDESVAPPSG*
Ga0070712_10049619713300006175Corn, Switchgrass And Miscanthus RhizosphereVRELGGEAEDKQPIPGVGWFSGCKDSEGNEFSLFQGDESAPPPAS*
Ga0070712_10157319913300006175Corn, Switchgrass And Miscanthus RhizosphereAKVRELGGEADDKQPIPHTGWFARCKDGEGNPFSLFQSDESVAPPQ*
Ga0074059_1001917523300006578SoilPIPGIGWFARCTDSEGNSFSLFQGDESVTMPEGAPPA*
Ga0066665_1025822213300006796SoilGEKQPIPNIGWFARCKDSEGNEFSLFQSDESAPMPEGMPGQ*
Ga0066665_1111607523300006796SoilGKAEDKMPIPHVGWFTPCSDTDGNAFSLFQSDESVTG*
Ga0066659_1141062613300006797SoilAEEKQPIPHVGWFARCRDTEGNRFSLFQSDESVAPPQ*
Ga0075433_1055322533300006852Populus RhizosphereRAESKQPIPQIGWFARAWDTEGNPFSLFQSDESVAPG*
Ga0075436_10055454213300006914Populus RhizosphereARVNELGGRAESKQPIPQIGWFARAWDTEGNPFSLFQSDESVAPG*
Ga0075435_10061448413300007076Populus RhizosphereEAEDKQPIPSVGWFARCKDSEGNPFSIFQSDESVQMPS*
Ga0075435_10173471313300007076Populus RhizosphereDIGKVRELGGEAEDKQPIPGVGWFSGCKDSEGNEFSLFQGDESAPPPAS*
Ga0105247_1041495423300009101Switchgrass RhizosphereIPGIGWFARCTDSEGNSFSLFQGDESVTMPEGAPGA*
Ga0066709_10181430333300009137Grasslands SoilAEDKMPIPHVGWFTPCSDTDGNAFSLFQSDESVTG*
Ga0114129_1116250333300009147Populus RhizosphereSADDKQPIPNVGWFTHCKDTEGNAFSLFQSNESAGG*
Ga0105242_1222719113300009176Miscanthus RhizosphereDEKQPIPQTGWFARCKDTEGNAFSLFQGDQSVPGDLG*
Ga0105248_1323483213300009177Switchgrass RhizosphereELGGEAEDKQPIPGVGWFSGCKDSEGNEFSLFQGDESAPPPAS*
Ga0105249_1337614013300009553Switchgrass RhizosphereGSADDKQPIPQTGWLARCKDTEGNTFSLYQSDESVPGDLSEG*
Ga0126313_1073603033300009840Serpentine SoilDDKQPIPHVGWFARCKDTEGNAFSLFQSDESVQLPT*
Ga0126313_1147374313300009840Serpentine SoilKQPIPGVGWFARAWDTEGNSFSLFQSDESVAPPGS*
Ga0126305_1109170513300010036Serpentine SoilGSAEDKQPIPGIGWFARCEDTEGNPFSIFQADDSVAIPAETQNREISN*
Ga0126304_1018266713300010037Serpentine SoilLGGQADDKMPIPEIGWFTHCTDTEGIAFSLFQSDESVSPPEG*
Ga0126315_1045673413300010038Serpentine SoilIPGVGWFSNCTDTEGNKFGLFQTDESIAPPAAPGPS*
Ga0126309_1002132513300010039Serpentine SoilGRAEDKQPIPSIGWFARCWDTEGNSFSLYQNDENAG*
Ga0126310_1129449023300010044Serpentine SoilADDKQPIPSVGWFARCKDTEGNPFSLFQSDESVQPH*
Ga0126311_1022503813300010045Serpentine SoilAEDKQPIPSIGWFARCWDTEGNSFSLYQNDENAA*
Ga0134064_1033625323300010325Grasslands SoilGGHAEDKQPIPGVGWFAGCKDPEGNSFSFFQGDESVPPPTQ*
Ga0126379_1138289213300010366Tropical Forest SoilEKQPIPHIGWFARAKDSEGNPFSLFQTDESAAPPA*
Ga0126379_1203097633300010366Tropical Forest SoilIAKVRELGGKAEDKMPIPHVGWFTHCVDTEGINFSLFQSDESVTG*
Ga0134128_1059317713300010373Terrestrial SoilLGGSADDKQPIPSIGWFARCVDTEGNRFSLFQADESVPAPGEG*
Ga0134128_1168891923300010373Terrestrial SoilSKVRELGGSADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES*
Ga0134124_1030297343300010397Terrestrial SoilELGGSADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES*
Ga0126383_1243709323300010398Tropical Forest SoilEEHPIPGIGWFARCVDTEGNPFSLFQADESAPSPDESEPAEADRS*
Ga0126383_1334232613300010398Tropical Forest SoilVRELGGSADEKQPIPTIGWYARCRDTEGNAFSLFQGDDSVTG*
Ga0134122_1060948833300010400Terrestrial SoilQPIPGIGWFARCKDSEGNSFSLFQGDESVTMPEGAPGG*
Ga0134123_1117188133300010403Terrestrial SoilADDKQPIPGIGWFARCKDSEGNSFSLFQGDESVTMPEGAPGA*
Ga0151489_167419413300011106SoilLGGKADDKQPIPGIGWFARCTDSEGNSFSLFQGDESVTMPEGAPGA*
Ga0150985_10724185713300012212Avena Fatua RhizosphereQPIPKIGWFARCKDSEGNDFSLFQSDENAPMPEGMPGS*
Ga0137386_1094530413300012351Vadose Zone SoilARVRELGGSTEDKQPIPTVGWFARCTDTEGNDFSLFQMDESVTVPG*
Ga0137371_1006769613300012356Vadose Zone SoilEDKQPIPTVGWFARCTDTEGNDFSLFQMDESVTAPG*
Ga0157347_103314813300012502Arabidopsis RhizosphereDIGASISKVRELGGSADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES*
Ga0136635_1005595713300012530Polar Desert SandEDKQPIPGIGWFARCEDTEGNPFSIFQPDDSVPIPAEMQGREISN*
Ga0157291_1025343913300012902SoilHGGRADDKQPIPHVGWFTSCTDTEGNDFSLFQSDESVTG*
Ga0157306_1046652833300012912SoilGEAEDKTPIPHVGWFSHCTDTEGIAFSLFQSDESVQPG*
Ga0137359_1161765223300012923Vadose Zone SoilGDKQPIPHVGWFTHCTDTEGNDFSLYQSDESVAG*
Ga0137416_1142325933300012927Vadose Zone SoilSGDKQPIPHVGWFTHCTDTEGNDFSLYQSDESVAG*
Ga0164241_1056488823300012943SoilEDKMPIPHVGWFTHCSDPEGNDFSLFQSDEAVTG*
Ga0164299_1047650823300012958SoilADDKQPIPSIGWFARCMDTEGNRFSLFQADESVPAPGEG*
Ga0126369_1324925813300012971Tropical Forest SoilAKVRELGGEAEDKQPIPSVGWFAGCKDSEGNEFALFQGDESAQPA*
Ga0164306_1037577133300012988SoilSGEAEDKQSIPGIGWFSGCKDSEGNGFSLFQSDENAPPPAS*
Ga0157371_1118341823300013102Corn RhizosphereADDKQPIPQTGWFARCKDTEGNAFSLFQTDESVPGDFSES*
Ga0157371_1131947223300013102Corn RhizosphereELGGSADDKQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPGEG*
Ga0120149_105294713300014058PermafrostAEGKEPIPHVGWFARCKDTEGNPFSLFQSDESVAPPQ*
Ga0182000_1035008523300014487SoilVVPWSIAKVRELGGKADDKNPIPHVGWFARCSDPDGNSFSLFQGDEGAGA*
Ga0157376_1286095513300014969Miscanthus RhizosphereGEAGEKQPIPQTGWFARCKDTEGNTFSLFQGDDSVPGDFS*
Ga0132255_10291867513300015374Arabidopsis RhizosphereDADLAKVRELGGNADDKQPIPHVGWFARCKDGEGNSFSLFQSDESVAPPQ*
Ga0134083_1039814013300017659Grasslands SoilELGGTAAQKEPIPHVGWFARCQDTEGNPFSLFQSDESVAPPSQ
Ga0184618_1027900413300018071Groundwater SedimentEPIPTIGWFARCKDSEGNEFSLFQSDESVTMPEGAPQD
Ga0184609_1035075713300018076Groundwater SedimentASVERVNELGGSAEDKQAIPATGWYARCEDTEGNQFSIFQADDSVPIPAELQSRENSN
Ga0184628_1043454313300018083Groundwater SedimentSIAKVRELGGEAEDKTPIPHVGWFSHCTDTEGIAFSLFQSDESVQPG
Ga0066669_1230322623300018482Grasslands SoilRELGGKAEDKQPIPGVGWVAGCSDTGGNAFSLFQGDESVPAPG
Ga0190273_1086520313300018920SoilESDDVDASIERVNELGGSAEDKQPIPGTGWYARCEDTEGNPFSIFQADDSVPIPAELQSRENSN
Ga0193701_107977123300019875SoilLGGSAEDKQPIPGIGWFARCVDTEGNKFSLFQGDESVAAPDET
Ga0193734_104523033300020015SoilQPIPGIGWFARCKDSEGNSFSLFQSDESVTMPEGAPGT
Ga0196963_1023289813300020215SoilVRELGGEADEKQPIPEFGWFARCRDPEGNAFSLFQSDESVPAA
Ga0126371_1263563913300021560Tropical Forest SoilKCDDKSPIPHVGWYTRCVDTEGIDFSLFQSDETVTP
Ga0222622_1022842613300022756Groundwater SedimentKARELGGSADDKQPIPSIGWFARCVDPEGNRFSLFQPDESVPAPGES
Ga0247752_107395713300023071SoilAEDKTPIPHVGWFSHCTDTEGIAFSLFQSDESVQPG
Ga0209322_1038395533300025146SoilPPIPEIGWFARCHDTEGNAFSIFQADASVPVPDAGQT
Ga0207692_1020104913300025898Corn, Switchgrass And Miscanthus RhizospherePIPGVGWFARCTDSEGNSFSLFQGDESVTMPEGAPGA
Ga0207642_1028300623300025899Miscanthus RhizosphereKQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPDEG
Ga0207684_1030124213300025910Corn, Switchgrass And Miscanthus RhizosphereQPIPNIGWFARCKDSEGNDFSLFQGDESAPMPEGMPGQ
Ga0207654_1097301313300025911Corn RhizosphereGSADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES
Ga0207657_1147176123300025919Corn RhizosphereELGGSAEDKQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPDEG
Ga0207665_1033443043300025939Corn, Switchgrass And Miscanthus RhizosphereIPKIGWFSRCKDSEGNEFSLYQSDENAPMPEGMPGS
Ga0207661_1166387223300025944Corn RhizosphereREHGGKADEKLPIPHVGWFTRCTDTEGNDFSLFQSDESVTG
Ga0207678_1061844023300026067Corn RhizosphereELGGSAEDKQPIPTIGWFARCVDTEGNPFSLFQPDDSVPAPGES
Ga0207702_1096069213300026078Corn RhizosphereASIARARELGGSAEDKQPIPTIGWFARCVDTEGNPFSLFQPDDSVPAPGES
Ga0209689_126659313300027748SoilDEKQPIPGVGWFAGAKDSEGNAFSLFQSDESAAPPS
Ga0209073_1050016413300027765Agricultural SoilSVAKVRALGGSADEEQPIPKIGWYARCVDTEGNPFSLFQADESAPSPDQS
Ga0209811_1043811223300027821Surface SoilGSADDKQPIPSIGWFARCVDTEGNRFSLFQADESVPAPGEG
Ga0307322_1023672423300028710SoilGSAEDKQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPGEG
Ga0307319_1005898813300028722SoilADEKQPIPTIGWFARCRDTEGNEFSLFQADETVPAPGNEG
Ga0307299_1006734623300028793SoilEDRQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPGEGQDR
Ga0307305_1030505233300028807SoilNKDPIPHVGWFARCKDTEGNSFSLFQSDESVAPPQ
Ga0307292_1034754223300028811SoilARARELGSAEDKQPIPGVGWFARCSDTEGNDFSLFQSDESVPAPGEG
Ga0307296_1047874923300028819SoilEDKQPIPSIGWFARCKDSEGNDFSLYQSDENAPMPEGMPNQ
Ga0307308_1048055513300028884SoilGKAEGKEAIPHVGWFARCEDTEGNKFSFFQSDESVPAPSA
Ga0308190_113455813300030993SoilNELGGSAEDKQAIPGIGWFARCEDTEGNPFSIFQADESVPIPTETQSREISD
Ga0302325_1097868613300031234PalsaSVARVRECGGGSDDPSPIPHVGWFARCTDTEGNSFRLFQSDESAGA
Ga0307405_1175685713300031731RhizosphereTKVREHGGTADDKLPIPHVGWFTHCKDPEGNDFSLFQSEESASG
Ga0308176_1194302223300031996SoilIRGLGGQAEGKTAIPHVGWFARCEDTEGNTFSLFQSDESVSAE
Ga0247830_1141474913300033551SoilVNEHGGTADDKLPIPHVGWFTQCKDSEGNQFCLFQSDESVTG
Ga0334931_163658_384_5333300034377Sub-Biocrust SoilVRESGGEAEDKQPIPTIGWFAGCKDPDGIEFSLFQGDDSAPMPEGAPPA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.