Basic Information | |
---|---|
Family ID | F051391 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 144 |
Average Sequence Length | 45 residues |
Representative Sequence | MRPIPFPILLADRQAYIVRAHRMRGAVVATLIRDLARWVSAAAR |
Number of Associated Samples | 121 |
Number of Associated Scaffolds | 144 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 84.72 % |
% of genes near scaffold ends (potentially truncated) | 21.53 % |
% of genes from short scaffolds (< 2000 bps) | 84.72 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.611 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.861 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.444 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.833 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.78% β-sheet: 0.00% Coil/Unstructured: 47.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 144 Family Scaffolds |
---|---|---|
PF05163 | DinB | 40.28 |
PF03466 | LysR_substrate | 20.14 |
PF00126 | HTH_1 | 16.67 |
PF01625 | PMSR | 6.94 |
PF12680 | SnoaL_2 | 3.47 |
PF00440 | TetR_N | 2.78 |
PF00873 | ACR_tran | 1.39 |
PF00072 | Response_reg | 0.69 |
PF07477 | Glyco_hydro_67C | 0.69 |
PF07690 | MFS_1 | 0.69 |
PF00378 | ECH_1 | 0.69 |
PF07687 | M20_dimer | 0.69 |
PF00529 | CusB_dom_1 | 0.69 |
PF01546 | Peptidase_M20 | 0.69 |
COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
---|---|---|---|
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 40.28 |
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 6.94 |
COG3661 | Alpha-glucuronidase | Carbohydrate transport and metabolism [G] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.61 % |
Unclassified | root | N/A | 1.39 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459009|GA8DASG01BP8O8 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
2170459017|G14TP7Y02I914F | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101190997 | Not Available | 660 | Open in IMG/M |
3300000955|JGI1027J12803_105903655 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300000956|JGI10216J12902_101980959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1290 | Open in IMG/M |
3300001431|F14TB_105278968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
3300001842|RCM30_1030446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1726 | Open in IMG/M |
3300002914|JGI25617J43924_10005339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3904 | Open in IMG/M |
3300002914|JGI25617J43924_10251825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
3300003990|Ga0055455_10122856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 779 | Open in IMG/M |
3300004092|Ga0062389_101737247 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300004479|Ga0062595_100962410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 728 | Open in IMG/M |
3300004633|Ga0066395_10304181 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300005179|Ga0066684_10153335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1463 | Open in IMG/M |
3300005330|Ga0070690_101388611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 565 | Open in IMG/M |
3300005332|Ga0066388_101126958 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300005355|Ga0070671_102093962 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300005434|Ga0070709_11316287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
3300005440|Ga0070705_100230605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1288 | Open in IMG/M |
3300005445|Ga0070708_100101818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2631 | Open in IMG/M |
3300005445|Ga0070708_100443988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1224 | Open in IMG/M |
3300005467|Ga0070706_101830218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 552 | Open in IMG/M |
3300005540|Ga0066697_10716004 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005554|Ga0066661_10036995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2730 | Open in IMG/M |
3300005610|Ga0070763_10002177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 6918 | Open in IMG/M |
3300005618|Ga0068864_102122806 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300005713|Ga0066905_100476579 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300005764|Ga0066903_102393236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1021 | Open in IMG/M |
3300005764|Ga0066903_102766609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 952 | Open in IMG/M |
3300005841|Ga0068863_101319249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 729 | Open in IMG/M |
3300005843|Ga0068860_101538588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
3300005937|Ga0081455_10060867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3180 | Open in IMG/M |
3300005985|Ga0081539_10055854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2194 | Open in IMG/M |
3300005994|Ga0066789_10047530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1883 | Open in IMG/M |
3300006038|Ga0075365_11161895 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300006041|Ga0075023_100605014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
3300006050|Ga0075028_100362858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 820 | Open in IMG/M |
3300006050|Ga0075028_100385968 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300006173|Ga0070716_101060958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 644 | Open in IMG/M |
3300006176|Ga0070765_100653716 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300006578|Ga0074059_12097592 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300007255|Ga0099791_10509533 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300007265|Ga0099794_10528313 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300007788|Ga0099795_10260770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
3300009038|Ga0099829_10092179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2342 | Open in IMG/M |
3300009088|Ga0099830_11700075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
3300009089|Ga0099828_11411381 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300009098|Ga0105245_10368627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1427 | Open in IMG/M |
3300009143|Ga0099792_10835587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
3300009143|Ga0099792_11135285 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300009239|Ga0103858_10156173 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300010043|Ga0126380_10488779 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300010043|Ga0126380_11869937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
3300010046|Ga0126384_11461273 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300010046|Ga0126384_12203083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 530 | Open in IMG/M |
3300010159|Ga0099796_10367012 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300010361|Ga0126378_11381151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
3300010362|Ga0126377_10371275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1433 | Open in IMG/M |
3300010362|Ga0126377_11187869 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300010362|Ga0126377_13233096 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300010366|Ga0126379_12608841 | Not Available | 603 | Open in IMG/M |
3300010397|Ga0134124_11034317 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300010880|Ga0126350_12219489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
3300011270|Ga0137391_10033908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 4301 | Open in IMG/M |
3300011270|Ga0137391_10137257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2127 | Open in IMG/M |
3300011271|Ga0137393_10518809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1022 | Open in IMG/M |
3300011271|Ga0137393_11104629 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300011271|Ga0137393_11160710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
3300012189|Ga0137388_10094061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2558 | Open in IMG/M |
3300012205|Ga0137362_10504000 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300012209|Ga0137379_11185467 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300012359|Ga0137385_11287756 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300012361|Ga0137360_11711136 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300012362|Ga0137361_10263089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1573 | Open in IMG/M |
3300012469|Ga0150984_106401531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli | 522 | Open in IMG/M |
3300012683|Ga0137398_11267152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300012685|Ga0137397_10202652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1476 | Open in IMG/M |
3300012917|Ga0137395_10475274 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300012918|Ga0137396_10664671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 769 | Open in IMG/M |
3300012923|Ga0137359_10371874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1270 | Open in IMG/M |
3300012923|Ga0137359_11285244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
3300012924|Ga0137413_10314979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1098 | Open in IMG/M |
3300012924|Ga0137413_10340685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1060 | Open in IMG/M |
3300012925|Ga0137419_10469901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 994 | Open in IMG/M |
3300012925|Ga0137419_10770610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 785 | Open in IMG/M |
3300012927|Ga0137416_10041025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3175 | Open in IMG/M |
3300012927|Ga0137416_10317908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1296 | Open in IMG/M |
3300012927|Ga0137416_10538382 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300012927|Ga0137416_11748022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
3300012929|Ga0137404_10200588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1690 | Open in IMG/M |
3300012943|Ga0164241_10330682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1090 | Open in IMG/M |
3300012944|Ga0137410_10397378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1110 | Open in IMG/M |
3300012957|Ga0164303_10526388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
3300012971|Ga0126369_13706218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300014166|Ga0134079_10699450 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300015371|Ga0132258_10549938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2893 | Open in IMG/M |
3300018468|Ga0066662_10984549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 834 | Open in IMG/M |
3300018482|Ga0066669_10782642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 844 | Open in IMG/M |
3300019877|Ga0193722_1013573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2085 | Open in IMG/M |
3300019881|Ga0193707_1041123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1494 | Open in IMG/M |
3300019882|Ga0193713_1042330 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
3300019887|Ga0193729_1002987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 8371 | Open in IMG/M |
3300019889|Ga0193743_1017649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3775 | Open in IMG/M |
3300019889|Ga0193743_1214807 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300020004|Ga0193755_1174875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
3300020021|Ga0193726_1017452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3700 | Open in IMG/M |
3300020021|Ga0193726_1228929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
3300020034|Ga0193753_10098745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1460 | Open in IMG/M |
3300020140|Ga0179590_1074082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 900 | Open in IMG/M |
3300021086|Ga0179596_10100127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1315 | Open in IMG/M |
3300021086|Ga0179596_10521274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
3300021178|Ga0210408_10019807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5379 | Open in IMG/M |
3300021478|Ga0210402_11151945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 703 | Open in IMG/M |
3300021560|Ga0126371_10415052 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
3300022533|Ga0242662_10122562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 763 | Open in IMG/M |
3300022756|Ga0222622_10025016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3102 | Open in IMG/M |
3300024330|Ga0137417_1103555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2253 | Open in IMG/M |
3300025552|Ga0210142_1076895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
3300025910|Ga0207684_10275817 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
3300025922|Ga0207646_10170666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1964 | Open in IMG/M |
3300026095|Ga0207676_11016779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
3300026095|Ga0207676_11177684 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300026118|Ga0207675_101001757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 854 | Open in IMG/M |
3300026291|Ga0209890_10073871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1216 | Open in IMG/M |
3300026551|Ga0209648_10179600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1639 | Open in IMG/M |
3300026557|Ga0179587_10536577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 769 | Open in IMG/M |
3300027164|Ga0208994_1059764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
3300027603|Ga0209331_1094030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
3300027835|Ga0209515_10187925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1247 | Open in IMG/M |
3300027846|Ga0209180_10417341 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300027855|Ga0209693_10018834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3309 | Open in IMG/M |
3300027874|Ga0209465_10203510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 988 | Open in IMG/M |
3300027894|Ga0209068_10363281 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300027894|Ga0209068_10657005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
3300028172|Ga0256798_1141595 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300028536|Ga0137415_10073299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3284 | Open in IMG/M |
3300028573|Ga0265334_10008452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4375 | Open in IMG/M |
3300028768|Ga0307280_10282175 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300029636|Ga0222749_10059636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1707 | Open in IMG/M |
3300031231|Ga0170824_107672334 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300031238|Ga0265332_10206063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 817 | Open in IMG/M |
3300031239|Ga0265328_10443955 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300031712|Ga0265342_10378432 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
(restricted) 3300031825|Ga0255338_1172938 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.03% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.64% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.17% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.17% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.47% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.08% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.39% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.39% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.39% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.39% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.69% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.69% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.69% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
Enriched Soil Aggregate | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.69% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.69% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.69% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.69% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028172 | Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0949-MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031825 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
F47_02927650 | 2170459009 | Grass Soil | MHPIPFPILLPDRQAYIVRAHRMRGAVVATLIRDLARWVSAAAR |
4ZMR_04531440 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MRPIPFPILTGDHQPHIVRAHRLRGAVRPSLIREVVRWISGAAR |
INPhiseqgaiiFebDRAFT_1011909972 | 3300000364 | Soil | MMRPIPFPILLGDRQPHIVRAHRMRSAVVANLIRDFARWVSAAAR* |
JGI1027J12803_1059036552 | 3300000955 | Soil | MMRPIPFPILLADRQPHVVRAHRMRSGVVAGLVRDFIRWVSVAAR* |
JGI10216J12902_1019809592 | 3300000956 | Soil | MLPIPFPVLVHDRQVYLLRAHRMRSAAIADLVRKVARLVSSAAR* |
F14TB_1052789682 | 3300001431 | Soil | MLLPLPFPVLVGDRQAYIVRAHRIRGAVVAGLIRNVVRWVSAAAR* |
RCM30_10304461 | 3300001842 | Marine Plankton | MRPIPFPVLTGDHQPHIVRAHRLRGAVAATLVRDLVRWISAAAR* |
JGI25617J43924_100053393 | 3300002914 | Grasslands Soil | MHPIPFPILLADRQAYIVRAHRMRGAVVATLIRDLARWVSAAAR* |
JGI25617J43924_102518251 | 3300002914 | Grasslands Soil | MRPIPFPILLADRQAYIVRAHRMRGAVVATLIRDLARWVSAAAR* |
Ga0055455_101228562 | 3300003990 | Natural And Restored Wetlands | MRPIPFPVLLSDRQAYVERAHRLRNAAVGGLFRDFVRWVSAAAR* |
Ga0062389_1017372472 | 3300004092 | Bog Forest Soil | MLPIPFPVLVPDRQAYVVRAHRLRGAIVAGLIHDLARWVSTAAR* |
Ga0062595_1009624102 | 3300004479 | Soil | MLPIPFPVLVPDRQAYVVRAHRLRGAVVAGLIRDVVRWVSAASR* |
Ga0066395_103041813 | 3300004633 | Tropical Forest Soil | RPWRFAMRPIPFALLTTDRQAYIDRAHRLRGAAVAGLVREFVRWVSAAAR* |
Ga0066684_101533352 | 3300005179 | Soil | MLPIPFPVLVADRQAYIVRAHRMRSAVVAGLIRDLARWVSAVSR* |
Ga0070690_1013886111 | 3300005330 | Switchgrass Rhizosphere | MRPIPFPILTGDHQPHIVRAHRLRGAVAAGLIRDFVRWISVAAR* |
Ga0066388_1011269582 | 3300005332 | Tropical Forest Soil | MRPIPFALLTTDRQAYIDRAHRLRGAAVAGLVREFVRWVSAAAR* |
Ga0070671_1020939621 | 3300005355 | Switchgrass Rhizosphere | MMRPIPFPILVPDRKAYVVEAHRMRSAVVAGLIRDLVRWVSAAAR* |
Ga0070709_113162872 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ISVPLSLEVLMHPIPFPILLADRQAYIVRAHRMRGAVVATLIRDLARWVSAAAR* |
Ga0070705_1002306052 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPIPFPILLADRQPHVVRAHRMRSGVVAGLVRDFIRWVSVAAR* |
Ga0070708_1001018184 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPIPFPILLADRQPHVVRAHRMRSAVVAGLVRDFIRWVSVAAR* |
Ga0070708_1004439881 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VPMRPIPFPILLADRQAYVVRAHRMRGAVVATLIRDLARWVSAAAR* |
Ga0070706_1018302182 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPIPFPILLADRQAYVVRAHRMRGAVVATLIRDLARWVSAAAR* |
Ga0066697_107160042 | 3300005540 | Soil | MLPIPFPVLVADRQAYIVRAHRMRSAVVAGLIRDLARWVSAASR* |
Ga0066661_100369951 | 3300005554 | Soil | MLPIPFPVLVPDRQAYVVRAHRLRSAVVAGLIRDVARWMSAASR* |
Ga0070763_100021772 | 3300005610 | Soil | MHPIPFPVLLPDRQAYVVRAHRLRGATVATLIRDLARWISAAAG* |
Ga0068864_1021228061 | 3300005618 | Switchgrass Rhizosphere | EEILMRPIPFPILTGDHQPHIVRAHRLRGAVAAGLIRDFVRWISVAAR* |
Ga0066905_1004765793 | 3300005713 | Tropical Forest Soil | MRPIPFPILLALMEDRQAYVTRAHRLRGAVMANLIRDVARWVTAAAR* |
Ga0066903_1023932362 | 3300005764 | Tropical Forest Soil | MRPIPFALLTTDRRAYIDRAHRLRGAAVAGLVREFVRWVSAAAR* |
Ga0066903_1027666092 | 3300005764 | Tropical Forest Soil | MLPIPFPVLVADRQAHIVRAHRMRSAVVAGLIRDVVRWVSAAAR* |
Ga0068863_1013192492 | 3300005841 | Switchgrass Rhizosphere | MLLPPPFPVLVGDRQAYIMRAHRIRGAVVAGLIRDVVGWVSAAAR* |
Ga0068860_1015385881 | 3300005843 | Switchgrass Rhizosphere | MLLPLPFPVLVGDRQAYIVRAHRIRGAVVAGLIRD |
Ga0081455_100608673 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLPIPFPILVADRQAYVVRAHRMRSAVVAGLIRDVVRWVSTASR* |
Ga0081539_100558543 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MFRPIPFPVLVPDRKAYVAEAHRLRSAVVAGLIRDLVRWVSAASR* |
Ga0066789_100475303 | 3300005994 | Soil | MRPIPFPILLADRQPHIVRAHRLRGAVVATLIRDLARWISAAAR* |
Ga0075365_111618951 | 3300006038 | Populus Endosphere | PILTGDHQVHIVRAHRLRSAAAANLVRDLVRWISTAAR* |
Ga0075023_1006050142 | 3300006041 | Watersheds | MLPIPFPALVPDRQAYVVRAHRMRGAVVADLIRELARWASAASR* |
Ga0075028_1003628582 | 3300006050 | Watersheds | MRPIPFPILLADRQPHIVRAHRLRGAVVATLVRDLARWISAAAR* |
Ga0075028_1003859683 | 3300006050 | Watersheds | MLPIPFPALVPDRQAYVVRAHRLRGAVVAGLIRDLARWVSAASR* |
Ga0070716_1010609582 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPIPFPILLADRQAYIVRAHRMRGAVVATLIRDLARWVS |
Ga0070765_1006537162 | 3300006176 | Soil | LEVLMRPIPFPILLLADRQPHIVRAHRMRGAVVATLIRDLARWISAAAR* |
Ga0074059_120975922 | 3300006578 | Soil | MMRPIPFPILLGDRQPHIVRAHRMRSAVVANLIRGFARWVSAAAR* |
Ga0099791_105095331 | 3300007255 | Vadose Zone Soil | MMRPIPFPILLADRQPHIVRAHRMRSAVVANLIRDFARWVSAAAR* |
Ga0099794_105283132 | 3300007265 | Vadose Zone Soil | SLQLLEVSMMRPIPFPILLADRQPHIVRAHRMRSAVVANLIRDFARWVSAAAR* |
Ga0099795_102607701 | 3300007788 | Vadose Zone Soil | PIPFPILLADRQPHIVRAHRMRSAVEANLIRDFARWVSAAAR* |
Ga0099829_100921792 | 3300009038 | Vadose Zone Soil | MRPIPFPILLADRQPHVMRAHHMRSAVVAGLVRDFIRWVSVAAR* |
Ga0099830_117000752 | 3300009088 | Vadose Zone Soil | MHPIPFPILLADRQVYIVRAHRMRGAVVAILIRDLARWVSAAAR* |
Ga0099828_114113811 | 3300009089 | Vadose Zone Soil | MRPIPFPILLADRQPHVVRGQRMRSAVVAGLVRDFIRWVSVAAR* |
Ga0105245_103686273 | 3300009098 | Miscanthus Rhizosphere | MRPIPFPILTGDHQPYIARAHRMRGAVAAGLIREVVRWISGAAR* |
Ga0099792_108355871 | 3300009143 | Vadose Zone Soil | MRPIPFPILLADRKPHVVRAHRMRSAVVAGLVRDFIRWVSVAAR* |
Ga0099792_111352851 | 3300009143 | Vadose Zone Soil | MHPIPFPILLADRQAYVVRAHRMRGAVVATLIRDLARWVSAVAR* |
Ga0103858_101561731 | 3300009239 | River Water | ISMRPIPFPVLTGDHQPHIVRAHRLRGAVAATLVRDLVRWISAAAR* |
Ga0126380_104887792 | 3300010043 | Tropical Forest Soil | MRPIPFSLLTTDRQAYIDRAHRLRGAAVAGLVREFVRWVSAAAR* |
Ga0126380_118699371 | 3300010043 | Tropical Forest Soil | MPLPIPFPVLVPDRQAYVVRAHRMRSAVVAGLIRDVVRWVSVAAR* |
Ga0126384_114612731 | 3300010046 | Tropical Forest Soil | TMRPIPFALLTTDRQAYIDRAHRLRGAAVAGLVREFVRWVSAAAR* |
Ga0126384_122030832 | 3300010046 | Tropical Forest Soil | MRPIPFPLLTTDRQAYIDRAHRLRGAAVAGLVREFVRWVSAAAR* |
Ga0099796_103670122 | 3300010159 | Vadose Zone Soil | MLPIPFPALVPDRQAYVVRAHRMRSAVVANLIRDLARWVSAASR* |
Ga0126378_113811511 | 3300010361 | Tropical Forest Soil | MRPIPFALLTTDRQAYIDRAHRLRGAAVAGLVREFVRWVS |
Ga0126377_103712753 | 3300010362 | Tropical Forest Soil | MSEVSMRPIPFPILLALMEDRQAYVTRAHRLRGAVMANLIRDVARWVTAAAR* |
Ga0126377_111878691 | 3300010362 | Tropical Forest Soil | MRPIPFPILVGLMEDRQAYVTRAHRLRGAVMASLLRDIARWVTAAAR* |
Ga0126377_132330962 | 3300010362 | Tropical Forest Soil | MMRPIPFVLLATDRQVHIERAHRLRGAVVATLIRDFARWVSVASR* |
Ga0126379_126088411 | 3300010366 | Tropical Forest Soil | IKTNYRLPDEEIGFSPTLEVPMPLPIPFPVLVPDRQAYVVRAHRMRSAVVAGLIRDVVRWVSTASR* |
Ga0134124_110343171 | 3300010397 | Terrestrial Soil | MLPIPFPALVPDRQAYVVRAHRLRGVVVAGLIRDLARWVAAASR* |
Ga0126350_122194891 | 3300010880 | Boreal Forest Soil | MRPIPFPVLLADRQPHIVRAHRLRGVVVATLIRDLARWISAAAR* |
Ga0137391_100339084 | 3300011270 | Vadose Zone Soil | MRPIPFPILLADRQPHVVRAHHMRSAVVAGLVRDFIRWVSVAAR* |
Ga0137391_101372572 | 3300011270 | Vadose Zone Soil | MLPIPFPALVPDRQAYVVRAHRLRGAAMAGLIRDLARWVSAASR* |
Ga0137393_105188092 | 3300011271 | Vadose Zone Soil | MHPIPFPIPLADRQAYIVRAHRMRGAVVAILIRDLARWVSAAAR* |
Ga0137393_111046292 | 3300011271 | Vadose Zone Soil | MRPIPFPILLADRQAYIVRAHRMRGAVVATLIRDLARWVFAAAR* |
Ga0137393_111607102 | 3300011271 | Vadose Zone Soil | MLPIPFPALVPDRQAYVVRAHRLRGAVVAGLIRDLARWVSAAAL* |
Ga0137388_100940613 | 3300012189 | Vadose Zone Soil | MRPIPFPILLADRQPHVMRAHRVRSAVVAGLVRDFIRWVSVAAR* |
Ga0137362_105040003 | 3300012205 | Vadose Zone Soil | MRPIPFPILLADRQPHVMRAHCMRSAVVAGLVRDFIRWVSVAAR* |
Ga0137379_111854672 | 3300012209 | Vadose Zone Soil | MMRPIPFPILAADRQPHIVRAHRMRSAVVATLIRDFARWVSAAAR* |
Ga0137385_112877562 | 3300012359 | Vadose Zone Soil | LEVPMLPIPFPALVPDRQAYVVRAHRLRGAVVAGLIRDLARWASAASR* |
Ga0137360_117111361 | 3300012361 | Vadose Zone Soil | MLPIPFPALVPDRQAYIVRAHRMRSAVVAGLVRDFIRWVSVAAR* |
Ga0137361_102630893 | 3300012362 | Vadose Zone Soil | MFPIPFPVLVPDRQAYVVRAHRLRGAVVAGLIRDLARWVSVASR* |
Ga0150984_1064015313 | 3300012469 | Avena Fatua Rhizosphere | FPALVPDRQAYVVRAHRLRGAVAAGLIRNFARWVSVASR* |
Ga0137398_112671521 | 3300012683 | Vadose Zone Soil | MMRPIPFPILLADRQPHIVRAHRMRSAVMANLIRDFARWVSAAAR* |
Ga0137397_102026522 | 3300012685 | Vadose Zone Soil | MRPIPFPILLADRKPHVVRAHRMRSGVVAGLVRDFIRWVSVAAR* |
Ga0137395_104752742 | 3300012917 | Vadose Zone Soil | MRPIPFPILLADRQPHIVRARRLRSAVVAGLLRNFVRWVSVAAR* |
Ga0137396_106646712 | 3300012918 | Vadose Zone Soil | MRPIPFPILLADRQPHIVRAHRLRSAVVAGLLRDFVRWVSVAAR* |
Ga0137359_103718742 | 3300012923 | Vadose Zone Soil | MRPIPFPILLADRQSHVVRAHRMRSGVVAGLVRDFIRWVSVAAR* |
Ga0137359_112852441 | 3300012923 | Vadose Zone Soil | LNPKRYLMFPIPFPVLVPDRQAYVVRAHRLRGAVVAGLIRDLARWVSVASR* |
Ga0137413_103149792 | 3300012924 | Vadose Zone Soil | MHPIPFPILLADRQAYVVRAHRMRGAVVATLIRDLARWVFAAAR* |
Ga0137413_103406852 | 3300012924 | Vadose Zone Soil | MHPIPFPILLADRQAYVVRAHRMRGAVVATLIRDLVRWVSAAAR* |
Ga0137419_104699012 | 3300012925 | Vadose Zone Soil | MLPIPFPALVPDRQAYVVRAHRMRSAVVAGLIRDLARWVSAASR* |
Ga0137419_107706102 | 3300012925 | Vadose Zone Soil | MHPIPFPILLADRQAYVVRAHRMRGAVVATLIRNLVSWVSAAAR* |
Ga0137416_100410254 | 3300012927 | Vadose Zone Soil | MERINPLEGRVKFPSTLEVLMLPIPFPLLVADRQTYVVRAHCMRSAVVAGLIRDVVRWVSAAAR* |
Ga0137416_103179083 | 3300012927 | Vadose Zone Soil | MMRPIPFPILLHDRQAYIVRAHRMRSAVVANLIRDLARWVSAAAR* |
Ga0137416_105383822 | 3300012927 | Vadose Zone Soil | MYPIPFPILLPDRQAYVVRAHRMRGAVVATLIRDLARWVSAAAR* |
Ga0137416_117480221 | 3300012927 | Vadose Zone Soil | MRPIPFPILLADRQPHIVRAHRMRGAVVATLFRDLAR |
Ga0137404_102005881 | 3300012929 | Vadose Zone Soil | MHPIPFPILFADRQAYIVRAHRMRGAVVATLIRDLARWVSAAAR* |
Ga0164241_103306821 | 3300012943 | Soil | MRPIPFPVLTGDHQPHIVRAHRMRGAVAANLIREVVRWI |
Ga0137410_103973783 | 3300012944 | Vadose Zone Soil | MMLPVPFPVLTGDRQAYIMRAHRIRSAVVASLIRDVVRWVSAASR* |
Ga0164303_105263881 | 3300012957 | Soil | MMRPIPFPILLGDRQPHIVRAHRMRSAVVANLIRDFA |
Ga0126369_137062182 | 3300012971 | Tropical Forest Soil | MPLPIPFPVLVPDRQAYVVRAHRMRSAVVAGLIRDVVRWVSTASR* |
Ga0134079_106994501 | 3300014166 | Grasslands Soil | MLPIPFPALVPDRQAYIARAHRIRGAVVASLIRDLARWVSVASR* |
Ga0132258_105499384 | 3300015371 | Arabidopsis Rhizosphere | MMLPIPFPVLAADRQAHVVRAHRLRSAVVAGLVRDVVRWVSIAAR* |
Ga0066662_109845492 | 3300018468 | Grasslands Soil | MLPIPFPVLVPDRQAYVVRAHRLRSAVVAGLIRDVARWVSAASR |
Ga0066669_107826422 | 3300018482 | Grasslands Soil | MLPIPFPVLVADRQAYIVRAHRMRSAVVAGLIRDLARWVSAVSR |
Ga0193722_10135731 | 3300019877 | Soil | MHPIPFPILLADRQAYIVRAHRMRGAVVATLIRDLVRWVSAAAR |
Ga0193707_10411233 | 3300019881 | Soil | MHPIPFPILLADRQAYIVRAHRMRGAVVATLIRDLARWVSAAAR |
Ga0193713_10423302 | 3300019882 | Soil | MMRPIPFPILLADRQPHIVRAHRMRSAVVANLIRDLARWVSAAAR |
Ga0193729_10029876 | 3300019887 | Soil | MLPIPFPILLADRQAYIVRAHRMRGAVVATLIRDLARWVSAAAR |
Ga0193743_10176495 | 3300019889 | Soil | MHPIPFPILLADRQAYVVRAHRMRGAVVATLIRDLVRWVSAAAR |
Ga0193743_12148072 | 3300019889 | Soil | MMRPIPFPILLGDRQVHITRAHRMRGAVMANLIRDFARWVSAAAR |
Ga0193755_11748752 | 3300020004 | Soil | MLPIPFPILLADRQPYIVRAHRMRGAVVATLIRDLARWVSAAAR |
Ga0193726_10174524 | 3300020021 | Soil | MHPIPFPVLLPDRQAYIVRAHRMRGAVVATLIRDLARWVSAAAR |
Ga0193726_12289291 | 3300020021 | Soil | LMHPIPFPILLADRQAYIVRAHRMRGAVVATLIRDLARWVSAAAR |
Ga0193753_100987451 | 3300020034 | Soil | FPILLADRQAYIVRAHRMRGAVVATLIRDLARWVSAAAR |
Ga0179590_10740822 | 3300020140 | Vadose Zone Soil | MHPIPFPILLADRQAYVVRAHRMRGAVVATLIRDLARWVFAAAR |
Ga0179596_101001273 | 3300021086 | Vadose Zone Soil | MMRPIPFPILLADRQPHIVRAHRMRSAVVANLIRDFARWVSAAAR |
Ga0179596_105212742 | 3300021086 | Vadose Zone Soil | EVRFFPTLEVPMLPIPFPALVPDRQAYVVRAHRMRSAVVAGLIRDLARWVSAAAR |
Ga0210408_100198077 | 3300021178 | Soil | MHPIPFPVLLPDRQAYVVRAHRLRGAVVATLIRDLARWISAAAR |
Ga0210402_111519452 | 3300021478 | Soil | MRPIPFPILLADRQAYVVRAHRMRGAVVATLIRDLARWVSAAAR |
Ga0126371_104150523 | 3300021560 | Tropical Forest Soil | MRPIPFALLTTDRRAYIDRAHRLRGAAVAGLVREFVRWVSAAAR |
Ga0242662_101225623 | 3300022533 | Soil | PIPFPALVPDRRAYVVLAHRMRGAVVAGLIRELARWASAASR |
Ga0222622_100250165 | 3300022756 | Groundwater Sediment | MMRPIPFPILLGDRQPHIVRAHRMRSAVVANLIRDFARWVSAAAR |
Ga0137417_11035551 | 3300024330 | Vadose Zone Soil | MMRPIPFPILLHDRQAYIVRAHRMRSAVVANLIRDLARWVSAAAR |
Ga0210142_10768952 | 3300025552 | Natural And Restored Wetlands | MRPIPFPVLLSDRQAYVERAHRLRNAAVGGLFRDFVRWVSAAAR |
Ga0207684_102758173 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPIPFPILLADRQPHVVRGHRMRSAVVGGLVRDFIRWVSVAAR |
Ga0207646_101706662 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPIPFPILLADRQPHVVRAHRMRSGVVAGLVRDFIRWVSVAAR |
Ga0207676_110167792 | 3300026095 | Switchgrass Rhizosphere | MLLPLPFPVLVGDRQTYIVRAHRIRGAVVAGLIRNVVRWVSAAAR |
Ga0207676_111776841 | 3300026095 | Switchgrass Rhizosphere | FPILTGDHQPHIVRAHRLRGAVAAGLIRDFVRWISVAAR |
Ga0207675_1010017572 | 3300026118 | Switchgrass Rhizosphere | MRPIPFPILTGDHQAHIVRAHRMRGAVAANIVREFVRWI |
Ga0209890_100738711 | 3300026291 | Soil | MRPIPFPILLADRQPHIVRAHRLRGAVVATLIRDLARWISAAAR |
Ga0209648_101796003 | 3300026551 | Grasslands Soil | MRPIPFPILLADRQAYIVRAHRMRGAVVATLIRDLARWVSAAAR |
Ga0179587_105365772 | 3300026557 | Vadose Zone Soil | MRPIPFPILLADRKPHVVRAHRMRSAVVAGLVRDFIRWVSVAAR |
Ga0208994_10597642 | 3300027164 | Forest Soil | MLPIPFPILLADRQAYVVRAHRMRGAVVATLIRDLARWVSAAAR |
Ga0209331_10940302 | 3300027603 | Forest Soil | MRPIPFPVLLADRQPHIVRAHRMRGAVVATLIRDLARWISAAAR |
Ga0209515_101879252 | 3300027835 | Groundwater | MLPIPYPFLATDHQAHIVRAHRMRSAVMAGLIRDIARWVSFAAR |
Ga0209180_104173412 | 3300027846 | Vadose Zone Soil | MRPIPFPILLADRQPHVMRAHHMRSAVVAGLVRDFIRWVSVAAR |
Ga0209693_100188344 | 3300027855 | Soil | MHPIPFPVLLPDRQAYVVRAHRLRGATVATLIRDLARWISAAAG |
Ga0209465_102035103 | 3300027874 | Tropical Forest Soil | RRPWRFAMRPIPFALLTTDRQAYIDRAHRLRGAAVAGLVREFVRWVSAAAR |
Ga0209068_103632812 | 3300027894 | Watersheds | MRPIPFPILLADRQPHIVRAHRLRGAVVATLVRDLARWISAAAR |
Ga0209068_106570052 | 3300027894 | Watersheds | MLPIPFPALVPDRQAYVVRAHRLRGAVVAGLIRDLARWVSAASR |
Ga0256798_11415952 | 3300028172 | Enriched Soil Aggregate | PIPFPILTGDHQPHIVRAHRMRSAVAANLVRDLVRWISAAAR |
Ga0137415_100732992 | 3300028536 | Vadose Zone Soil | MLPIPFPLLVADRQTYVVRAHCMRSAVVAGLIRDVVRWVSAAAR |
Ga0265334_100084527 | 3300028573 | Rhizosphere | MLPIPFPVLTGDHHPHIVRAHRLRSAVVAGLIRDVVRWVSVAAR |
Ga0307280_102821752 | 3300028768 | Soil | MMRPIPFPILLHDRQAYVVRAHRMRGAVVATLIRDLARWVSAAAR |
Ga0222749_100596362 | 3300029636 | Soil | MYPIPFPILLADRQAYIVRAHRMRGAVVATLIRDLVRWVSAAAR |
Ga0170824_1076723342 | 3300031231 | Forest Soil | MMRPIPFPILLADRQPHVVRAHRMRSAVVANLIRDFARWISAAAR |
Ga0265332_102060632 | 3300031238 | Rhizosphere | MMRPIPFPILLADRQPHIVRAHRMRSAVFAGLIRDIARWVSAAAR |
Ga0265328_104439552 | 3300031239 | Rhizosphere | MMRPIPFPILLADRQPHIVRAHRLRSAVFAGLIRDIARWVSAAAR |
Ga0265342_103784322 | 3300031712 | Rhizosphere | MMRPIPFPILLADRQTHIVRAHRMRSAVFAGLIRDIARWVSAAAR |
(restricted) Ga0255338_11729381 | 3300031825 | Sandy Soil | MRPIPFPVLAADRHTHIVRAHRIRGAVVATLIRDLARWVSAAAR |
⦗Top⦘ |