NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F052044

Metagenome / Metatranscriptome Family F052044

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052044
Family Type Metagenome / Metatranscriptome
Number of Sequences 143
Average Sequence Length 127 residues
Representative Sequence MADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLTR
Number of Associated Samples 123
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 77.62 %
% of genes near scaffold ends (potentially truncated) 33.57 %
% of genes from short scaffolds (< 2000 bps) 89.51 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.301 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.476 % of family members)
Environment Ontology (ENVO) Unclassified
(26.573 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(51.049 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 57.03%    β-sheet: 1.56%    Coil/Unstructured: 41.41%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 143 Family Scaffolds
PF01717Meth_synt_2 2.10
PF02796HTH_7 2.10
PF04392ABC_sub_bind 1.40
PF08042PqqA 0.70
PF03401TctC 0.70
PF13410GST_C_2 0.70
PF13379NMT1_2 0.70
PF12680SnoaL_2 0.70
PF06147DUF968 0.70
PF13011LZ_Tnp_IS481 0.70
PF01243Putative_PNPOx 0.70
PF13565HTH_32 0.70
PF12728HTH_17 0.70
PF08327AHSA1 0.70
PF06537DHOR 0.70
PF00589Phage_integrase 0.70
PF00005ABC_tran 0.70
PF10711DUF2513 0.70
PF08448PAS_4 0.70
PF03090Replicase 0.70
PF00701DHDPS 0.70
PF13936HTH_38 0.70
PF13683rve_3 0.70
PF12850Metallophos_2 0.70
PF07883Cupin_2 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 143 Family Scaffolds
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 2.10
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.40
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.40
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.70
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 0.70

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.30 %
UnclassifiedrootN/A0.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_104073150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4686Open in IMG/M
3300002461|AADWTP_10004855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium76879Open in IMG/M
3300002461|AADWTP_10007120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria16044Open in IMG/M
3300002461|AADWTP_10041071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4342Open in IMG/M
3300004153|Ga0063455_100928899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4620Open in IMG/M
3300004157|Ga0062590_101017427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4789Open in IMG/M
3300004463|Ga0063356_104668665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4589Open in IMG/M
3300004481|Ga0069718_14525874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4522Open in IMG/M
3300005045|Ga0071328_175147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth42498Open in IMG/M
3300005093|Ga0062594_100940873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4822Open in IMG/M
3300005332|Ga0066388_103041373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4857Open in IMG/M
3300005341|Ga0070691_10584805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4657Open in IMG/M
3300005345|Ga0070692_11398203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4505Open in IMG/M
3300005365|Ga0070688_100844523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4719Open in IMG/M
3300005441|Ga0070700_101500514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4573Open in IMG/M
3300005455|Ga0070663_100959187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4742Open in IMG/M
3300005456|Ga0070678_101692673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4595Open in IMG/M
3300005466|Ga0070685_11466073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4525Open in IMG/M
3300005544|Ga0070686_101353867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4596Open in IMG/M
3300005843|Ga0068860_101919501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4614Open in IMG/M
3300006038|Ga0075365_11105318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4558Open in IMG/M
3300006042|Ga0075368_10235461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4780Open in IMG/M
3300006047|Ga0075024_100531047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4622Open in IMG/M
3300006048|Ga0075363_100818941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4567Open in IMG/M
3300006051|Ga0075364_10238624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41235Open in IMG/M
3300006178|Ga0075367_10442268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4824Open in IMG/M
3300006196|Ga0075422_10210508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4803Open in IMG/M
3300006800|Ga0066660_11042207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4654Open in IMG/M
3300006844|Ga0075428_101666893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4666Open in IMG/M
3300006844|Ga0075428_102677885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4508Open in IMG/M
3300006881|Ga0068865_101839504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4548Open in IMG/M
3300006969|Ga0075419_10012339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5276Open in IMG/M
3300007004|Ga0079218_10691393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4954Open in IMG/M
3300009094|Ga0111539_10681306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41197Open in IMG/M
3300009094|Ga0111539_11543471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4770Open in IMG/M
3300009098|Ga0105245_12917549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4530Open in IMG/M
3300009100|Ga0075418_12841864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4529Open in IMG/M
3300009101|Ga0105247_10540028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4855Open in IMG/M
3300009101|Ga0105247_11348021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4575Open in IMG/M
3300009148|Ga0105243_11905624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4627Open in IMG/M
3300009156|Ga0111538_10208299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth42479Open in IMG/M
3300009156|Ga0111538_10783883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41207Open in IMG/M
3300009156|Ga0111538_11754594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4782Open in IMG/M
3300009156|Ga0111538_11766500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4779Open in IMG/M
3300009156|Ga0111538_11898900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4749Open in IMG/M
3300009162|Ga0075423_10401170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41439Open in IMG/M
3300009609|Ga0105347_1296808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4677Open in IMG/M
3300009678|Ga0105252_10065856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41400Open in IMG/M
3300009792|Ga0126374_11113023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4627Open in IMG/M
3300009803|Ga0105065_1076932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4523Open in IMG/M
3300010037|Ga0126304_10302590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41059Open in IMG/M
3300010039|Ga0126309_10876170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4593Open in IMG/M
3300010047|Ga0126382_10886499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4770Open in IMG/M
3300010360|Ga0126372_10380525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41279Open in IMG/M
3300010362|Ga0126377_11853387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4679Open in IMG/M
3300010373|Ga0134128_12235499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4603Open in IMG/M
3300010375|Ga0105239_12971815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4553Open in IMG/M
3300010400|Ga0134122_12719574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4547Open in IMG/M
3300010401|Ga0134121_10900006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4859Open in IMG/M
3300010401|Ga0134121_11654069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4662Open in IMG/M
3300010403|Ga0134123_11992356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4639Open in IMG/M
3300011445|Ga0137427_10027892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2217Open in IMG/M
3300012225|Ga0137434_1061132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4585Open in IMG/M
3300012898|Ga0157293_10178578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4623Open in IMG/M
3300012902|Ga0157291_10285249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4565Open in IMG/M
3300012922|Ga0137394_11249385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4606Open in IMG/M
3300012924|Ga0137413_10358612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41037Open in IMG/M
3300012925|Ga0137419_10811780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4766Open in IMG/M
3300012929|Ga0137404_11356049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4656Open in IMG/M
3300012940|Ga0164243_10306879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41138Open in IMG/M
3300012944|Ga0137410_11085357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4685Open in IMG/M
3300012955|Ga0164298_10088841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1606Open in IMG/M
3300012955|Ga0164298_11571439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4517Open in IMG/M
3300012957|Ga0164303_10265671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4992Open in IMG/M
3300012957|Ga0164303_11219676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4551Open in IMG/M
3300012958|Ga0164299_10592926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4756Open in IMG/M
3300012960|Ga0164301_11229112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4603Open in IMG/M
3300012961|Ga0164302_10201361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41225Open in IMG/M
3300012984|Ga0164309_10368960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41060Open in IMG/M
3300012984|Ga0164309_10809096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4755Open in IMG/M
3300012985|Ga0164308_10688789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4880Open in IMG/M
3300012986|Ga0164304_10762214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4742Open in IMG/M
3300012987|Ga0164307_10216405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41315Open in IMG/M
3300012988|Ga0164306_10441909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4987Open in IMG/M
3300012989|Ga0164305_11533948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4592Open in IMG/M
3300013073|Ga0164283_1007092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3413Open in IMG/M
3300013297|Ga0157378_10457117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41268Open in IMG/M
3300013308|Ga0157375_10506411Not Available1371Open in IMG/M
3300014325|Ga0163163_10330375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41579Open in IMG/M
3300014325|Ga0163163_12122756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4621Open in IMG/M
3300014745|Ga0157377_10707448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4732Open in IMG/M
3300014968|Ga0157379_10440122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41202Open in IMG/M
3300014969|Ga0157376_11994420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4618Open in IMG/M
3300015077|Ga0173483_10749885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4557Open in IMG/M
3300015200|Ga0173480_10698027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4636Open in IMG/M
3300015242|Ga0137412_10635009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4804Open in IMG/M
3300015371|Ga0132258_13564320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41065Open in IMG/M
3300015372|Ga0132256_103108562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4558Open in IMG/M
3300015373|Ga0132257_102709511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4646Open in IMG/M
3300015374|Ga0132255_101055800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41220Open in IMG/M
3300015374|Ga0132255_104703791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4578Open in IMG/M
3300017652|Ga0182746_1184010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4687Open in IMG/M
3300017653|Ga0180215_1054182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2125Open in IMG/M
3300018051|Ga0184620_10345022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4505Open in IMG/M
3300018072|Ga0184635_10313109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4612Open in IMG/M
3300018083|Ga0184628_10083796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41629Open in IMG/M
3300018422|Ga0190265_11470549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4795Open in IMG/M
3300018422|Ga0190265_13294528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4539Open in IMG/M
3300018429|Ga0190272_10554462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4993Open in IMG/M
3300018429|Ga0190272_10741570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4892Open in IMG/M
3300018465|Ga0190269_11006682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4630Open in IMG/M
3300018466|Ga0190268_12163771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4519Open in IMG/M
3300018469|Ga0190270_10869415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4916Open in IMG/M
3300018469|Ga0190270_12342784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4595Open in IMG/M
3300018476|Ga0190274_11251192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4827Open in IMG/M
3300019377|Ga0190264_11103416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4647Open in IMG/M
3300019377|Ga0190264_11317876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4611Open in IMG/M
3300019377|Ga0190264_12346826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4502Open in IMG/M
3300020592|Ga0180222_1000252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales88732Open in IMG/M
3300021080|Ga0210382_10550012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4512Open in IMG/M
3300025935|Ga0207709_11832545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4505Open in IMG/M
3300026075|Ga0207708_11890554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4523Open in IMG/M
3300026089|Ga0207648_10970072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4795Open in IMG/M
3300026118|Ga0207675_100682314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41035Open in IMG/M
3300027640|Ga0209347_1006583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria10199Open in IMG/M
(restricted) 3300027730|Ga0247833_1023701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4317Open in IMG/M
3300027866|Ga0209813_10314902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4611Open in IMG/M
3300027880|Ga0209481_10015160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3354Open in IMG/M
3300027909|Ga0209382_10005544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae16417Open in IMG/M
3300027915|Ga0209069_10565530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4650Open in IMG/M
(restricted) 3300028044|Ga0247838_1306045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4515Open in IMG/M
3300028379|Ga0268266_11396554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4676Open in IMG/M
3300028381|Ga0268264_11662246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4649Open in IMG/M
3300028792|Ga0307504_10258952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4640Open in IMG/M
3300031152|Ga0307501_10152571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4629Open in IMG/M
3300031228|Ga0299914_10356088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth41283Open in IMG/M
3300031547|Ga0310887_10959483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4544Open in IMG/M
3300031652|Ga0315553_10016309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4836Open in IMG/M
3300031716|Ga0310813_10625571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4955Open in IMG/M
3300031740|Ga0307468_102146805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4539Open in IMG/M
3300032180|Ga0307471_101218239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4917Open in IMG/M
3300032205|Ga0307472_101914235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4592Open in IMG/M
3300034773|Ga0364936_136331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. NDB2Meth4501Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.49%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.20%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere4.20%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.50%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Freshwater2.10%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.10%
CompostEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost2.10%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.10%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.10%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.40%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.40%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.40%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.40%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.70%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.70%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.70%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.70%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.70%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.70%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface0.70%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.70%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.70%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.70%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002461Freshwater microbial communities from a drinking water treatment plant in Ann Arbor, Michigan, USAEnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005045Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USAEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009803Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012940Organic Plus compost microbial communities from Emeryville, California, USA - Original compost - Organic plus compost (OP)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013073Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 5th pass 37_C Kraft OP (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017652Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 30_C BE-Lig OP (version 2)EnvironmentalOpen in IMG/M
3300017653Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 3rd pass 37_C BE-Lig BY (version 2)EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020592Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C Kraft OP (version 2)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027640Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/23 (SPAdes)EnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028044 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15mEnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031652Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034773Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10407315013300000956SoilMADAERLEKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDAAEVFSLITLGFLGLFADPADPEAAAFIQHSLDRQDNPRFQEGAAAGGT
AADWTP_10004855513300002461FreshwaterMVDADRLGKIASIGQDLITTQLTMAMETPSQAFESGWVLGYCFGVFDALAQHAELNDDDDVFSLITLGLLGLFADPGDPEAAMFVRRSLDYQDNPRFQEGAAAGGGDVFVWIADRAKPPKALFERLNQ*
AADWTP_10007120173300002461FreshwaterMVDAERLGKIASIGQDLITTQLAMAMETPSQALESGWVLGYCFGVFDALAQQAQLEDDDDVFSLITLGFLGLFAAPADPEAAMFVRRSLAYQDNPRFQEGAAAGGSDVFVWIADRAMAPKALLEQFNR*
AADWTP_1004107113300002461FreshwaterMVDADRLGKIASIGQDLITTQLTMAMQTPSQALESGWVLGYCFGVFDALAQETELDDDDGVFSLITLGFLGLFADPADPEATMFVRRSLEYQDNPRFQEGAAAGGGDVFVWIADRAK
Ga0063455_10092889913300004153SoilMADADRLGKIASIGQDLITTQLAMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDAADSFSLVTLGFLGLFADPADPEAAAFIQHSLDRQDNPRFQEGATAGGTDVFAWAADRTKAPNALFEHLIQ*
Ga0062590_10101742723300004157SoilMADADRSGKIASIGQDLITTQLTMAMQTPSQALEGGWVLGYCFGIFDALAQRAELDDGAETFSLVTLGFLGLFADPADPEAAMFVRRSLDQQENPRFQEGAAAGGNDVFVWVADRAKAPKALFEHLNR*
Ga0063356_10466866523300004463Arabidopsis Thaliana RhizosphereMADADRLGKIASIGQDLITTQLTMATQTPSQALEATWVLGYCFGVFDALAQRADLDDAAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKAPKALFEHLNR*
Ga0069718_1452587413300004481SedimentMVDADRLGKIASIGQDLITTQLTMAMETPSQALESGWVLGYCFGVFDALAQQAELDDDDDVFSLITLGFLGLFADPADPEAAMFVRRSLHYQDNPHFQEGAAAGGSDVFVWIADRAKAPKALFEQLNR*
Ga0071328_17514723300005045PermafrostMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRADLDDGGEGFSLITLGFVGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGSDVFVWVADRAKAPNALFEHLTR*
Ga0062594_10094087323300005093SoilMADADRLEKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLNSQDSPRFQEGAAAGGTDVF
Ga0066388_10304137323300005332Tropical Forest SoilMADADRIGKVASIGQDLITTQLTMATQSPSQALEGTWVLGYCFGVFDALAQQAGFDDGAEGFSLITIGFLGLFADPADPEAAAFVRRSLESQDNSRFQEGAAAGGSDVFVWVADRAKIPNALFEHLTR*
Ga0070691_1058480513300005341Corn, Switchgrass And Miscanthus RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLNSQDSPRFQEGAAAGGTDVFVWVADRAKAPKALFEHLTR*
Ga0070692_1139820313300005345Corn, Switchgrass And Miscanthus RhizosphereMADAERLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAARFVRRSLDSQDNPRFQEGAAAGGTDVFAWVADRTKAPNALFEHL
Ga0070688_10084452323300005365Switchgrass RhizosphereMADADRLEKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRANLDDAAEGFSLITLGFLGLFADPADPEATGFLRRSLDSQDNPRFQEGAAAGG
Ga0070700_10150051413300005441Corn, Switchgrass And Miscanthus RhizosphereMADEDRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGTFDALAQQANLDDAAEGFNLITLGFLGLFADPADPEAAAFIRHSLDRQDNPRFQEGAAAGGTDVFAWVDDRAKAPNALFEHLTR*
Ga0070663_10095918713300005455Corn RhizosphereMTDADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRANLDDAAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDSPRFQEGAAAGGTDVFVWVADRAKAPKALFEHLTR*
Ga0070678_10169267323300005456Miscanthus RhizosphereMADADRLEKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFVW
Ga0070685_1146607313300005466Switchgrass RhizosphereMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAAAFIQHSLDRQDNPRFQEGAAAGGNDVFVWVADRAKAPSALFEHLTDDLGARPVAH*
Ga0070686_10135386713300005544Switchgrass RhizosphereMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKAPKALFEHLNR*
Ga0068860_10191950113300005843Switchgrass RhizosphereMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRAELDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLTR*
Ga0075365_1110531823300006038Populus EndosphereMADADRLGKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQQAEVDEAETFSLITLGFLGLFADPADPEAAAFIQHSLDRQDNPRFQEGAAAGGTDVF
Ga0075368_1023546113300006042Populus EndosphereMADADRLGKIASIGQDLITTQLAMAMQTPSQALEGSWVLGYCFGVFDALAQQAELDDGAEGFSLITLGFLGLFADPADPEAAMFVRRSLDGQDNPRFQEGAAAGGNDVFVWVADRAKAPKALFEHLNR*
Ga0075024_10053104713300006047WatershedsSALARTGSFVLSLHRSGPNPARFFCRGQRFASLLARGPATMVDAERLGKIASIGQDLITTQLTMAMETPSQALESGWVLGYCFGVFDALAQQAELDDDDDVFSLITLGFLGLFADPADPEAAMFVRRSLDYQDNPRFQEGAAAGGSDVFVWIADRAKAPKALFEQLNR*
Ga0075363_10081894123300006048Populus EndosphereMADADRLGKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQQADLDDGTETFSLITLGFLGLFADPADPEAAAFIQHSLDRQDNPRFQEGAAAGGTDVFVWIADRAKAPNALFEHLTR*
Ga0075364_1023862423300006051Populus EndosphereMADADRLGKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQQAEVDEAETFSLITLGFLGLFADPADPEAAAFIQHSLDRQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLTR*
Ga0075367_1044226823300006178Populus EndosphereTQLAMAMQTPSQALEGSWVLGYCFGVFDALAQQAELDDGAEGFSLITLGFLGLFADPADPEAAMFVRRSLDGQDNPRFQEGAAAGGNDVFVWVADRAKAPKALFEHLNR*
Ga0075422_1021050813300006196Populus RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFEHLTR*
Ga0066660_1104220723300006800SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADIDHAADGFSLITLGFVGLFADPTDPEAAAFVRRSLDSQDNPRFQEGATAGGTDVFVWAADRAKAPTALFEHLTR*
Ga0075428_10166689323300006844Populus RhizosphereMADADRLGKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQRAALDDAAEGFSLITLGFLGLFADPTDPEAAAFVRRSLDSQDNPRFQEGATAGGTDVFVWAADRTKVPAALLEHLTR*
Ga0075428_10267788513300006844Populus RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADIDDGTEGFSLITLGFLGLFADPADPEAAAFVRRSLDRQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFEHLTR*
Ga0068865_10183950413300006881Miscanthus RhizosphereMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRAELDDGAEGFSLITLGFLGLFADPADPEAAMFVRRSLEGQDNPRFQEGAAAGGNDVFVSVADRAKAPRALFEHLTR*
Ga0075419_1001233923300006969Populus RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADIDDGTEGFSLITLGFLGLFADPADPEAAALVRRSLDRQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFEHLTR*
Ga0079218_1069139323300007004Agricultural SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRANLDDAAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGNDVFVWAADRAKAPNALFEHLTR*
Ga0111539_1068130613300009094Populus RhizosphereMADADRLGKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQQADIDDAADGFSLITLGFVGLFADPTDPEAAASIRRSLDSQDNPRFQEGATAGGTDVFVWAADRAKAPTALFEHLTR*
Ga0111539_1154347113300009094Populus RhizosphereMTDAEHLEKIASIGQDLITTQLTMATQTPSQALEGGWVLGYCYAVFDALAQHAGLDAGADSFTLLTLGFLGLFADPTDPEAARFVRRSLESQDSPRFQEGAAAGGVDVFAWIADRTKAPNALFEHLTQSTKNRA*
Ga0105245_1291754913300009098Miscanthus RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRANLDDAAEGFSLITLGFLGLFADPADPEATGFLRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAK
Ga0075418_1284186413300009100Populus RhizosphereMTDAEHLEKIASIGQDLITTQLTMATQTPSQALEGGWVLGYCYAVFDALAQHAGLDAGADSFTLLTLGFLGLFADPTDPEAARFVRRSLESQDSPRFQEGAAAGGVDVFAWIADRTKAPNALFEHLTQSTKNGA*
Ga0105247_1054002813300009101Switchgrass RhizospherePTIADADRLVKIASIGQDLITTQLTMAAQTPSQALEGSWVLGYCLGTFDALAQQAGLDDGTEGFSLITLGIIGLFADPADPEAAAFVRHSLDRQDNPRFQEGAAAGGTDVFAWVADRTKAPNALFDHLTR*
Ga0105247_1134802113300009101Switchgrass RhizosphereMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFAWVADRTKAPNALFEHLTR*
Ga0105243_1190562413300009148Miscanthus RhizosphereISGYPRHFSQKVSPTMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAAGFVRRSLDSQDNPRFQEGAAAGGTDVFVWAADRAKVPNALFEHLTR*
Ga0111538_1020829913300009156Populus RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDAGAEGSSLITLGFLGLFADPTDPEAAAFIRRSLDSQDNPRFQEGAAAGGTDVFAWVADRAKVPNALFEHLTR*
Ga0111538_1078388313300009156Populus RhizosphereKMADADRLGKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQRAALDDAAEGFSLITLGFLGLFADPTDPEAAAFVRRSLDSQDNPRFQEGATAGGTDVFVWAADRTKVPAALFEHLTR*
Ga0111538_1175459423300009156Populus RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGGWVLGYCFGIFDALAQQADLDDGAEVFSLITLGFIGLFADPADPEAAEFVRRSLDRQDNPRFQEGAIAGGTDVFAWVADRAKAPNALFEHLNR*
Ga0111538_1176650013300009156Populus RhizospherePTMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLNSQDSPRFQEGAAAGGTDVFVWVADRAKAPKALFEHLTR*
Ga0111538_1189890013300009156Populus RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADIDDAADGFSLITLGFVGLFADPTDPEAAAFIRRSLDSQDNPRFQEGATAGGTDVF
Ga0075423_1040117023300009162Populus RhizosphereMTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDAAEGFGLISLGFIGLFADPADPEAAEFVRRSLDRQDNPRFQEGAIAGGTDVFAWVADRAKAPNALFEHLNR*
Ga0105347_129680813300009609SoilMDRTLQDAFFQGMPHFGLPSSLLAQGSPTMADADRLGKIASIGQDLITTQLMMATQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAMFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLTR*
Ga0105252_1006585623300009678SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLDRQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFKHLTR*
Ga0126374_1111302313300009792Tropical Forest SoilGQDLITTQLTMAMETPSQALESGWVLGYCFGVFDALAQQAELDDDDDVFNLITLGFLGLFADPADPEAAMFVRRSLDYQDNPRFQEGAAAGGSDVFVWIADRAKAPKALFEQLNR*
Ga0105065_107693213300009803Groundwater SandDRLGKIASIGQDLITTQLTMAMQTPSQALEGSWVLGYCFGVFDALAQQANLDDGTEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFEHLTR*
Ga0126304_1030259023300010037Serpentine SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLTR*
Ga0126309_1087617013300010039Serpentine SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLDLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLTR*
Ga0126382_1088649913300010047Tropical Forest SoilGPEKAVLSQRGSPTMADSDRLGKIASIGQDLITTQLAMAMQSPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSFDGQDNPRFREGAAAEGNDALVWVADHAKAPKALFEYLTR*
Ga0126372_1038052513300010360Tropical Forest SoilMAEEDRLGKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQQAGLDDRTEVFKLVTLGFLGLFADPDDPEPAAFIRRSMDSQDNPRFQEGAAAGGSDVFVWIADRAKAPKALFEQLNR*
Ga0126377_1185338713300010362Tropical Forest SoilIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQAGLDDSAEGFSLITLGLLGLFADPADPEAAAFVRRSLESQDNPRFQEGAAAGGTDVFVWIADRAKAPEALFEHLTR*
Ga0134128_1223549923300010373Terrestrial SoilMADADRLGKIASIGQDLITTQLTMATQTPSQALEGSWVLGYCLGTFDALAQQAGLDDGTEGFSLITLGIIGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFAWVADRTKAPNALFEHLTR*
Ga0105239_1297181513300010375Corn RhizosphereNRTLQDAFFQGMPQFGLTSLFLQRGTPTMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLIR*
Ga0134122_1271957413300010400Terrestrial SoilMPRFGLPSSLLAKGSPTMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDAADGFNLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADHAKAPNALFEHLTR*
Ga0134121_1090000623300010401Terrestrial SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDGAEGFNLITLGFLGLFADPADPEAAEFVRRSLDRQDNPRFQEGATAGGTDVFVWVSDRAKAPNALFEHLTR*
Ga0134121_1165406913300010401Terrestrial SoilMADEDRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGTFDALAQQANLDDAAEGFNLITLGFLGLFADPADPEAAAFIRHSLDRQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLTR*
Ga0134123_1199235623300010403Terrestrial SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGSWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFAPADPEGAMFARRSLESQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFEHLTR*
Ga0137427_1002789213300011445SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLDRQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFKHLTDD*
Ga0137434_106113213300012225SoilTLQDALFQGMPHFGLTSSLLAKRISKMADADRLGKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLFTLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFEHLTR*
Ga0157293_1017857813300012898SoilMNSGTQAARIGMDRTLQDAFFQGMPQFGLTSLFLQRGTPTMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRAELDDGAETFSLVTLGFLGLFADPADPEAAMFVRRSLDQQENPRFQEGAAAGGNDVFVWVADRAKAPKALFEHLNR*
Ga0157291_1028524913300012902SoilLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADVDDGAEGFSLVTIGFLGLFADPADPEAAAFIRRSLDSQDNPRFQEGAAAGGTDVFAWVADRAKVPNALFEHLTR*
Ga0137394_1124938513300012922Vadose Zone SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDAAEGFSLITLGIVGLFADPTDPEAAAFVRRSLDSQDNPRFQEGATAGGTDVFVWVADRAKAPNALFEHLTQ*
Ga0137413_1035861223300012924Vadose Zone SoilMADADRLGRIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDAADGFNLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGATAGGTDVFVWVADRAKVPNALFEHLNR*
Ga0137419_1081178013300012925Vadose Zone SoilMADADRLGKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQRADLDDAAEGFSLITLGFLGLFADPTDPEAAAFVRRSLDSQENPRFQEGATAGGSDVSAWVADRTKAPAALFEHLTR*
Ga0137404_1135604923300012929Vadose Zone SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLVTLGFLGLFADPTDPEAAAFIRRSLDSQDNPRFQEGATAGGTDVFVWAADRAKAPAALFEHLTR*
Ga0164243_1030687913300012940CompostMADADRLGKIATIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDGAEVFSLVTLGFLGLFADPADPEAAAFIRRSLDRQDNPRFQEGAAAGGTDVFVWVADRTKAPNALFEHLGR*
Ga0137410_1108535723300012944Vadose Zone SoilMADTDRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADLDDAAEGFSLITLGFVGLFADPTDPEAAAFIRRSLDSQDNPRFQEGATAGGTDVFAWVADRTKAPAALFEHLTR*
Ga0164298_1008884123300012955SoilMADADRLGKIASIGQDLITTQLAMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEATGFLRRSLDSQDNPRFQEGAAAGGSDAFVWVADRAKVPNALFEHLTR*
Ga0164298_1157143913300012955SoilMATQTPSEALEGTWVLGYCFGIFDALAQQADLDDGAEVFSLITLGFVGLFADPTDPEPAAFIRRSLDSQDNPRFQEGATAGGTDVFVWAADRAKAPTALFEHLTR*
Ga0164303_1026567113300012957SoilPTMADADRLGKIASIGQDLITTQLAMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEATGFLRRSLDSQDNPRFQEGAAAGGSDAFVWVADRAKVPNALFEHLTR*
Ga0164303_1121967613300012957SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGGWVLGYCFGTFDALAQQADLDDGAVLSLITLGFIGLFADPADPEAAMFVRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKAPKALFEHLNR*
Ga0164299_1059292613300012958SoilMVDADRLGKIASIGQDLITTQLTMAMRTPSQALEGGWVLGYCFGVFDALAQQAELDDGADGFSLITLGFLGLFADPADPEAAGFVRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKAPKALFEHLNR*
Ga0164301_1122911213300012960SoilMADADRLGKIASIGQDLITTQLAMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAAGFVRRSLDSQDNPRFQEGAAAGGTDVFVWAADRAKVPNALFEHLTR*
Ga0164302_1020136133300012961SoilMADADRLGKIASSGQDLITTQLAMATQTPSQALEGTWVLGYCFGIFDALAQRANLDDAAEGFSLITLGFLGLFADPADPEATGFLRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKAPKALFEHLNR*
Ga0164309_1036896023300012984SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAAGFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKVPNALFEHLTR*
Ga0164309_1080909623300012984SoilMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEATGFLRRSLDSQDNPRFQEGAAAGGS
Ga0164308_1068878913300012985SoilMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAAGFVRRSLDSQDNPRFQEGAAAGGTDVFDWVADRARAPNALFEHLTR*
Ga0164304_1076221413300012986SoilMADADRLEKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRANLDDAAEGFSLITLGFLGLFADPADPEATGFLRRSLDSQDNPRFQEGAAAGGSDAFVWVADRAKVPNALFEHLTR*
Ga0164307_1021640513300012987SoilMADADRLGKIASIGQDLITTQLAMATQTPSQALEGTWVLGYCFGIFDALAQRANLDDAAEGFSLITLGFLGLFADPADPEAAGFVRRSLDSQDNPRFQEGAAAGGSDAFVWVADRAKVPNALFEHLTR*
Ga0164306_1044190913300012988SoilMADADRLEKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADSEAAGFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKVPNALFEHLTR*
Ga0164305_1153394823300012989SoilASSLLAKRISKMADADRLGKIASIGQDLITTQLTMAAQTPSQALEGSWVLGYCLGTFDALAQQAGLDDGTEGFSLITLGIIGLFADPADPEAAAFVRHSLDRQDNPRFQEGAAAGGTDVFAWVADRTKAPNALFDHLTR*
Ga0164283_100709223300013073SoilMADADRLEKIATIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQADLDDGAEVFGLVTLGFLGLFADPADPEAAAFIRRSLDRQDNPRFQEGAAAGGTDVFVWVADRIKAPNALFEHLSR*
Ga0157378_1045711713300013297Miscanthus RhizosphereMADEDRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGTFDALAQQANLDDAAEGFNLITLGFLGLFADPADPEAAAFIRHSLDRQDNPRFQEGAAAGGTDVFAWVDDRAKAPNALFEHL
Ga0157375_1050641113300013308Miscanthus RhizosphereMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRANLDDAAEGFSLITLGFLGLFADPADAAAFIQHSLDRQDNPRFQEGAAAGGTDVFVWVADRAKA
Ga0163163_1033037523300014325Switchgrass RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGGWVLGYCFGIFDALAQQADLDDGAEVFSLITLGFIGLFADPADPEAAMFVRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKAPKALFEHLNRMTQ*
Ga0163163_1212275623300014325Switchgrass RhizosphereDLIMTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDAAEGFGLISLGFIGLFADPADPEAAEFVRRSLDRQDNPRFQEGAIAGGTDVFAWVADRAKAPNALFEHLNR*
Ga0157377_1070744813300014745Miscanthus RhizosphereMADADRLEKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQADLDGAETFNLITLGFLGLFADPADPEAAMFVRRSLDSQDNPRFQEGAAAGGSDAFVWVADRAKVPNALFEHLTR*
Ga0157379_1044012213300014968Switchgrass RhizosphereMADADRLGKIASIGQDLITTQLAMATQTPSQALEGTWVLGYCFGIFDALAQRANLDDAAEGFSLITLGFLGLFADPADPEAAGFVRRSLDSQDNPRFQEGAAAGGTDVFVWAADRAKVPNALFEHLTR*
Ga0157376_1199442023300014969Miscanthus RhizosphereMMADADRLEKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDGLAQQAGLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQSNPRFQEGAAAGGADVFVWADDRAKAPNALFEHLTR*
Ga0173483_1074988513300015077SoilMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLNSQDSPRFQEGAAAGGTDVFVWVADRAKAPKALF
Ga0173480_1069802713300015200SoilGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAKFVRRSLDSQDTPRFQEGAAAGGTDVFVWVADRAKVPNALFEHLNR*
Ga0137412_1063500923300015242Vadose Zone SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDAADGFNLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGATAGGTD
Ga0132258_1356432023300015371Arabidopsis RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDAADGFSLITLGFVGLFADPTDPEAAAFIRRSLDSQDNPRFQEGATAGGTDVFVWAADRAKAPTALFEHLTR*
Ga0132256_10310856223300015372Arabidopsis RhizosphereWQKGSPTMADEDRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGTFDALAQQANLDDAAEGFNLITLGFLGLFADTADPEAAAFIRHSLDRQDNPRFQEGAAAGGTDVFVWVADRAKVPNALFEHLTR*
Ga0132257_10270951123300015373Arabidopsis RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDAADGFSLITLGFVGLFADPTDPEAAAFIRRSLDSQDNPRFQEGATAGGSDVFDWAADRAKVPAALFEHLT
Ga0132255_10105580023300015374Arabidopsis RhizosphereMADADRLVKIASIGQDLITTQLTMAAQTPSQALEGSWVLGYCFGTFDALAQQAGLDDGTEGFSLITLGIIGLFADPADPEAAAFVRHSLDRQDNPRFQEGAAAGGTDVFAWVADRTKAPNALFDHLTR*
Ga0132255_10470379123300015374Arabidopsis RhizosphereMADAERLGKIASIGQDLITTQLTMAMQTPSQALEGGWVLGYCFGIFDALAQQADLDDGAEVFSLIPLGFIGLFAAPADPEAAMFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLTR*
Ga0182746_118401013300017652CompostMADADRLGKIATIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDGAEVFSLVTLGFLGLFADPADPEAAAFIRRSLDRQDNPRFQEGAAAGGTDVFVWVADRTKAPNALFEHLGR
Ga0180215_105418233300017653SoilMADADRLGKIATIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDGAEGFSLVTLGFLGLFPDPADPEAAAFIRRSLDRQDNPRFQEGAAAGGTDVFVWVADRTKAPNALFEHLSR
Ga0184620_1034502213300018051Groundwater SedimentMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRADLDDAAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVF
Ga0184635_1031310913300018072Groundwater SedimentMADADRLGKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFIRNSLDRQDNPRFQEGATAGGTDVFVWVADRAKAPNALFEHLTQ
Ga0184628_1008379633300018083Groundwater SedimentMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLTR
Ga0190265_1147054923300018422SoilMADADRLGKIASIGQDLITTQLTMATQTPSQALEGGWVLGYCFGVFDALAQQADLDDGADVFSLITLGFLGLFADPADPEAAMFVRRSLDSQDNPRFQEGAAAGGSDVFVWVADRAKAPNALFEHLTR
Ga0190265_1329452813300018422SoilMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGSDV
Ga0190272_1055446213300018429SoilMADADRLGKIASIGQDLITTQLTMATQTPSQALEGGWVLGYCFGVFDALAQQADLDDGADVFSLITLGFLGLFADPADPEAAMFVRRSLDGQDNPRFQEGAAAGGSDVFVWVADRAKAPNALFEHLTR
Ga0190272_1074157013300018429SoilSIGQDLITTQLAMAMQTPSQALEGGWVLGYCFGIFDALAQQADLDDGGEGFGLLTAGFLGLFADPADPEAAMFVRRSLDGQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFEHLTR
Ga0190269_1100668213300018465SoilIMTDADRLGKLASIGQDLITTQLTMAMETPSQALERGWVLGYCFGVFDALAQQAELEDEEVFRLIALGFLGLFPDPADPEAAMFVRRSLDYQDNPRFQEGAAAGGNDVFIWVADRSKTPKTLFEHFNR
Ga0190268_1216377113300018466SoilDADRLGKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQQADLDDGAEVFGLITLGFLGLFADPADPEAAAFVRRSLDSQDSPRFQDGAAAGGTDVFDWVADRAKAPNALFEHLTR
Ga0190270_1086941523300018469SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLTRWPQEERLVAHQRT
Ga0190270_1234278413300018469SoilMADADRLGKIASIGQDLITTQLAMAAQTPSQALESTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPTDPEAATFVRRSLDSQDNPRFQEGAAAGGTDVFAWVADRAKVPNALFEHLTR
Ga0190274_1125119223300018476SoilMADADRLGKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQQADLDDGAGGFSLITLGFLGLFADPADPEAAAFVRRSLGSQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLTR
Ga0190264_1110341623300019377SoilMTDADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRADLDDAAGGFSLITIGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGSDVFVWVADRAKAPNALFEHLTR
Ga0190264_1131787623300019377SoilMADADRLEKIASIGQDLITTQLTMAAQTPSQALEGTWVLGYCFGIFDALAQQADLDDEAEGFSLVALGFVGLFADPTDPEAAAFIRRSLDSQDNPRFQEGATAGGSDVFVWAADRAKMPYALFEHLTGHERPVAH
Ga0190264_1234682613300019377SoilGKIASIGQDLITTQLTMATQTASQALEGTWVLGYCFGIFDALAQRADLDDSGEVFSLITLGFLGLFADPADPEAAAFVRHALDRQDNPRFQEGAAAGGTDVFAWVADRANAPNALFEHLT
Ga0180222_1000252723300020592CompostMADADRLEKIATIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQADLDDGAEVFGLVTLGFLGLFADPADPEAAAFIRRSLDRQDNPRFQEGAAAGGTDVFVWVADRIKAPNALFEHLSR
Ga0210382_1055001213300021080Groundwater SedimentMADTDRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQANLDDAEEGFSLVTLGFLGLFADPTDPEAAAFIQHSLDRQDNPRFQEGATAGGNDVFVWVADRTKAPAALFEHLTR
Ga0207709_1183254513300025935Miscanthus RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFVWAADRAKVPNALFEHLTR
Ga0207708_1189055413300026075Corn, Switchgrass And Miscanthus RhizosphereEDRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGTFDALAQQANLDDAAEGFNLITLGFLGLFADPADPEAAAFIRHSLDRQDNPRFQEGAAAGGTDVFAWVDDRAKAPNALFEHLTR
Ga0207648_1097007223300026089Miscanthus RhizosphereMADEDRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAAMFVRRSLDNQDNPRFQEGAAAGGTDVFVWAADRAKVPNALFEHLTR
Ga0207675_10068231413300026118Switchgrass RhizosphereMADADRSGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAAGFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKAPNALFEHLTR
Ga0209347_100658383300027640Deep SubsurfaceMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCIGIFDALAQRADLDDAEGFSLITLGFLGLFADPADPEAAAFIRHSLDRQDSPRFQEGATAGGTDVFDWVADRTKAPTALFEHLTR
(restricted) Ga0247833_102370123300027730FreshwaterMVDADRLGKTASIGQDLITTQLTMAMQTPSQALESGWVLGYCFGVFDALAQEAELDDDDGVFSLITLGFLGLFADPADPEAAMFVRRSLDYQDNPRFQEGAAAGGGDVFVWIADRAKAPKALFEQLNR
Ga0209813_1031490213300027866Populus EndosphereMADADRLGKIASIGQDLITTQLAMAMQTPSQALEGSWVLGYCFGVFDALAQQAELDDGAEGFSLITLGFLGLFADPADPEAAMFVRRSLDGQDNPRFQEGAAAGGNDVFVWVADRAKAPKALFEHLNR
Ga0209481_1001516023300027880Populus RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADIDDGTEGFSLITLGFLGLFADPADPEAAALVRRSLDRQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFEHLTR
Ga0209382_1000554413300027909Populus RhizosphereMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRADIDDGTEGFSLITLGFLGLFADPADPEAAAFVRRSLDRQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFEHLTR
Ga0209069_1056553013300027915WatershedsMVDAERLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQADLDDAADGFSLITLGFLGLFADPADPEAAAFIQHSLDRQDNPRFQEGATAGGNDVFVWAADRAKAPYALFEHLTR
(restricted) Ga0247838_130604513300028044FreshwaterDAERLKKIASIGQDLITTQLTMAMQTPSQALESGWVLGYCFGVFDALAQEAELDDDDGVFSLITLGFLGLFADPADPEAAMFVRRSLDYQDNPRFQEGAAAGGGDVFVWIADRAKAPKALFEQLNR
Ga0268266_1139655413300028379Switchgrass RhizosphereMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQADLDDGAEGFSLITLGFLGLFADPADPEAAAFVRHSLDRQDNPRFQEGAAAGGTDVFAWVADRTKAPNALFDHLTR
Ga0268264_1166224613300028381Switchgrass RhizosphereMVDADRLGKVTSIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDAEEGFSLVTLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGTDVFVWVADRAKVPNALFEHLTR
Ga0307504_1025895223300028792SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQRANLDDGAEGFSLITLGFLGLFADPADPEAAEFVRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFEHLTR
Ga0307501_1015257113300031152SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGSWVLGYCFGIFDALAQRADLDDGAEGFSLITLGFLGLFADPADPEAATFVRRSLDSQDNPRFQEGAAAGGNDVFAWVADRAKAPNALFEHLTR
Ga0299914_1035608813300031228SoilMADADGLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALGQQANLDDGAEGFSLITLGFLGLFADAADPEAAAFVRRSLDGQDNPRFQEGAAAGGNDAFVWVADHAK
Ga0310887_1095948313300031547SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCFGIFDALAQQANLDDAAEGFSLITLGFLGLFADPADPEAAAFVRRSLDSQDSPRFQEGAAAGGTDVFVWVADRAKAPKALFEHLTR
Ga0315553_1001630973300031652Salt Marsh SedimentMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGTWVLGYCIGIFDALAQRADLDDAEGFSLITLGFLGLFADPADPEAAAFIRRSLDRQDNPRFQEGAAAGGTDVFDWVADRAKAPNALFEHLTR
Ga0310813_1062557113300031716SoilMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGGWVLGYCFGIFDALAQQAHLDDGAEVFSLITLGFIGLFADPADPEAAMFVRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKAPKALFDHLNRMTQ
Ga0307468_10214680513300031740Hardwood Forest SoilYAAFQATLVSSRKGFPTMADADRLGKIASIGQDLITTQLAMAMQTPSQALEGTWVLGYCFGIFDALAQRAGLDEGAEGFSIITLGFLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKAPNALFAHLTR
Ga0307471_10121823913300032180Hardwood Forest SoilMADADRLGKIASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQRADLDDGAEGFSLITLGVLGLFADPADPEAAAFVRRSLDSQDNPRFQEGAAAGGNDVFAWVADRAKAPNALFEHLTR
Ga0307472_10191423523300032205Hardwood Forest SoilMVDADRLGKVASIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQANLDDGAEGFSLITLGFLGLFADLADPEAAAFVRRSLDSQDNPRFQEGAAAGGNDVFVWVADRAKVPNALFEHLTR
Ga0364936_136331_37_4233300034773SedimentMADADRLGKIASIGQDLITTQLTMAMQTPSQALEGSWVLGYCFGIFDALAQRADLDDGAEVFSLITLGFLGLFADPADPEAAMFVRRSLDGQDNPRFQEGAAAGGNDVFVWVADRAKAPKALFEHLNR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.