Basic Information | |
---|---|
Family ID | F051392 |
Family Type | Metagenome |
Number of Sequences | 144 |
Average Sequence Length | 38 residues |
Representative Sequence | DAAMRRVLIGLTVTLLVVVSIGVGVAVARWPHPHLWP |
Number of Associated Samples | 124 |
Number of Associated Scaffolds | 144 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 41.67 % |
% of genes near scaffold ends (potentially truncated) | 27.08 % |
% of genes from short scaffolds (< 2000 bps) | 72.22 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.222 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.139 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.472 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.500 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.15% β-sheet: 0.00% Coil/Unstructured: 53.85% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 144 Family Scaffolds |
---|---|---|
PF08323 | Glyco_transf_5 | 40.28 |
PF12833 | HTH_18 | 32.64 |
PF02074 | Peptidase_M32 | 7.64 |
PF02446 | Glyco_hydro_77 | 4.86 |
PF00165 | HTH_AraC | 3.47 |
PF03168 | LEA_2 | 2.08 |
PF01171 | ATP_bind_3 | 1.39 |
PF03065 | Glyco_hydro_57 | 1.39 |
PF06206 | CpeT | 1.39 |
PF13419 | HAD_2 | 0.69 |
PF04536 | TPM_phosphatase | 0.69 |
PF02405 | MlaE | 0.69 |
PF13578 | Methyltransf_24 | 0.69 |
COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
---|---|---|---|
COG0297 | Glycogen synthase | Carbohydrate transport and metabolism [G] | 40.28 |
COG0438 | Glycosyltransferase involved in cell wall bisynthesis | Cell wall/membrane/envelope biogenesis [M] | 40.28 |
COG2317 | Zn-dependent carboxypeptidase, M32 family | Posttranslational modification, protein turnover, chaperones [O] | 7.64 |
COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 4.86 |
COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 1.39 |
COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.39 |
COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 1.39 |
COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 1.39 |
COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.39 |
COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 1.39 |
COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.22 % |
Unclassified | root | N/A | 2.78 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001182|JGI12668J13544_1001054 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100392281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1268 | Open in IMG/M |
3300002909|JGI25388J43891_1025976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 987 | Open in IMG/M |
3300005174|Ga0066680_10072349 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
3300005175|Ga0066673_10090288 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
3300005186|Ga0066676_10247134 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
3300005187|Ga0066675_10094794 | All Organisms → cellular organisms → Bacteria | 1956 | Open in IMG/M |
3300005526|Ga0073909_10054609 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
3300005533|Ga0070734_10052432 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
3300005538|Ga0070731_10059351 | All Organisms → cellular organisms → Bacteria | 2542 | Open in IMG/M |
3300005540|Ga0066697_10651148 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300005541|Ga0070733_10001097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 20583 | Open in IMG/M |
3300005541|Ga0070733_10020966 | All Organisms → cellular organisms → Bacteria | 4069 | Open in IMG/M |
3300005560|Ga0066670_10488515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 758 | Open in IMG/M |
3300005566|Ga0066693_10023575 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
3300005568|Ga0066703_10438383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 783 | Open in IMG/M |
3300005591|Ga0070761_10000216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 38280 | Open in IMG/M |
3300005591|Ga0070761_10001810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13355 | Open in IMG/M |
3300005591|Ga0070761_10015547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4232 | Open in IMG/M |
3300005610|Ga0070763_10004108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5496 | Open in IMG/M |
3300005614|Ga0068856_100013187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8004 | Open in IMG/M |
3300005764|Ga0066903_100580485 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
3300005764|Ga0066903_105925014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
3300005921|Ga0070766_10261778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1100 | Open in IMG/M |
3300005921|Ga0070766_10267021 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300006034|Ga0066656_10272875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1089 | Open in IMG/M |
3300006173|Ga0070716_101049412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 647 | Open in IMG/M |
3300006176|Ga0070765_101173756 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300006358|Ga0068871_101003739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 777 | Open in IMG/M |
3300006804|Ga0079221_10679724 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300006852|Ga0075433_10442799 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300007258|Ga0099793_10063313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1658 | Open in IMG/M |
3300009038|Ga0099829_10899411 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300009093|Ga0105240_10460812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1421 | Open in IMG/M |
3300009143|Ga0099792_10000094 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 34066 | Open in IMG/M |
3300009826|Ga0123355_10031006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8672 | Open in IMG/M |
3300009826|Ga0123355_10665996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1209 | Open in IMG/M |
3300010043|Ga0126380_10644710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 842 | Open in IMG/M |
3300010048|Ga0126373_12537316 | Not Available | 571 | Open in IMG/M |
3300010322|Ga0134084_10112403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 881 | Open in IMG/M |
3300010359|Ga0126376_10394658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1244 | Open in IMG/M |
3300010361|Ga0126378_11637322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 731 | Open in IMG/M |
3300010361|Ga0126378_12332500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 611 | Open in IMG/M |
3300010361|Ga0126378_12991239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 539 | Open in IMG/M |
3300010376|Ga0126381_100718124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1430 | Open in IMG/M |
3300010376|Ga0126381_101113263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1141 | Open in IMG/M |
3300010379|Ga0136449_101952316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 869 | Open in IMG/M |
3300010398|Ga0126383_10127808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2330 | Open in IMG/M |
3300010401|Ga0134121_10039107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3869 | Open in IMG/M |
3300012202|Ga0137363_10029353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3783 | Open in IMG/M |
3300012203|Ga0137399_10044027 | All Organisms → cellular organisms → Bacteria | 3193 | Open in IMG/M |
3300012203|Ga0137399_10199330 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
3300012211|Ga0137377_10044694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4071 | Open in IMG/M |
3300012361|Ga0137360_10232378 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
3300012582|Ga0137358_10914339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 574 | Open in IMG/M |
3300012917|Ga0137395_10058308 | All Organisms → cellular organisms → Bacteria | 2454 | Open in IMG/M |
3300012924|Ga0137413_10105229 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
3300012925|Ga0137419_11579261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 557 | Open in IMG/M |
3300012927|Ga0137416_10692830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 895 | Open in IMG/M |
3300012971|Ga0126369_12454095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 607 | Open in IMG/M |
3300012971|Ga0126369_12710494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
3300014495|Ga0182015_10000987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 39314 | Open in IMG/M |
3300014501|Ga0182024_11742704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 700 | Open in IMG/M |
3300015052|Ga0137411_1137161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1089 | Open in IMG/M |
3300015193|Ga0167668_1053918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 835 | Open in IMG/M |
3300015371|Ga0132258_10019359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14778 | Open in IMG/M |
3300016371|Ga0182034_10141164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1795 | Open in IMG/M |
3300017924|Ga0187820_1034226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1328 | Open in IMG/M |
3300017927|Ga0187824_10006557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3277 | Open in IMG/M |
3300017927|Ga0187824_10072370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1083 | Open in IMG/M |
3300017937|Ga0187809_10280585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 609 | Open in IMG/M |
3300017959|Ga0187779_11233085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 527 | Open in IMG/M |
3300017961|Ga0187778_10095962 | Not Available | 1839 | Open in IMG/M |
3300017961|Ga0187778_10103880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1768 | Open in IMG/M |
3300017970|Ga0187783_10011390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6536 | Open in IMG/M |
3300017970|Ga0187783_10580869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 811 | Open in IMG/M |
3300017972|Ga0187781_10456324 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300017973|Ga0187780_11277521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 539 | Open in IMG/M |
3300017974|Ga0187777_10147177 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
3300017974|Ga0187777_11285429 | Not Available | 537 | Open in IMG/M |
3300017993|Ga0187823_10051435 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300018058|Ga0187766_10275381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1083 | Open in IMG/M |
3300018062|Ga0187784_11192458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 604 | Open in IMG/M |
3300018085|Ga0187772_10866940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 655 | Open in IMG/M |
3300018431|Ga0066655_10009343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4180 | Open in IMG/M |
3300018433|Ga0066667_10084261 | All Organisms → cellular organisms → Bacteria | 2059 | Open in IMG/M |
3300018468|Ga0066662_10018036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3880 | Open in IMG/M |
3300018482|Ga0066669_11253065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 670 | Open in IMG/M |
3300020170|Ga0179594_10107945 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300020579|Ga0210407_10265730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1338 | Open in IMG/M |
3300020579|Ga0210407_10484700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 967 | Open in IMG/M |
3300020581|Ga0210399_10017780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 5622 | Open in IMG/M |
3300020581|Ga0210399_10481471 | Not Available | 1032 | Open in IMG/M |
3300021088|Ga0210404_10478327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 702 | Open in IMG/M |
3300021171|Ga0210405_10866825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 688 | Open in IMG/M |
3300021358|Ga0213873_10061151 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300021358|Ga0213873_10122568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 764 | Open in IMG/M |
3300021402|Ga0210385_10001028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17638 | Open in IMG/M |
3300021403|Ga0210397_11316692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 561 | Open in IMG/M |
3300021407|Ga0210383_10357326 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300021420|Ga0210394_10061354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3267 | Open in IMG/M |
3300021432|Ga0210384_10008049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 11042 | Open in IMG/M |
3300021432|Ga0210384_10052921 | All Organisms → cellular organisms → Bacteria | 3680 | Open in IMG/M |
3300021444|Ga0213878_10171265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 907 | Open in IMG/M |
3300021474|Ga0210390_10644149 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300021559|Ga0210409_10037894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4587 | Open in IMG/M |
3300021560|Ga0126371_11157012 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300026324|Ga0209470_1089232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1400 | Open in IMG/M |
3300026529|Ga0209806_1150068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 890 | Open in IMG/M |
3300027181|Ga0208997_1005941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1543 | Open in IMG/M |
3300027480|Ga0208993_1005019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2218 | Open in IMG/M |
3300027521|Ga0209524_1000296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7101 | Open in IMG/M |
3300027591|Ga0209733_1002693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4256 | Open in IMG/M |
3300027591|Ga0209733_1101473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 725 | Open in IMG/M |
3300027633|Ga0208988_1117131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 654 | Open in IMG/M |
3300027635|Ga0209625_1000654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 8766 | Open in IMG/M |
3300027727|Ga0209328_10159638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 684 | Open in IMG/M |
3300027853|Ga0209274_10003685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7284 | Open in IMG/M |
3300027867|Ga0209167_10002416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10150 | Open in IMG/M |
3300027869|Ga0209579_10062889 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1965 | Open in IMG/M |
3300027889|Ga0209380_10438099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 765 | Open in IMG/M |
3300031544|Ga0318534_10670646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 587 | Open in IMG/M |
3300031561|Ga0318528_10252353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 946 | Open in IMG/M |
3300031564|Ga0318573_10024378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2762 | Open in IMG/M |
3300031715|Ga0307476_11390113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 511 | Open in IMG/M |
3300031720|Ga0307469_10897841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 820 | Open in IMG/M |
3300031723|Ga0318493_10584163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 622 | Open in IMG/M |
3300031724|Ga0318500_10528348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 594 | Open in IMG/M |
3300031736|Ga0318501_10340459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 805 | Open in IMG/M |
3300031740|Ga0307468_100019225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2965 | Open in IMG/M |
3300031747|Ga0318502_10396250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 821 | Open in IMG/M |
3300031751|Ga0318494_10537188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 682 | Open in IMG/M |
3300031769|Ga0318526_10094035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1192 | Open in IMG/M |
3300031795|Ga0318557_10241625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 827 | Open in IMG/M |
3300032001|Ga0306922_10517549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1271 | Open in IMG/M |
3300032010|Ga0318569_10237048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 847 | Open in IMG/M |
3300032065|Ga0318513_10243829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
3300032067|Ga0318524_10538405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 614 | Open in IMG/M |
3300032068|Ga0318553_10345683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
3300032180|Ga0307471_103109203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 588 | Open in IMG/M |
3300032205|Ga0307472_101384762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 681 | Open in IMG/M |
3300032783|Ga0335079_10017710 | All Organisms → cellular organisms → Bacteria | 8140 | Open in IMG/M |
3300033158|Ga0335077_10611604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1135 | Open in IMG/M |
3300033289|Ga0310914_10893971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.14% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.33% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.94% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.25% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.86% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.47% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.47% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.39% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.39% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.39% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.39% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.39% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.69% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.69% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.69% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.69% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001182 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12668J13544_10010542 | 3300001182 | Forest Soil | MRRVLIGLTVTLLLVVSIGVGVVVARWPCPHPWR* |
JGIcombinedJ26739_1003922812 | 3300002245 | Forest Soil | MRRVLIGLTVTLLLVVSIGVGVVVARWPXPHPWR* |
JGI25388J43891_10259762 | 3300002909 | Grasslands Soil | LSGYDVRMQRLLISIAVTLLLVVSIAVGVAVARWPHLWR* |
Ga0066680_100723493 | 3300005174 | Soil | LSGYDVTMQRLLISIAVTLLLVVSIAVGVAVARWPHLWR* |
Ga0066673_100902882 | 3300005175 | Soil | MSGYDAAMRRVLIGLTVALLLVVSIGVGVVVARWPYSHLWR* |
Ga0066676_102471342 | 3300005186 | Soil | MSGYDALMRRVLIGLTVALLLVVSIGVGVVVARWPCPHLWR* |
Ga0066675_100947942 | 3300005187 | Soil | MSGYDAAMRRVLIGLTVTLLLVLSIGVGVVVARWPCSHLWR* |
Ga0073909_100546092 | 3300005526 | Surface Soil | MRRLLIGLTVTLLVVVSIGVGVAVARWPHPHLWP* |
Ga0070734_100524323 | 3300005533 | Surface Soil | MRRVLIGLTVTLLLVVSIGLGVAVARWPCHHFWR* |
Ga0070731_100593513 | 3300005538 | Surface Soil | MRRVLIGLTVTLLLVVSIGLGVAVARWPCRHFWR* |
Ga0066697_106511482 | 3300005540 | Soil | MRRVLIGLTVTLLLVVSIGVGVVVARWPCSHLWR* |
Ga0070733_1000109710 | 3300005541 | Surface Soil | MMRSMRRVLIGLMLTLLLVVSVSIGVVVARWPLYPHLWP* |
Ga0070733_100209664 | 3300005541 | Surface Soil | MRRLLIGLALTLLLVVSIGVGVTVARWPQPHLWP* |
Ga0066670_104885152 | 3300005560 | Soil | MRRVLIGLTVALLLVVSIGVGVVVARWPYSHLWR* |
Ga0066693_100235752 | 3300005566 | Soil | MRRVLIGLTVTLLLVLSIGVGVVVARWPCSHLWR* |
Ga0066703_104383832 | 3300005568 | Soil | MSGYDALMRRVLIGLTVTLLLVVSIGVGVVVARWPCPHLWR* |
Ga0070761_1000021634 | 3300005591 | Soil | MRSMRRVLIGLTLTLLLLLSVSVGVVVARWPLYPHLWP* |
Ga0070761_100018105 | 3300005591 | Soil | MRRLLIGLTLTLLLIVSIGVGVAVARWPYPHLWP* |
Ga0070761_100155475 | 3300005591 | Soil | MRRLLIGLTVTLLLVVSIGVGVAVARWPLARLWPP* |
Ga0070763_100041083 | 3300005610 | Soil | MRRLMIGITVTLLVVVSIGVGVAVARWPQPHLWP* |
Ga0068856_1000131875 | 3300005614 | Corn Rhizosphere | MRRLLIGLTVTLLLVISIGVGVAVALWPHPHLWR* |
Ga0066903_1005804852 | 3300005764 | Tropical Forest Soil | MRRVLIGFTVTLLVVVSIGVGVAVARWPHPHLWP* |
Ga0066903_1059250141 | 3300005764 | Tropical Forest Soil | MRRVLIGLTVTLLVVVSIGVGVAVARWPRPHLWP* |
Ga0070766_102617781 | 3300005921 | Soil | MSGYDAAMRRVLIGLTVTLLLVVSIGVGVVVARWPCSHLWR* |
Ga0070766_102670212 | 3300005921 | Soil | MRSMRRVLIGLMLTLLLLVSVSIGVVVARWPLYPHLWP* |
Ga0066656_102728752 | 3300006034 | Soil | MRRVLIGLTVTLLLVVSIGVGVVVARWPCPHLWR* |
Ga0070716_1010494122 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGYDAAMRRVLIGLTVTLLLVVSIGVGVVVARWPYPHPWR* |
Ga0070765_1011737562 | 3300006176 | Soil | MRRVALGLTVTVLVLVSIGVGVAVARWPHPFMLP* |
Ga0068871_1010037391 | 3300006358 | Miscanthus Rhizosphere | AAMRRLLIGLTVTLLVVVSIGVGVAVARWPHPHLWP* |
Ga0079221_106797242 | 3300006804 | Agricultural Soil | MPVMRRLLIGLTVTLLLVISIGIGVAVALWPHPHLWR* |
Ga0075433_104427992 | 3300006852 | Populus Rhizosphere | MRRLLIGLTVALLVIVSIGIGVVIALWPHPHLSR* |
Ga0099793_100633133 | 3300007258 | Vadose Zone Soil | MSGYDAAMRRVLIGLTVTLLLVVSIGVGVVVARWPCPHPWR* |
Ga0099829_108994111 | 3300009038 | Vadose Zone Soil | MSGYDAAMRRVLIGLTVTFLLVVSIGVGVVVARWPCPHPWR* |
Ga0105240_104608122 | 3300009093 | Corn Rhizosphere | MRRFLIGLTVTLIVIVSIGVGVAVALLARWGHALFRG* |
Ga0099792_1000009412 | 3300009143 | Vadose Zone Soil | MRRVLIGLTVTLLVVVSIGVGVVVARWPCSHLWR* |
Ga0123355_100310067 | 3300009826 | Termite Gut | VAVILREQLSGYDEAMRRLLIGLTVTLLVVVSIGVGVAIARWPHPHLWP* |
Ga0123355_106659962 | 3300009826 | Termite Gut | GGYDERMRRVLIGLTVTLLVVVSIGVGVAIARWPHLWP* |
Ga0126380_106447102 | 3300010043 | Tropical Forest Soil | MRRLLIGLTVTLLVVVSIGVGVAIARWPHSPFWR* |
Ga0126373_125373162 | 3300010048 | Tropical Forest Soil | MRRVLIGLTVTLLVVVSIGVGVAVARWPHSHLWP* |
Ga0134084_101124032 | 3300010322 | Grasslands Soil | MSGYDAAMRRVLIGLTVALLLVVSIGVGVVVARWPCSHL* |
Ga0126376_103946582 | 3300010359 | Tropical Forest Soil | VRRLLIIVTLVLLLAVSIGVGVAVARWPHFWPRHT* |
Ga0126378_116373222 | 3300010361 | Tropical Forest Soil | MRRVLIGLTVTLLVVVSIGVGVAVARWPHTHLWP* |
Ga0126378_123325001 | 3300010361 | Tropical Forest Soil | MRRVLIGLTVTLLVVVSIGVGVAIARWTHPHLWP* |
Ga0126378_129912392 | 3300010361 | Tropical Forest Soil | MMLAMRRLLIGLTVTLLVVVSSGVGVAIARWPHTRLWP* |
Ga0126381_1007181242 | 3300010376 | Tropical Forest Soil | LSAGWQVYDAAMRRLLIGLTVTLLVVVSIGVGVAVARWPHSHLWP* |
Ga0126381_1011132632 | 3300010376 | Tropical Forest Soil | MMPAMRRLLIGLTVTLLVVVSIGVGVAIARWPHTRLWP* |
Ga0136449_1019523162 | 3300010379 | Peatlands Soil | MQRLLIGLTVTLLVVVSICVGVLVARWPHVHLWP* |
Ga0126383_101278083 | 3300010398 | Tropical Forest Soil | MRSGYDAFMRRLLIGLTVALLLLVSIGVGLAVVRWPCPHRWL* |
Ga0134121_100391072 | 3300010401 | Terrestrial Soil | MMRRLLIGLTVTLLLVISIGVGVAVALWPHPHLWR* |
Ga0137363_100293532 | 3300012202 | Vadose Zone Soil | MSGYDAAMRRVLIGLTVTLLLVVSIGVGVVVARWPCPYPWR* |
Ga0137399_100440274 | 3300012203 | Vadose Zone Soil | MMSGYDGQMRRVLIGLTVTLLLVVSIGVGVAVARWPCPHLWR* |
Ga0137399_101993302 | 3300012203 | Vadose Zone Soil | MRRVLIGLTVTLLLVVSIGVGVVVARWPSSHLWR* |
Ga0137377_100446945 | 3300012211 | Vadose Zone Soil | SRARGGYDAPMRRVLIGLTVTLLLVVSIGVGVVVARWPCPHLWR* |
Ga0137360_102323782 | 3300012361 | Vadose Zone Soil | MRRVLIGLTVTVLLVVSIGVGVVVARWPCSHLWR* |
Ga0137358_109143391 | 3300012582 | Vadose Zone Soil | AMRRVLIGLTVTLLLVVSIGVGVVVARWPCPHPWR* |
Ga0137395_100583083 | 3300012917 | Vadose Zone Soil | RYDAAMRRVLIGLTVTLLLVVSIGVGVVVARWPCSYLWR* |
Ga0137413_101052292 | 3300012924 | Vadose Zone Soil | MRRVLIGLAVTLLVVVSIGVGVVVARWPCSHLWR* |
Ga0137419_115792612 | 3300012925 | Vadose Zone Soil | MRRVLIGLTVALLLVVSIGVGVAVARWPWPHLWR* |
Ga0137416_106928302 | 3300012927 | Vadose Zone Soil | MRRVLIGLTVTLLLVVSIGVGVVVARWPCPYPWR* |
Ga0126369_124540951 | 3300012971 | Tropical Forest Soil | MRRVLIGLTVTLLVVVSIGVGVAVARWPHPHLWP* |
Ga0126369_127104942 | 3300012971 | Tropical Forest Soil | MRSGYDGFMRRLLIGLAVALLLLVSIGVGVAVARWPCPHRWL* |
Ga0182015_1000098713 | 3300014495 | Palsa | MRRVLIGLTLTLLLVVSVGVGVVVARWPLYPHLWP* |
Ga0182024_117427042 | 3300014501 | Permafrost | MRRVLIGLTLALLLVLSVGVGVVVARWPLYPRLWP* |
Ga0137411_11371612 | 3300015052 | Vadose Zone Soil | MSGYDAAMRRVLIGLTVTLLLVLSIGVGVVVARWPCPHPWR* |
Ga0167668_10539182 | 3300015193 | Glacier Forefield Soil | MRRLLIGLTVTLLLVVSICVGVAVARWPQHPHLWP* |
Ga0132258_1001935912 | 3300015371 | Arabidopsis Rhizosphere | MRRVLIGLTVTLLVIVSIGIGVVVALWPHPYLWR* |
Ga0182034_101411643 | 3300016371 | Soil | SGYDAAMRRLLIGLTVTLLVVVSIAVGVAVARWQHPHLWP |
Ga0187820_10342262 | 3300017924 | Freshwater Sediment | MRRLLIGLTVTLLVVVSIGVGVAVARWPYPHLWPWGTPPKF |
Ga0187824_100065572 | 3300017927 | Freshwater Sediment | MRRLLIGLTLTLLLVVSIGVGVAVARWPQHPFLWR |
Ga0187824_100723702 | 3300017927 | Freshwater Sediment | MRRLLIGLTLTLLLLVSIGVGVAVARWPQHPYLWR |
Ga0187809_102805852 | 3300017937 | Freshwater Sediment | MRRLLIGLTVTLLVVVSIGVGVAVARWPYPHLWPWGTP |
Ga0187779_112330851 | 3300017959 | Tropical Peatland | MMAAMRRLLIGLTLALLLVVSIGLGVAVARWHYPHLWP |
Ga0187778_100959623 | 3300017961 | Tropical Peatland | MMSAMRRLLIGVTVALLLVVSIGVGVAVARWRYPHLWP |
Ga0187778_101038802 | 3300017961 | Tropical Peatland | MRRVLIGLTVAVLLLLSIGIGVVVARWPQHPHLWP |
Ga0187783_100113906 | 3300017970 | Tropical Peatland | MRRVLIGLTVVLLLAVSIGVGVAVARWPCRHLWRWPV |
Ga0187783_105808692 | 3300017970 | Tropical Peatland | PDTGGYDVGMRRLLIGLTVTLLVVVSIVVGVAVARWPHPHLWR |
Ga0187781_104563242 | 3300017972 | Tropical Peatland | MMLAMRRLLIGLTVVLLLVVSIGVGVAVARWHLPHVWP |
Ga0187780_112775211 | 3300017973 | Tropical Peatland | GGCQGYDAAMRRLLIGLTVTLLVVVSIGVGVAIARWPHAHLWR |
Ga0187777_101471771 | 3300017974 | Tropical Peatland | GRVMMSAMRRLLIGVTVALLLVVSIGVGVAVARWRYPHLWP |
Ga0187777_112854292 | 3300017974 | Tropical Peatland | CAGCQVMMAAMRRLLIGLTLALLLVVSIGLGVAVARWHYPHLWP |
Ga0187823_100514352 | 3300017993 | Freshwater Sediment | MRRLLIGLTLTVLLLVSIGVGVAVARWPQHPYLWR |
Ga0187766_102753812 | 3300018058 | Tropical Peatland | MSAMRRLLIGVTVALLLVVSIGVGVAVARWRYPHLWP |
Ga0187784_111924581 | 3300018062 | Tropical Peatland | FGRGRSGYDRPMRRVLIGLTVMLLLVVSIGVGVAVARWPYRHLWP |
Ga0187772_108669402 | 3300018085 | Tropical Peatland | MMPAMRRLLIGLTVALLLIASIAVGVAVARWHLARLWP |
Ga0066655_100093434 | 3300018431 | Grasslands Soil | LSGYDVTMQRLLISIAVTLLLVVSIAVGVAVARWPHLWR |
Ga0066667_100842612 | 3300018433 | Grasslands Soil | MSGYDAAMRRVLIGLTVTLLLVLSIGVGVVVARWPCSHLWR |
Ga0066662_100180362 | 3300018468 | Grasslands Soil | LSGYDVRMQRLLISIAVTLLLVVSIAVGVAVARWPHLWR |
Ga0066669_112530652 | 3300018482 | Grasslands Soil | MSGYDAAMRRVLIGLTVALLLVVSIGVGVVVARWPYSHLWR |
Ga0179594_101079452 | 3300020170 | Vadose Zone Soil | MSGYDAAMRRVLIGLTVTLLLVVSIGVGVVVARWPCPHPWR |
Ga0210407_102657302 | 3300020579 | Soil | MSGYDAAMRRVLIGLTVALLLVVSIGVGVAVARWSCPHLWR |
Ga0210407_104847002 | 3300020579 | Soil | MSGYDAAMRRVLIGLTVTLLLVVSIGVGVVVARWPCPLPWR |
Ga0210399_100177805 | 3300020581 | Soil | MMRSMRRVLIGLMLTLLLVVSVSIGVVVARWPRYPHLWP |
Ga0210399_104814712 | 3300020581 | Soil | MMPGMRRVLIGLTVALLLVLSVSIGVVVARWPLYPHLWP |
Ga0210404_104783271 | 3300021088 | Soil | DLVMRRVLIGLTVTLLLVVSIGVGVVVARWPCPHPWR |
Ga0210405_108668252 | 3300021171 | Soil | LVARRSSGYDVVMRRLLIGLTVTLLTVVSITVGVAIARWPHPHLWH |
Ga0213873_100611512 | 3300021358 | Rhizosphere | MMAPMRRVLIGLTVALLLVVSIGLGVAVARWHYPHLWP |
Ga0213873_101225682 | 3300021358 | Rhizosphere | MWVGCWSGYDPAMRRVLIGLTVILLLVISIGVGVVIARWPDRHFWH |
Ga0210385_100010282 | 3300021402 | Soil | MRRLLIGLTVTLLLVVSIGVGVAVARWPLARLWPP |
Ga0210397_113166922 | 3300021403 | Soil | SSGYDAAMRRLLIGLTVTLLVVVSIGVGVAVARWPHPHLWP |
Ga0210383_103573262 | 3300021407 | Soil | MMRGMRRVLIGLVLTLLLVVSVSIGVAVARWPRYPHLWP |
Ga0210394_100613543 | 3300021420 | Soil | MMRSMRRVLIGLMLTLLLLVSVSIGVVVARWPLYPHLWP |
Ga0210384_100080496 | 3300021432 | Soil | MMPGMRRVLIGLTVAVLLVLSVSIGVVVARWPLYPHLWP |
Ga0210384_100529212 | 3300021432 | Soil | MMPGMRRVLIGLTVAMLLVLSVSIGVVVARWPLYPHLWP |
Ga0213878_101712651 | 3300021444 | Bulk Soil | MAPMRRVLIGLTVALLLVISIGLGVAVARWHYPHLWP |
Ga0210390_106441492 | 3300021474 | Soil | MRSMRRVLIGLMLTLLLLVSVSIGVVVARWPLYPHLWP |
Ga0210409_100378945 | 3300021559 | Soil | MRRLLIGLTVALLLVVSIGVGVAVARWPQHALRWH |
Ga0126371_111570122 | 3300021560 | Tropical Forest Soil | LSAGWQVYDAAMRRLLIGLTVTLLVVVSIGVGVAVARWPHSHLWP |
Ga0209470_10892322 | 3300026324 | Soil | MSGYDALMRRVLIGLTVALLLVVSIGVGVVVARWPCPHLWR |
Ga0209806_11500682 | 3300026529 | Soil | MSGYDALMRRVLIGLTVTLLLVVSIGVGVVVARWPCPHLWR |
Ga0208997_10059412 | 3300027181 | Forest Soil | MSGYDATMRRVLIGLTVALLLVVSIGVGVAVARWPCPHPWR |
Ga0208993_10050191 | 3300027480 | Forest Soil | MSGYDATMRRVLIGLTVALLLVVSIGVGVAVARWPCPHLWR |
Ga0209524_10002964 | 3300027521 | Forest Soil | MSGYDAAMRRVLIGLTVALLLLVSIGVGVVVARWPCPHLWR |
Ga0209733_10026935 | 3300027591 | Forest Soil | MSGYDAAMRRVLIGLTVTVLLVVSIGVGVAVARWPCPHLWR |
Ga0209733_11014732 | 3300027591 | Forest Soil | MSGYDAAMRRVLIGLTVTLLLVVSIGVGVVVARWPCPYPWR |
Ga0208988_11171312 | 3300027633 | Forest Soil | MSGYDAAMRRVLIGLTVALLLVVSIGVGVVVARWPCPHLWR |
Ga0209625_10006543 | 3300027635 | Forest Soil | MSGYDAAMRRVLIGLTVTLLLVVSIGVGVVVARWPFPLPWR |
Ga0209328_101596381 | 3300027727 | Forest Soil | MRRLLIGLTVTLLLVVSICVGVAVARWPQHPHLWP |
Ga0209274_100036853 | 3300027853 | Soil | MRSMRRVLIGLTLTLLLLLSVSVGVVVARWPLYPHLWP |
Ga0209167_100024166 | 3300027867 | Surface Soil | MMRSMRRVLIGLMLTLLLVVSVSIGVVVARWPLYPHLWP |
Ga0209579_100628891 | 3300027869 | Surface Soil | PVSYYVAMRRLLIGLTLTLLLVASIGVGVLVARWPSLWP |
Ga0209380_104380992 | 3300027889 | Soil | MRRVLIGLMLTLLLLVSVSIGVVVARWPLYPHLWP |
Ga0318534_106706462 | 3300031544 | Soil | MRGVLIGLTLTLLLAASVGIGIVVARWPLYPHLWP |
Ga0318528_102523531 | 3300031561 | Soil | GYDAAMRRLLIGLTVTLLVVVSIGVGVAIARWPHPHLWP |
Ga0318573_100243781 | 3300031564 | Soil | RSGYDAAMRRLLIGLTVTLLVVVSIGVGVAIARWPHPHLWP |
Ga0307476_113901132 | 3300031715 | Hardwood Forest Soil | MRGVLIGLTLTLLVAVSVGVGIVVARWPLYPHLWP |
Ga0307469_108978411 | 3300031720 | Hardwood Forest Soil | VSGYDVRVQRLLISIAVTLLLVVSIAVGVAVARWPH |
Ga0318493_105841631 | 3300031723 | Soil | YDAAMRGFLLGLTLTLLLLVSVGVGIVVARWPLYPHLWP |
Ga0318500_105283481 | 3300031724 | Soil | GYDSAMRRVLIGLTVALLVVVSIGVGVAVARWRHPHLWP |
Ga0318501_103404592 | 3300031736 | Soil | VLSGSGQGYDLSMRRLLIGLTVTLLVLVSVGVGVAVARWPHAHLWR |
Ga0307468_1000192252 | 3300031740 | Hardwood Forest Soil | MRRLLIGLTVTLLLVVSIGVGVAVARWPQHPHLWP |
Ga0318502_103962501 | 3300031747 | Soil | DAAMRRVLIGLTVALLVVVSIGVGVAVARWPHPHLWP |
Ga0318494_105371882 | 3300031751 | Soil | GRWRSGYDAAMRRLLIGLTVTLVVVVSIGVGVAIARWPHPHLWP |
Ga0318526_100940351 | 3300031769 | Soil | YDAVMRRVLIGLTVTLLVVVSIGVGVAVARWPHPHLWP |
Ga0318557_102416252 | 3300031795 | Soil | YDAAMRRVLIGLTVTLLVAVSIGVGVAVARWPHPHLWP |
Ga0306922_105175491 | 3300032001 | Soil | LTGYDAAMRRLLIGLTVTLLVVVSIGVGVAVARWPHPHLWP |
Ga0318569_102370482 | 3300032010 | Soil | DAAMRRLLIGLTVTLLVVVSIGVGVAIARWPHPHLWP |
Ga0318513_102438292 | 3300032065 | Soil | SAMRRVWIGLTVTLLLVVSIGVGVAVARWTHPHLWP |
Ga0318524_105384051 | 3300032067 | Soil | QLSGYDAAMRRVLIGLTVALLVVVSIGVGVAVARWPHPHLWP |
Ga0318553_103456831 | 3300032068 | Soil | YDAAMRRVLIGLTVTLLVVVSIGVGVAVARWPHPHLWP |
Ga0307471_1031092031 | 3300032180 | Hardwood Forest Soil | SGYDAAMRRVLIGLTVTLLLVVSIGVGVVVARWPYPHPWR |
Ga0307472_1013847621 | 3300032205 | Hardwood Forest Soil | SGYDAAMRRLLIGLTVTLLVVVSIGVGVAVARWPHPHLWP |
Ga0335079_100177108 | 3300032783 | Soil | LRGGYQGYDAAMRRLLIGLTVTLLVVVSIGVGVAIARWPYAHLWR |
Ga0335077_106116041 | 3300033158 | Soil | PEILRGGYQGYDAAMRRLLIGLTVTLLVVVSIGVGVAIARWPYAHLWR |
Ga0310914_108939712 | 3300033289 | Soil | DAAMRRVLIGLTVTLLVVVSIGVGVAVARWPHPHLWP |
⦗Top⦘ |