NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051510

Metagenome / Metatranscriptome Family F051510

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051510
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 45 residues
Representative Sequence QPMRDAVRAAFADVVAEHGSMPRERAEAYLDELETTARYRPDLWG
Number of Associated Samples 132
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.78 %
% of genes near scaffold ends (potentially truncated) 92.36 %
% of genes from short scaffolds (< 2000 bps) 89.58 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.73

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.139 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.222 % of family members)
Environment Ontology (ENVO) Unclassified
(27.778 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.278 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.21%    β-sheet: 0.00%    Coil/Unstructured: 54.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.73
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
c.25.1.4: NADPH-cytochrome p450 reductase-liked1f20a21f200.82818
c.25.1.0: automated matchesd3qfta23qft0.82301
c.23.1.0: automated matchesd6wsha16wsh0.76751
c.23.1.1: CheY-relatedd1s8na_1s8n0.75829
c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domaind1c1da11c1d0.73246


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF00710Asparaginase 5.56
PF16859TetR_C_11 4.86
PF01740STAS 4.17
PF00069Pkinase 2.78
PF00903Glyoxalase 2.08
PF00440TetR_N 2.08
PF01909NTP_transf_2 1.39
PF07286D-Glu_cyclase 1.39
PF00667FAD_binding_1 1.39
PF00384Molybdopterin 1.39
PF00106adh_short 0.69
PF02567PhzC-PhzF 0.69
PF00583Acetyltransf_1 0.69
PF08281Sigma70_r4_2 0.69
PF12680SnoaL_2 0.69
PF01042Ribonuc_L-PSP 0.69
PF09130DUF1932 0.69
PF05721PhyH 0.69
PF00892EamA 0.69
PF01636APH 0.69
PF09990DUF2231 0.69
PF09754PAC2 0.69
PF03435Sacchrp_dh_NADP 0.69
PF12146Hydrolase_4 0.69
PF00067p450 0.69
PF03372Exo_endo_phos 0.69
PF00348polyprenyl_synt 0.69
PF07883Cupin_2 0.69
PF07690MFS_1 0.69
PF01047MarR 0.69
PF01545Cation_efflux 0.69
PF01351RNase_HII 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG0252L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit DTranslation, ribosomal structure and biogenesis [J] 11.11
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 11.11
COG0369Flavoprotein (flavin reductase) subunit CysJ of sulfite and N-hydroxylaminopurine reductasesNucleotide transport and metabolism [F] 1.39
COG4336Uncharacterized conserved protein YcsI, UPF0317/DUF1446 familyFunction unknown [S] 1.39
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.69
COG0142Geranylgeranyl pyrophosphate synthaseCoenzyme transport and metabolism [H] 0.69
COG0164Ribonuclease HIIReplication, recombination and repair [L] 0.69
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.69
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 0.69
COG1039Ribonuclease HIIIReplication, recombination and repair [L] 0.69
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.69
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.69
COG2124Cytochrome P450Defense mechanisms [V] 0.69
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.69
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.14 %
UnclassifiedrootN/A29.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10333652Not Available538Open in IMG/M
3300002907|JGI25613J43889_10000326All Organisms → cellular organisms → Bacteria10680Open in IMG/M
3300004268|Ga0066398_10073421All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300004633|Ga0066395_11009398All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium508Open in IMG/M
3300004961|Ga0072333_1130250Not Available544Open in IMG/M
3300005336|Ga0070680_100871978All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300005337|Ga0070682_100544568All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300005435|Ga0070714_100875844All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300005437|Ga0070710_10460273All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300005439|Ga0070711_100359518All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300005455|Ga0070663_100964440Not Available740Open in IMG/M
3300005530|Ga0070679_101480774Not Available626Open in IMG/M
3300005535|Ga0070684_100028101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4755Open in IMG/M
3300005548|Ga0070665_100122708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2600Open in IMG/M
3300005563|Ga0068855_100902298All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300005578|Ga0068854_102231757All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005899|Ga0075271_10045374All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300005983|Ga0081540_1233972All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300006028|Ga0070717_10417705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1206Open in IMG/M
3300006028|Ga0070717_10509802All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300006028|Ga0070717_10809235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales852Open in IMG/M
3300006163|Ga0070715_10246785Not Available931Open in IMG/M
3300006173|Ga0070716_101753555Not Available513Open in IMG/M
3300006354|Ga0075021_10672863All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300006796|Ga0066665_11104970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales604Open in IMG/M
3300006804|Ga0079221_10386745Not Available861Open in IMG/M
3300006852|Ga0075433_10177905All Organisms → cellular organisms → Bacteria1893Open in IMG/M
3300006953|Ga0074063_14138798All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300007076|Ga0075435_101742476All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300009088|Ga0099830_11581837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M
3300009174|Ga0105241_11450380All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300009520|Ga0116214_1003096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6127Open in IMG/M
3300010043|Ga0126380_10929438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces xiamenensis725Open in IMG/M
3300010046|Ga0126384_10099135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2145Open in IMG/M
3300010048|Ga0126373_13154031All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium513Open in IMG/M
3300010325|Ga0134064_10446768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300010358|Ga0126370_11697583All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300010359|Ga0126376_10780656Not Available930Open in IMG/M
3300010360|Ga0126372_11935044All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300010360|Ga0126372_12647474All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium553Open in IMG/M
3300010361|Ga0126378_13409416All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium504Open in IMG/M
3300010366|Ga0126379_10169306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. URHA00322063Open in IMG/M
3300010366|Ga0126379_13541703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii523Open in IMG/M
3300010373|Ga0134128_13007803All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300010396|Ga0134126_11081386All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria895Open in IMG/M
3300010398|Ga0126383_11550694All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium752Open in IMG/M
3300010398|Ga0126383_12593145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300010398|Ga0126383_12875549Not Available562Open in IMG/M
3300010869|Ga0126359_1068365Not Available979Open in IMG/M
3300010880|Ga0126350_12067981All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium798Open in IMG/M
3300010937|Ga0137776_1317221Not Available594Open in IMG/M
3300012096|Ga0137389_10188159All Organisms → cellular organisms → Bacteria → Terrabacteria group1713Open in IMG/M
3300012202|Ga0137363_10171899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium1719Open in IMG/M
3300012351|Ga0137386_10069738All Organisms → cellular organisms → Bacteria2451Open in IMG/M
3300012359|Ga0137385_10377642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1211Open in IMG/M
3300012927|Ga0137416_10492378All Organisms → cellular organisms → Bacteria → Terrabacteria group1055Open in IMG/M
3300012930|Ga0137407_10030520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4195Open in IMG/M
3300012971|Ga0126369_11178911All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium856Open in IMG/M
3300013104|Ga0157370_10393884All Organisms → cellular organisms → Bacteria1275Open in IMG/M
3300013307|Ga0157372_10741399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1142Open in IMG/M
3300013307|Ga0157372_11477535Not Available783Open in IMG/M
3300014157|Ga0134078_10593000Not Available529Open in IMG/M
3300014166|Ga0134079_10422705All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300016270|Ga0182036_10972803Not Available698Open in IMG/M
3300016294|Ga0182041_11714562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300016319|Ga0182033_11750788Not Available563Open in IMG/M
3300016341|Ga0182035_11846507Not Available548Open in IMG/M
3300016357|Ga0182032_10413261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1094Open in IMG/M
3300016371|Ga0182034_11615295Not Available569Open in IMG/M
3300016387|Ga0182040_10966912Not Available709Open in IMG/M
3300016445|Ga0182038_11074634Not Available714Open in IMG/M
3300017933|Ga0187801_10248459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii714Open in IMG/M
3300017973|Ga0187780_11411635Not Available513Open in IMG/M
3300018060|Ga0187765_10785984All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300018064|Ga0187773_10780420Not Available605Open in IMG/M
3300019789|Ga0137408_1327640All Organisms → cellular organisms → Bacteria3335Open in IMG/M
3300019890|Ga0193728_1097626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1362Open in IMG/M
3300020140|Ga0179590_1175703All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300020579|Ga0210407_10178796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1644Open in IMG/M
3300021088|Ga0210404_10684050Not Available585Open in IMG/M
3300021374|Ga0213881_10163775All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300021405|Ga0210387_11786262Not Available518Open in IMG/M
3300021479|Ga0210410_10657922All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300021560|Ga0126371_10420078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1481Open in IMG/M
3300025464|Ga0208076_1092156Not Available522Open in IMG/M
3300025898|Ga0207692_10605622Not Available705Open in IMG/M
3300025901|Ga0207688_11045180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium516Open in IMG/M
3300025919|Ga0207657_11431591Not Available518Open in IMG/M
3300025929|Ga0207664_10851849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2575819Open in IMG/M
3300025929|Ga0207664_10869068Not Available810Open in IMG/M
3300025929|Ga0207664_11467350Not Available603Open in IMG/M
3300025932|Ga0207690_10119710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1910Open in IMG/M
3300025939|Ga0207665_10656463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium822Open in IMG/M
3300025945|Ga0207679_11972886Not Available532Open in IMG/M
3300026116|Ga0207674_10184945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2034Open in IMG/M
3300026121|Ga0207683_10401621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1261Open in IMG/M
3300026320|Ga0209131_1000265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria37964Open in IMG/M
3300027671|Ga0209588_1237847Not Available559Open in IMG/M
3300027889|Ga0209380_10514942Not Available697Open in IMG/M
3300027908|Ga0209006_11289772Not Available565Open in IMG/M
3300028881|Ga0307277_10013352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3178Open in IMG/M
3300030740|Ga0265460_10407779Not Available996Open in IMG/M
3300031018|Ga0265773_1004690Not Available960Open in IMG/M
3300031170|Ga0307498_10009457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1907Open in IMG/M
3300031543|Ga0318516_10061514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. URHA00322066Open in IMG/M
3300031543|Ga0318516_10422938All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium767Open in IMG/M
3300031561|Ga0318528_10394667All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium743Open in IMG/M
3300031681|Ga0318572_10336574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia894Open in IMG/M
3300031682|Ga0318560_10189351Not Available1097Open in IMG/M
3300031708|Ga0310686_109943360Not Available524Open in IMG/M
3300031708|Ga0310686_112842865Not Available582Open in IMG/M
3300031713|Ga0318496_10217713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1051Open in IMG/M
3300031724|Ga0318500_10351095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia728Open in IMG/M
3300031740|Ga0307468_102567132All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031744|Ga0306918_10932402All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300031751|Ga0318494_10291664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia940Open in IMG/M
3300031765|Ga0318554_10188679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1173Open in IMG/M
3300031765|Ga0318554_10653512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300031769|Ga0318526_10022459All Organisms → cellular organisms → Bacteria2222Open in IMG/M
3300031771|Ga0318546_11255030All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium520Open in IMG/M
3300031779|Ga0318566_10449686All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300031793|Ga0318548_10176648All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1045Open in IMG/M
3300031821|Ga0318567_10469834All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300031833|Ga0310917_10232790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1238Open in IMG/M
3300031846|Ga0318512_10345329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium744Open in IMG/M
3300031859|Ga0318527_10152389Not Available970Open in IMG/M
3300031890|Ga0306925_11613774Not Available630Open in IMG/M
3300031910|Ga0306923_11559070All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium688Open in IMG/M
3300031912|Ga0306921_11068920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia906Open in IMG/M
3300031942|Ga0310916_11736128Not Available504Open in IMG/M
3300031947|Ga0310909_10667724All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300032008|Ga0318562_10829823Not Available528Open in IMG/M
3300032009|Ga0318563_10408305All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300032042|Ga0318545_10343037Not Available538Open in IMG/M
3300032052|Ga0318506_10363144Not Available642Open in IMG/M
3300032054|Ga0318570_10235826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia829Open in IMG/M
3300032068|Ga0318553_10052966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. URHA00322002Open in IMG/M
3300032074|Ga0308173_10988613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia781Open in IMG/M
3300032205|Ga0307472_101240079All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium714Open in IMG/M
3300032261|Ga0306920_101434748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia988Open in IMG/M
3300033134|Ga0335073_11285176All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300033289|Ga0310914_10477502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1128Open in IMG/M
3300034818|Ga0373950_0017230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1243Open in IMG/M
3300034819|Ga0373958_0007751All Organisms → cellular organisms → Bacteria1721Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.22%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.03%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.17%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.08%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.08%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.08%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.08%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.08%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.39%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.39%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.39%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.39%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil1.39%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.39%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.69%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.69%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.69%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.69%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.69%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.69%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.69%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.69%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004961Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 83 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005899Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025464Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300031018Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1033365213300001356Peatlands SoilVRTAFADVLTEHASMPPECAEAYLNKMETSARYRPDLWS*
JGI25613J43889_1000032663300002907Grasslands SoilMRAAVRAAFVDIVAEHGSLPRVRAEAYLDELESTARYRPDLWG*
Ga0066398_1007342113300004268Tropical Forest SoilGYVYVCGSQPMRDAVRAAFIDVVTEHGPVPRERAEAYLQEMETTERYRPDLWV*
Ga0066395_1100939813300004633Tropical Forest SoilGYVYVCGSQPMRDAVRAVFVDVVAEQGSLPRGQAEAYVEELERTTHYRPDLWG*
Ga0072333_113025013300004961Peatlands SoilLVWRLLAADGYVYVCGSQPMRTAVRAAIVDVVAEQRSLPHEPAEAYLQEMEATARYRPDLWG*
Ga0070680_10087197813300005336Corn RhizosphereAMREGVRAAFVDVVAEHGAMPREHAEAYVDELETSEQRYRPDLWG*
Ga0070682_10054456833300005337Corn RhizosphereLRDGVRRAFVDVLEAQGAMPREHAEAYLHELEHTQNRYRPDLWG*
Ga0070714_10087584433300005435Agricultural SoilMRDAVRAAFIDVVTEHGSLPREHAEAYLQEMETTERYRPDLWV*
Ga0070710_1046027333300005437Corn, Switchgrass And Miscanthus RhizosphereVCGSAPVRAGIRAALADVIADRGALPPERAGAYLDELETTARYRPDLWG*
Ga0070711_10035951833300005439Corn, Switchgrass And Miscanthus RhizosphereDAVRAAFTDVIADHGGLARDHAAAYLDELETTARYRPDLWV*
Ga0070663_10096444023300005455Corn RhizosphereVYVCGSQPMRAAVRAAFTDVAAEHGSLPPAQAAAYLDELETTAHYRPDLWG*
Ga0070679_10148077413300005530Corn RhizosphereYVYVCGSQAMRDGVRDAFVDVAAEHGALPREHAEAFVVELEATEQRYRPDLWG*
Ga0070684_10002810113300005535Corn RhizosphereQPMRAAVRAAVTDVAAEHGSLSPGQAAAYLDELEATARYRPDLWG*
Ga0070665_10012270833300005548Switchgrass RhizosphereVTDVAAEHGSLSPGQAAAYLDELEATARYRPDLWG*
Ga0068855_10090229813300005563Corn RhizosphereVYVCGSLPMRDGVRQAFVDVVAEHAPMPREHAEAYLHELEATENRYRPDLWG*
Ga0068854_10223175713300005578Corn RhizosphereIDVVTEHGSLPREHAEAYLQEMETTERYRPDLWV*
Ga0075271_1004537413300005899Rice Paddy SoilQPMREAVRAAFADVVTEHGSLPREHAEAYLHEMETTARYRPDLWG*
Ga0081540_123397233300005983Tabebuia Heterophylla RhizosphereGGYAYVCGSQPMRDAVRAAFIDVATEHGSLPRERAGAYLQELETAERYRPDLWV*
Ga0070717_1041770543300006028Corn, Switchgrass And Miscanthus RhizosphereAEVIADHGALPPERAAAYLDDLETTARYRPDLWG*
Ga0070717_1050980233300006028Corn, Switchgrass And Miscanthus RhizosphereAAVRAALADVIADHGALPPARAAAYLDDLETSARYRPDLWG*
Ga0070717_1080923513300006028Corn, Switchgrass And Miscanthus RhizosphereALAEVIADHGALPPERAAAYLDDLETTARYRPDLWG*
Ga0070715_1024678513300006163Corn, Switchgrass And Miscanthus RhizosphereQPMRQAVRAAIADIVEGHGSLPPAAAEAYVCDLESAARYRPDLWV*
Ga0070716_10175355513300006173Corn, Switchgrass And Miscanthus RhizosphereAVRAAFTDVAAEHGSLLPAQAAAYLDELETTAHYRPDLWG*
Ga0075021_1067286313300006354WatershedsRTAFTDVIAEHGGLARDHAAAYLDELETTARYRPDLWV*
Ga0066665_1110497033300006796SoilAAFTDVIADHGGLARDHAVAYLDELETTARYRPDLWV*
Ga0079221_1038674523300006804Agricultural SoilVCGSQPMRAAVRAAFTDVAAEHGSLPPAQAAAYLDELETTAHYRPDLWG*
Ga0075433_1017790513300006852Populus RhizosphereVRTAFADVIAEHGRLPRDRAEAYLDELETTARYRPDLWG*
Ga0074063_1413879813300006953SoilRDAVRTAFADVIADHGRLPRDRAEAYLDELETTARYRPDLWG*
Ga0075435_10174247633300007076Populus RhizosphereAAVRAEVRAALADVIADHGALPPERAAAYLDDLETTARYRPDLWG*
Ga0099830_1158183733300009088Vadose Zone SoilVYVCGSQPMRDAVRDAFVDVVADHGMRPREHAEAYVRQLETTARYRPDLWG*
Ga0105241_1145038013300009174Corn RhizosphereLDSGAYVYVCGGQALRDGVRRAFVDVLEAHGSMPREHAEAYLHELELTENRYRPDLWG*
Ga0116214_100309683300009520Peatlands SoilMRTAVRAAIVNVVAEQRSLPHEPAEAYLQEMEATARYRPDLWG*
Ga0126380_1092943813300010043Tropical Forest SoilSQPMRDAVRAAFVDVVTERGSLPREHAEAYLHEMETTARYRPDLWG*
Ga0126384_1009913513300010046Tropical Forest SoilAAFVDVVTERGSLPREHAEAYLHEMETTARYRPDLWG*
Ga0126373_1315403133300010048Tropical Forest SoilGYVYVCGSQPMRDAVRAAFADVVTEHGSLPREHADAYLHEMETTARYRPDLWG*
Ga0134064_1044676813300010325Grasslands SoilMRDAVRDAFTDVIADHGGLARDHAAAYLDELETTARYRPDLWV*
Ga0126370_1169758313300010358Tropical Forest SoilAAFTDVIADHGGLPRERAAAYLHELETTTRYRPDLWG*
Ga0126376_1078065633300010359Tropical Forest SoilSQPMRQAVRAAIADVVAEHGPLSRAAAEAYVCDMESAARYRPDLWV*
Ga0126372_1193504433300010360Tropical Forest SoilEGGYVYVCGSQPMRDAVRAVFVDVVAEQGSLPRGQAEAYVEELERTTHYRPDLWG*
Ga0126372_1264747433300010360Tropical Forest SoilEGGYVYVCGSQPMRDAVRAVFVDVVAEQGSLPRVQAEAYVDELERTTHYRPDLWG*
Ga0126378_1340941633300010361Tropical Forest SoilYVCGSQPMRDAVRAAFIDIVTEHGPLPRERAEAYLQEMETTERYRPDLWV*
Ga0126379_1016930613300010366Tropical Forest SoilMRDGVRAAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG*
Ga0126379_1354170323300010366Tropical Forest SoilEAVRDAFVDVAMDHGSLPREHAEAHLAELEATARYRPDLWE*
Ga0134128_1300780313300010373Terrestrial SoilPMRDAVRTAFADVIAEHGRLPRDRAEAYLDELETTARYRPDLWG*
Ga0134126_1108138613300010396Terrestrial SoilMRDGVRAAFVDLIAEHLSISRERAESVLLELETVDNRYRPDLWG*
Ga0126383_1155069423300010398Tropical Forest SoilGYVYVCGSQPMRDAVRAAFVDVVTERGSLPREHAEAYLHEMETTARYRPDLWG*
Ga0126383_1259314533300010398Tropical Forest SoilRAAFVDVAAEHGALPRGQAEAYVDELETTAHYRPDLWG*
Ga0126383_1287554913300010398Tropical Forest SoilEGVREAFVDVVEKHGGMPRHCAEAYLHELETTLQRYRPDLWG*
Ga0126359_106836513300010869Boreal Forest SoilRAAFADVIADHGALPRERAAAYLDELETTARYRPDLWG*
Ga0126350_1206798133300010880Boreal Forest SoilWRLLAADGYVYVCGSQPMRDAVRAAFADVLTGHASMPPEYAQAYLSELETTARYRPDLWS
Ga0137776_131722113300010937SedimentLIDVVTEHGSLPREHAEAYLQEMETAERYRPDLWV*
Ga0137389_1018815913300012096Vadose Zone SoilRAAVRAAFVDIVAEHGSLPRVRAEAYLDELESTARYRPDLWG*
Ga0137363_1017189943300012202Vadose Zone SoilYAYVCGSQPMRDAVRAALIDVVTEHGSLPREHAEAYVQELETTERYRPDLWV*
Ga0137386_1006973813300012351Vadose Zone SoilMRASVRAAFVDVVAEYGSLPREQAEAYIDELETTTRYRPDL
Ga0137385_1037764233300012359Vadose Zone SoilMRASVRAVFVDVVAEYGSLPREQAEAYIDELETTTRYR
Ga0137416_1049237833300012927Vadose Zone SoilVDIVAEHGSLPRVRAEAYLDELESTARYRPDLWG*
Ga0137407_1003052013300012930Vadose Zone SoilAPMRAAVRAALAGVIADHGALASARADAYLDELETTARYRPDLWG*
Ga0126369_1117891123300012971Tropical Forest SoilMRDAVRAAFVDVVADHGSLPHEQAAAYVDELETTTHYRPDLWG*
Ga0157370_1039388443300013104Corn RhizosphereAFVDVVAEHGSLPREHAEGYLLELETIDNRYRPDLWG*
Ga0157372_1074139913300013307Corn RhizosphereQLVWRLLEAGAYVYVCGGQAMRDGVREAFIDVVAECAPMPREHAEAFVENLELRENRYRPDLWG*
Ga0157372_1147753513300013307Corn RhizosphereAYVYVCGGQALRDGVRRAFVDVLEAQGAMPREHAEAYLHELEHTQNRYRPDLWG*
Ga0134078_1059300013300014157Grasslands SoilMRDAVRVAFTDVIADHGGLARDQAVAYLDELETTGRYRPDLWV*
Ga0134079_1042270533300014166Grasslands SoilVCGSQPMRDAVRAAFTDVIADHGGLARDHAAAYLDELETTARYRPDLWV*
Ga0182036_1097280313300016270SoilAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG
Ga0182041_1171456233300016294SoilAFIDVIADHGGVPPEGAAAYLHELESTTRYRPDLWG
Ga0182033_1175078813300016319SoilDAVRTAFADVAAEHGALPHERAAAYVDELEATTRYRPDLWN
Ga0182035_1184650713300016341SoilGGYVYVCGSPAVRESVRAAFVDVVAEHGSLLRRHAEVFLNELDTTARYRSDLWA
Ga0182032_1041326133300016357SoilVRAAFVDVVAEHGSLPRDQAGAYIDELETTTHYRPDLWG
Ga0182034_1161529513300016371SoilYVCGAQPMRDAVRTAFADVAAEHGALPRERAAAYVDELEATNRYRPDLWG
Ga0182040_1096691213300016387SoilCGSQPMRDAVRAAFADVIADHGALPRERAAAYLHELETTARYRPDLWG
Ga0182038_1107463413300016445SoilAVRAAFADVIADHGALPRERAAAYLHELETTTRYRPDLWG
Ga0187801_1024845933300017933Freshwater SedimentCGSAPMRDAVRTAVTDVIAGHGPLPREHAEAYLHELETTARYRPDLWG
Ga0187780_1141163533300017973Tropical PeatlandQPMRDGVRGAFVDVAAEHGRLPHEHAEAHLHELETTARYRPDLWG
Ga0187765_1078598433300018060Tropical PeatlandSPPMRDAVRDVFVDVVADHGSLPREDAEAYLQHLELTARYRPDLWG
Ga0187773_1078042033300018064Tropical PeatlandCGSQPMRDAVRAAFVDVIAQHASLSPERAEAYLDELDKTTRYRPDLWG
Ga0137408_132764073300019789Vadose Zone SoilMRDAVRAAFADVIADHGGLPRDRAAAYLDELETTARYRPDLWG
Ga0193728_109762613300019890SoilFADVIAEHGRLPRDRAEAYLDELETTARYRPDLWG
Ga0179590_117570313300020140Vadose Zone SoilVCGAQPMRDAVRTAFADVIADHGRLPRDRAEAYLDELETTARYRPDLWG
Ga0210407_1017879643300020579SoilYICGSQPIRDAVRAAFADVVAEHGSMPRERAEAYLDELETTARYRPDLWG
Ga0210404_1068405033300021088SoilSQPMRDAVRAAFADVVAEHGSMPRERAEAYLDELETTARYRPDLWG
Ga0213881_1016377533300021374Exposed RockEAVRAAFADVVAEGTGLTHERAQAYLDRMETTTRYRPDLWA
Ga0210387_1178626213300021405SoilQPMRDAVRAAFADVVAEHGSMPRERAEAYLDELETTARYRPDLWG
Ga0210410_1065792213300021479SoilRAAFTDVIADHGGLPRDRAAAYLDELETTARYRPDLWV
Ga0126371_1042007833300021560Tropical Forest SoilCGSQPVRDAVHAAFTDVIAEQGSLPREHAEAYLHELETTTHYRPDLWG
Ga0208076_109215633300025464Arctic Peat SoilSQPMRTAVREAFTDVVAEHGSLPREQAEAFLLELENTTRYRPDLWG
Ga0207692_1060562213300025898Corn, Switchgrass And Miscanthus RhizosphereSAPVRAGIRAALADVIADRGALPPERAGAYLDELETTARYRPDLWG
Ga0207688_1104518013300025901Corn, Switchgrass And Miscanthus RhizosphereAFVDVIAEHGTMPSAGAETLLAELEKAGRYRPDLWG
Ga0207657_1143159133300025919Corn RhizosphereAYVYVCGGQAMRDGVRRAFVDVVEANGSMPREHAEAYLHELEHTQNRYRPDLWG
Ga0207664_1085184933300025929Agricultural SoilAVRAALADVIADHGALPPARAAAYLDELETSARYRPDLWG
Ga0207664_1086906813300025929Agricultural SoilALAEVIADHGALPPERAAAYLDDLETTARYRPDLWG
Ga0207664_1146735013300025929Agricultural SoilCGSQPMRTAVRAAFTDVAAEHGSLLPAQAAAYLDELETTAHYRPDLWG
Ga0207690_1011971043300025932Corn RhizosphereMRDGVREAFVDIVADHGAMPVEHAEAYLHELELTENRYRPDLWG
Ga0207665_1065646333300025939Corn, Switchgrass And Miscanthus RhizosphereYVCGGQALRDGVRRAFVDVLEAHGSMPREHAEAYLHELEHTQNRYRPDLWG
Ga0207679_1197288633300025945Corn RhizosphereMRDGVRRAFVDVVEANGSMPREHAEAYLHELEHTQNRYRPDLWG
Ga0207674_1018494543300026116Corn RhizosphereGSAAVRAEVRAALADVIADHGALPPERAAAYLDDLETTARYRPDLWG
Ga0207683_1040162113300026121Miscanthus RhizosphereDAVRAAFIDVVTEHGSLPREHAEAYLQEMETTERYRPDLWV
Ga0209131_1000265153300026320Grasslands SoilMRAAVRAAFVDIVAEHGSLPRVRAEAYLDELESTARYRPDLWG
Ga0209588_123784713300027671Vadose Zone SoilPMRAAVRAAFVDIVAEHGSLPRVRAEAYLDELEATARYRPDLWG
Ga0209380_1051494233300027889SoilDAVRAAFVDVIAEHGSMPREHAGAYLHELETTARYRPDLWG
Ga0209006_1128977223300027908Forest SoilAVRAAFADVLTEHASMPPECAEAYLHKLETTARYRPDLWS
Ga0307277_1001335213300028881SoilFANVIAEHGRLPRDRAEAYLDELETTARYRPDLWG
Ga0265460_1040777933300030740SoilFVDVIAHQGALPREHAEAYLADMETTARYRPDLWG
Ga0265773_100469033300031018SoilPMRDAVRDAFVDVIAEYGSMPREHAETYLHELETTTRYRPDLWG
Ga0307498_1000945743300031170SoilYVCGSQPMRDAVRAALIDIVTEHGSLPHEHAEAYLQEMETAERYRPDLWV
Ga0318516_1006151443300031543SoilVYVCGSQPVRDAVRAAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG
Ga0318516_1042293823300031543SoilMRDAVRAAFVDVVAEQGSLPRDQAGAYLHELETTTHYRPDLWG
Ga0318528_1039466713300031561SoilGYVYVCGSQPMRDNVFEAFVDVVSKHGSRSHEDAEAYMRELETAKDRYRPDLWG
Ga0318572_1033657413300031681SoilTAEGYVYVCGSQPMRDAVRAAFVDVVAEHGSLPRDQAGAYIDELETTTHYRPDLWG
Ga0318560_1018935143300031682SoilCGSQPVRDAVRAAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG
Ga0310686_10994336033300031708SoilGSQPMRDAVRAAFVDVIAEHGSMPRQHAEAYLHELETTARYRPDLWG
Ga0310686_11284286523300031708SoilSQSMRDAVRAAFVDVVTQHGLLPRQHSEAYLSELETTERYRPDLWI
Ga0318496_1021771333300031713SoilTAEGYVYVCGSQPMRDAVRAAFVDVVAEHGPLPRGQAEAYLDELETTTHYRPDLWG
Ga0318500_1035109533300031724SoilSQPMRDAVRAAFVDVVAEHGPLPRGQAEAYLDELETTTHYRPDLWG
Ga0307468_10256713233300031740Hardwood Forest SoilPMRDAVRTAFADVIAEHGRLPRDRAEAYLDELETTARYRPDLWG
Ga0306918_1093240213300031744SoilVRAAFADVIADQAPMPRDCAAAYLDQLETTERYRPDLWG
Ga0318494_1029166413300031751SoilPMRDAVRAAFVDVVAEHGSLPRGRAEAYIDELETTAHYRPDLWG
Ga0318554_1018867913300031765SoilAVRVAFAEVAAEHGALPGERAAAYVDELEATNRYRPDLWG
Ga0318554_1065351233300031765SoilSQPMRDAVRAAFVDVVAEHGSLPRGRAEAYIDELETTAHYRPDLWG
Ga0318526_1002245913300031769SoilVYVCGSQPMRDAVRAAFVDVVAEHGSLPRDQAGAYIDELETTTHYRPDLWG
Ga0318546_1125503033300031771SoilVYVCGSQPMRDAVRAAFIDVIADQGGLPPERAAACLHELESTTRYRPDLWG
Ga0318566_1044968613300031779SoilYVCGSQPMRDAVRAAFTDVIADHGALPRERAEAYLDELETTARYRPDLWG
Ga0318548_1017664823300031793SoilVREAVRDAFVDVAAEHGPLPRERASEYLSELERTARYRPDLWG
Ga0318567_1046983433300031821SoilYVCGAQPMRNAVRAAFTDVIADHGGLLRERAAAYLHELETTARYRPDLWG
Ga0310917_1023279033300031833SoilSQPMRDAVRAAFVDVVAEHGSLPRDQAGAYIDELETTTHYRPDLWG
Ga0318512_1034532913300031846SoilHRLRAAVRAALIDVVTEDGSLPREHAEAYLQEMETAERYRPDLWV
Ga0318527_1015238913300031859SoilVCGSQPVREAVRAAFVDVAAEHGSLPRERAEAFLGRLETTTRYRPDLWG
Ga0306925_1161377413300031890SoilYVCGAQPMRDAVRTAFTDVIADHGALPRERAAAYLHELETTARYRPDLWG
Ga0306923_1155907013300031910SoilVCGSQPVRDAVRAAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG
Ga0306921_1106892033300031912SoilVCGSQPMRDAVRAAFVDVVAEHGPLPRGQAEAYLDELETTTHYRPDLWG
Ga0310916_1173612833300031942SoilQPMRDAVRAAFADVIADHGALPRERAAAYLHELETTARYRPDLWG
Ga0310909_1066772433300031947SoilDAVRAAFTDVIADHGALPRERAEAYLDELETTARYRPDLWG
Ga0318562_1082982313300032008SoilAFVDVAAEHGPLPRERASEYLSELERTARYRPDLWG
Ga0318563_1040830533300032009SoilQPMRDAVCDAFTDVVAEHGSMPREHAEAYLQQLELTTRYRPDLWG
Ga0318545_1034303713300032042SoilAAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG
Ga0318506_1036314433300032052SoilRTAFTDVIADHGALPRERAAAYLHELETTARYRPDLWG
Ga0318570_1023582613300032054SoilQPMRDAVRAAFVDVVAEHGSLPRGRAEAYIDELETTAHYRPDLWG
Ga0318553_1005296643300032068SoilYVCGSQPVRDAVRAAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG
Ga0308173_1098861313300032074SoilPAAVRAEVRAALADVIADHGALPPERAAAYLDDLETTARYRPDLWG
Ga0307472_10124007923300032205Hardwood Forest SoilMRDAVRAAFTDVITEHGALPRERAAAYLHELESTTRYRPDLWG
Ga0306920_10143474833300032261SoilAEGYVYVCGSQPMRDAVRAAFVDVVAEHGSLPRGRAEAYIDELETTAHYRPDLWG
Ga0335073_1128517613300033134SoilVCGSQPMRDAVRTAFTSVIAEHGGLPRERAAAYLHELETTTRYRPDLWG
Ga0310914_1047750213300033289SoilALIDVVTEHGPLPREHAEAYLQEMETAERYRPDLWV
Ga0373950_0017230_1135_12423300034818Rhizosphere SoilFIDVVTEHGSLPREHAEAYLQEMETTERYRPDLWV
Ga0373958_0007751_1566_16973300034819Rhizosphere SoilMRDAVRTAFADVIADHGRLPRDRAEAYLDELETTARYRPDLWG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.