NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F052222

Metagenome / Metatranscriptome Family F052222

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052222
Family Type Metagenome / Metatranscriptome
Number of Sequences 143
Average Sequence Length 50 residues
Representative Sequence MMFAAVVGHRSGRATPSLRDAPQRQSMEIVRRETIYRNRNAVQTNPATS
Number of Associated Samples 124
Number of Associated Scaffolds 142

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.29 %
% of genes near scaffold ends (potentially truncated) 69.93 %
% of genes from short scaffolds (< 2000 bps) 78.32 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.531 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.776 % of family members)
Environment Ontology (ENVO) Unclassified
(19.580 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.958 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.47%    β-sheet: 0.00%    Coil/Unstructured: 67.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 142 Family Scaffolds
PF13683rve_3 69.01
PF01527HTH_Tnp_1 18.31
PF13276HTH_21 2.82
PF13408Zn_ribbon_recom 1.41
PF07721TPR_4 1.41
PF01695IstB_IS21 0.70
PF00665rve 0.70
PF02371Transposase_20 0.70
PF08388GIIM 0.70
PF13817DDE_Tnp_IS66_C 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 142 Family Scaffolds
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.70
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.70
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.70
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.70
COG3547TransposaseMobilome: prophages, transposons [X] 0.70
COG4584TransposaseMobilome: prophages, transposons [X] 0.70

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.53 %
UnclassifiedrootN/A31.47 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001098|JGI12633J13313_101465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens1367Open in IMG/M
3300001151|JGI12713J13577_1004050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens1406Open in IMG/M
3300001166|JGI12694J13545_1006813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens1367Open in IMG/M
3300001173|JGI12669J13542_100354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens1378Open in IMG/M
3300001593|JGI12635J15846_10190742All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium1364Open in IMG/M
3300002245|JGIcombinedJ26739_100365343All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300004006|Ga0055453_10022504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1561Open in IMG/M
3300005434|Ga0070709_10098817All Organisms → cellular organisms → Bacteria1940Open in IMG/M
3300005434|Ga0070709_10697325All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300005435|Ga0070714_100583384All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300005437|Ga0070710_11435927All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005439|Ga0070711_101002216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187716Open in IMG/M
3300005617|Ga0068859_102507395Not Available568Open in IMG/M
3300005842|Ga0068858_102543601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → unclassified Methylovirgula → Methylovirgula sp. HY1506Open in IMG/M
3300006047|Ga0075024_100833087All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300006086|Ga0075019_10112408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1572Open in IMG/M
3300006163|Ga0070715_10451713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187726Open in IMG/M
3300006174|Ga0075014_100014312All Organisms → cellular organisms → Bacteria → Proteobacteria2886Open in IMG/M
3300006237|Ga0097621_100067705All Organisms → cellular organisms → Bacteria2943Open in IMG/M
3300006237|Ga0097621_102197259Not Available528Open in IMG/M
3300006854|Ga0075425_101078957All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300009545|Ga0105237_11156546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium780Open in IMG/M
3300009553|Ga0105249_11038057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp.889Open in IMG/M
3300009826|Ga0123355_11055464All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300010371|Ga0134125_10335046All Organisms → cellular organisms → Bacteria1679Open in IMG/M
3300012212|Ga0150985_109170502Not Available631Open in IMG/M
3300012481|Ga0157320_1025656Not Available566Open in IMG/M
3300012957|Ga0164303_10778104All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300012961|Ga0164302_10653552All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300012986|Ga0164304_10816442All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300013105|Ga0157369_10348578All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300013105|Ga0157369_10348578All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300014501|Ga0182024_10637691All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1327Open in IMG/M
3300014654|Ga0181525_10761318Not Available545Open in IMG/M
3300015206|Ga0167644_1054716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1401Open in IMG/M
3300015373|Ga0132257_100376330All Organisms → cellular organisms → Bacteria → Proteobacteria1721Open in IMG/M
3300016319|Ga0182033_10245986All Organisms → cellular organisms → Bacteria1450Open in IMG/M
3300016357|Ga0182032_10315715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1239Open in IMG/M
3300016445|Ga0182038_10691619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium887Open in IMG/M
3300016750|Ga0181505_10519869Not Available511Open in IMG/M
3300017823|Ga0187818_10266990All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300017943|Ga0187819_10353553All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300019888|Ga0193751_1074251All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300020582|Ga0210395_10229875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1392Open in IMG/M
3300021170|Ga0210400_11427195Not Available551Open in IMG/M
3300021171|Ga0210405_10223488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1491Open in IMG/M
3300021178|Ga0210408_10253743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1401Open in IMG/M
3300021180|Ga0210396_10161680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2008Open in IMG/M
3300021180|Ga0210396_10220856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1689Open in IMG/M
3300021181|Ga0210388_10310541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1385Open in IMG/M
3300021384|Ga0213876_10081159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1715Open in IMG/M
3300021401|Ga0210393_10265935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1392Open in IMG/M
3300021402|Ga0210385_10211715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1412Open in IMG/M
3300021403|Ga0210397_10357867Not Available1083Open in IMG/M
3300021404|Ga0210389_10199991Not Available1558Open in IMG/M
3300021405|Ga0210387_10281784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1459Open in IMG/M
3300021406|Ga0210386_10270427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1452Open in IMG/M
3300021407|Ga0210383_10343217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1286Open in IMG/M
3300021420|Ga0210394_10997907All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300021420|Ga0210394_11070112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187696Open in IMG/M
3300021433|Ga0210391_10252389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1384Open in IMG/M
3300021474|Ga0210390_11316732Not Available578Open in IMG/M
3300021475|Ga0210392_10195077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1410Open in IMG/M
3300021477|Ga0210398_10254101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1432Open in IMG/M
3300021560|Ga0126371_10853832All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter cognatus1055Open in IMG/M
3300024181|Ga0247693_1006066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1466Open in IMG/M
3300024227|Ga0228598_1111995Not Available552Open in IMG/M
3300025898|Ga0207692_10685614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187664Open in IMG/M
3300025898|Ga0207692_10892546All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300025901|Ga0207688_10869875Not Available571Open in IMG/M
3300025906|Ga0207699_10165083All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300025910|Ga0207684_10071912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2938Open in IMG/M
3300025916|Ga0207663_10219600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1382Open in IMG/M
3300025916|Ga0207663_10286221All Organisms → cellular organisms → Bacteria → Proteobacteria1226Open in IMG/M
3300025928|Ga0207700_10070129All Organisms → cellular organisms → Bacteria → Proteobacteria2693Open in IMG/M
3300025928|Ga0207700_10701816All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300025929|Ga0207664_10302513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1407Open in IMG/M
3300025929|Ga0207664_11947784Not Available510Open in IMG/M
3300025939|Ga0207665_10118055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1871Open in IMG/M
3300026035|Ga0207703_12119350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → unclassified Methylovirgula → Methylovirgula sp. HY1538Open in IMG/M
3300026078|Ga0207702_10637358All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300027000|Ga0207803_1018675All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri901Open in IMG/M
3300027117|Ga0209732_1011610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1476Open in IMG/M
3300027545|Ga0209008_1025495All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300027854|Ga0209517_10531682Not Available635Open in IMG/M
3300027879|Ga0209169_10462870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187666Open in IMG/M
3300027884|Ga0209275_10120316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1365Open in IMG/M
3300027889|Ga0209380_10503222All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300027898|Ga0209067_10090428All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300027911|Ga0209698_10140881All Organisms → cellular organisms → Bacteria1984Open in IMG/M
3300028563|Ga0265319_1046259All Organisms → cellular organisms → Bacteria1451Open in IMG/M
3300028577|Ga0265318_10041559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1747Open in IMG/M
3300028773|Ga0302234_10284564All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300028879|Ga0302229_10383028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales626Open in IMG/M
3300029944|Ga0311352_10604604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria875Open in IMG/M
3300030520|Ga0311372_11229954All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300031234|Ga0302325_10981411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1157Open in IMG/M
3300031236|Ga0302324_100629506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1531Open in IMG/M
3300031238|Ga0265332_10348752Not Available611Open in IMG/M
3300031525|Ga0302326_10713235All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300031544|Ga0318534_10468778All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300031561|Ga0318528_10752341Not Available521Open in IMG/M
3300031682|Ga0318560_10369909All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300031736|Ga0318501_10177725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1106Open in IMG/M
3300031879|Ga0306919_10843999All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300032008|Ga0318562_10122099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1489Open in IMG/M
3300032060|Ga0318505_10588106Not Available523Open in IMG/M
3300032074|Ga0308173_10500924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1087Open in IMG/M
3300032089|Ga0318525_10103885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1449Open in IMG/M
3300032805|Ga0335078_11947225Not Available632Open in IMG/M
3300032828|Ga0335080_10367871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → Methylovirgula ligni1548Open in IMG/M
3300032892|Ga0335081_10899587All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300032898|Ga0335072_10416987All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300032898|Ga0335072_10451120All Organisms → cellular organisms → Bacteria1355Open in IMG/M
3300033289|Ga0310914_10399244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1244Open in IMG/M
3300033545|Ga0316214_1072579Not Available508Open in IMG/M
3300033547|Ga0316212_1010473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1329Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere12.59%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.99%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.20%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.50%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.80%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.10%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.10%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.40%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.40%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.40%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.40%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots1.40%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.40%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.70%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.70%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.70%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.70%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.70%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.70%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.70%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.70%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.70%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.70%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.70%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.70%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.70%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.70%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001098Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1EnvironmentalOpen in IMG/M
3300001151Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3EnvironmentalOpen in IMG/M
3300001166Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2EnvironmentalOpen in IMG/M
3300001173Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004006Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015206Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027000Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes)EnvironmentalOpen in IMG/M
3300027045Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes)EnvironmentalOpen in IMG/M
3300027063Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes)EnvironmentalOpen in IMG/M
3300027117Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027313Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028020Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4EnvironmentalOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033545Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4Host-AssociatedOpen in IMG/M
3300033547Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1Host-AssociatedOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12633J13313_10146513300001098Forest SoilMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATS
JGI12713J13577_100405013300001151Forest SoilMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSL
JGI12694J13545_100681333300001166Forest SoilMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSV
JGI12669J13542_10035433300001173Forest SoilMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSLL
JGI12635J15846_1019074213300001593Forest SoilMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPAT
JGIcombinedJ26739_10036534333300002245Forest SoilMFAAAVGHRSGRATPSLRDAPQQQSMEIVGRETIYRNRNAVQTNPATSV
Ga0055453_1002250433300004006Natural And Restored WetlandsMMFAAVVGHCFGRATPSLRNAPPRQSMEIVRRETIYPNRNAVQTNPATSKAQPLRFQRN*
Ga0070709_1009881723300005434Corn, Switchgrass And Miscanthus RhizosphereMMFAAAVGHRSGRATPSLRDAPQQQSMEMVGTETIYRNRNAVQTNPATSVRRSVG*
Ga0070709_1069732513300005434Corn, Switchgrass And Miscanthus RhizosphereMFAAVVGHGSGRATPSLRHAPQRQSMEIVRRETIYRNRNAVQTNPATS
Ga0070714_10058338423300005435Agricultural SoilMFAAAVWHRSGRATPSLRDAPQQQSMEMVGTETIYRNRNAVQTNPATS
Ga0070710_1143592713300005437Corn, Switchgrass And Miscanthus RhizosphereMSFTAVVGHRSGRATPSLRDAPQRQSREKVCGETIYRNRNAVQTNPATSVCLTVGLPEEIAHIACAH
Ga0070711_10100221613300005439Corn, Switchgrass And Miscanthus RhizosphereMFAAVVGHGSGRATPSLRHAPQRQSMEIVRRETIYRNRNAVQTNPA
Ga0070706_10004385413300005467Corn, Switchgrass And Miscanthus RhizosphereMFAAVVGHRSGRATPSLRDAPQRQCTEIVGRETIYRNRNAVQ
Ga0068856_10188147923300005614Corn RhizosphereMMFAAAVGHRSGRATPSLRDAPQQQSMEMVGTETIYR
Ga0068859_10250739513300005617Switchgrass RhizosphereVTFAAVVGRRSARATPSLRDAPQWQSMEIVGRETIYRNRNAVQ
Ga0068858_10254360113300005842Switchgrass RhizosphereMMFAAAVGHRSGRATPSLRDAPQQQSMELVGRETIYRNRNAVQ
Ga0075024_10083308723300006047WatershedsMMFAAVVGHCFGRATPSLRNAPPRQSREIVRRETIYRNRNAVQTNPATSHNGRAAGQVNRRFYS*
Ga0075019_1011240813300006086WatershedsMMFAAVVGHCSSRATPSLRYAPPRQSMEIVRGETIYRNRNAVQSNPATS
Ga0070715_1045171323300006163Corn, Switchgrass And Miscanthus RhizosphereMMFAAVVGHGSGRATPSLRHAPQRQSMEIVRRETIYRNRNAVQTNPATS
Ga0070715_1062922113300006163Corn, Switchgrass And Miscanthus RhizosphereMFAAAVGHRSGRATPSLRDAPQQQSMELVGRETIYRNRNAVQ
Ga0075014_10001431243300006174WatershedsMMFAAVVGHCSSRATPSLRYAPPRQSMEIVRGETIYRNRNAVQSNPATSQRPKH*
Ga0097621_10006770543300006237Miscanthus RhizosphereMMFAAVVGHRSGRATPSLRDAPQRQSMEIVRRETIYRNRNAVQTNPATS
Ga0097621_10219725923300006237Miscanthus RhizosphereVKFAAVAEHRSSRAMPSLRDAPQRQSMERIGRGSIYRNRNAVQTKPATSPYRRSGLSSSKNEP
Ga0075425_10107895723300006854Populus RhizosphereMMFAAAVGHRSGRASPSLRDAPQQQSMEMVGTETIYRNRNAVQTNPATSHR*
Ga0105237_1115654613300009545Corn RhizosphereMFAAAVGHRSGRATPSLRDAPQQQSMEMVGTETIYRNRNAVQTNPATSKLIY*
Ga0105249_1103805733300009553Switchgrass RhizosphereCMMFAAVVGHRSGRATPSLRDAPQRQSMEIVRRETIYRNRNAVQTNPATSSFAVVSFFS*
Ga0123355_1105546423300009826Termite GutVKFAAVAVHHFSRAMPSLRDAPQPQSTDRIGRESIYRDRNAVQTNP
Ga0134125_1033504613300010371Terrestrial SoilMKFVAVAGRHSGRATPSLRDAPQRQSMERIGRESIYRDRNAVQTNPTTS
Ga0126381_10040674913300010376Tropical Forest SoilMKIAAVVGHRFGRATPSLRDAPQRQSMERNGRESIYRN*
Ga0150985_10917050213300012212Avena Fatua RhizosphereMIFAIVRGHRSGRATPSLRDAPERQFTLTTGRGSTCRERNAVQTKPATSGRFEAFAAV
Ga0157320_102565623300012481Arabidopsis RhizosphereMMFAAVVGHCCGRATPFLRNAPQRQSMEIVRRETIYRNRNAVQTNPA
Ga0164303_1077810413300012957SoilMFAAAVGHRSGRATPSLRDAPQRQSMEIVGRDTIYRNRNAVQTNPATSQLCHAVQSM
Ga0164302_1065355213300012961SoilMMFAAVVGHCCGRATPFLRNAPQRQSMEIVRRETIYRNRNAVQTNPATS
Ga0164304_1081644213300012986SoilMMFAAVVGHCCGRATPFLRNAPQRQSMEIVRGETIYRNRNAVQTNPATSEFALKACASRC
Ga0157373_1047327823300013100Corn RhizosphereMFAAVVGHCFDRATPSLRDAPPRQSMEIVRRETIY
Ga0157369_1034857813300013105Corn RhizosphereMMFAAAVGHRSGRATPSLRDAPQRQSMEIVGRDTIY
Ga0157369_1034857843300013105Corn RhizosphereMTFAAVAGQRSDRATPSLRDAPQRQSMEIVGRDTIYRNRNAVQTNPATEVAGRI*
Ga0182024_1063769113300014501PermafrostMNFAAVAGRRSGRAMPSLRNAPQQQSMEPTGRRSTYRWRNAVQTNPATS
Ga0181525_1076131823300014654BogVKFAAVAGHRSGRATPSLRDAPQRQSMERIGWESIYRDRNAVQTNPATSLTLRDLRDL
Ga0167644_105471633300015206Glacier Forefield SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSLHQAT
Ga0132257_10037633043300015373Arabidopsis RhizosphereMMFAAAVWHRSGRATPSLRDAPQQQSMEMVGTETIYRNRNAVQTNPATSGYTVFQEGFLTI*
Ga0182033_1024598613300016319SoilMMFAAVVGHCSGRATPSLRNAPPRQPREIVRRETIYRNRNAVQTNPATSGFDPASAPGLWLST
Ga0182032_1031571533300016357SoilMMFAAVVGHCSGRATPSLRNAPPRQPREIVRRETIYRNRNAVQTNPATSWRALNRCR
Ga0182038_1069161923300016445SoilMMFAAVVGHCSGRATPSLRNAPPRQPREIVRRETIYRNRNAVQANPATSVGHGERLRSKGPKLY
Ga0181505_1051986923300016750PeatlandVKFAAVAGHRSGRATPSLRDAPQRQSIETTGREAIYRHRNAVQTKPATS
Ga0187818_1026699023300017823Freshwater SedimentVKFAAVAGHRSGRATPSLRDAPQRQSMERIGRESIYRDRNAVQTKPATSVENEASSTN
Ga0187819_1035355323300017943Freshwater SedimentVKFAAVAGHRSGRATPSLRDAPQRQSMERIGRESIYRDRNAVQTKPA
Ga0193751_107425113300019888SoilMMFAAVVGHRSGRATPSLRDAPQRQCTEIVGRETIYRNRNAVQTNPATSIP
Ga0210395_1022987513300020582SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSQG
Ga0210400_1142719533300021170SoilMFAAAVGHRSGRATPSLRDAPQQQSMEIVGRETIYRNRNAVQTNPATSAFFCKAIKVQG
Ga0210405_1022348833300021171SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSVFIIT
Ga0210405_1099771423300021171SoilVTFAAVAGHRSGRATPSLRAAPQRQSIETTGRETIYRNRN
Ga0210408_1025374313300021178SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQT
Ga0210396_1016168033300021180SoilMFAAVVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATS
Ga0210396_1022085613300021180SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSDYRHKP
Ga0210388_1031054133300021181SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSF
Ga0213876_1008115913300021384Plant RootsMMFAAVVGHCSGRATPSLRNAPPRQLMEIVGGETIYRNRNAVQTNPATSLFISP
Ga0210393_1026593533300021401SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSE
Ga0210385_1021171513300021402SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSLARHNAYLHM
Ga0210397_1011445113300021403SoilMMFAAAVGHRSGRATPSLRDAPQQQSMEIVGRETIYRNRNAV
Ga0210397_1035786733300021403SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSEFLPAK
Ga0210389_1019999143300021404SoilMMFAAAVGHRSGRATPSLRDAPQQQSMEIVGRETIYRNRNAVQTNPATSIRQVRSDG
Ga0210387_1028178433300021405SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRESIYRNRNAVQTNPATSLCVILA
Ga0210386_1027042733300021406SoilMMFAAVVGHRSGRDTPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSWSTISGFLTGFTGLKTKRFSRS
Ga0210383_1034321733300021407SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSIDSNIV
Ga0210394_1099790723300021420SoilVTFAAVAGHRSGRATPSLRAAPQRQSTETTGRETIYRNRNAVQTNPATSMGRPGS
Ga0210394_1107011213300021420SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSHRPTRH
Ga0210391_1025238913300021433SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSQ
Ga0210390_1131673213300021474SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSLCARILG
Ga0210392_1019507713300021475SoilMMCAAAVGHRSGRATPSLRDAPQQQSMEIVGRETIYRNRNAVQTNPATSRYAAFRRRGH
Ga0210398_1025410113300021477SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSLHQATDQRPRLGGIV
Ga0126371_1085383213300021560Tropical Forest SoilMMVAAVVGHCPGRATPSLCNAPPRQLMEIVRRETIYRNRNAVQTKPATCLETRNGKNLLC
Ga0247693_100606633300024181SoilMMFAAAVGHRSGRATPSLRDAPQQQSMEIVGRETIYRNRNAVQTNPATSVVL
Ga0228598_103080813300024227RhizosphereMKSAAVVGHRSGRATPSLRDAPQRHSMETVGWESIY
Ga0228598_111199523300024227RhizosphereMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSWSTIS
Ga0207692_1006021043300025898Corn, Switchgrass And Miscanthus RhizosphereMMFAAAVGHRSGRATPSLRDAPQQQSMEIVRRETIY
Ga0207692_1068561423300025898Corn, Switchgrass And Miscanthus RhizosphereMMFAAVVGHGSGRATPSLRHAPQRQSMEIVRRETIYRNRNAVQTNPATSIELSKLG
Ga0207692_1089254623300025898Corn, Switchgrass And Miscanthus RhizosphereMSFTAVVGHRSGRATPSLRDAPQRQSREKVCGETIYRNRNAVQTNPATSVRGG
Ga0207688_1086987523300025901Corn, Switchgrass And Miscanthus RhizosphereVTFAAVVGRRSARATPSLRDAPQWQSMEIVGRETIYRNRNAVQTNPATSTPITREAE
Ga0207699_1016508333300025906Corn, Switchgrass And Miscanthus RhizosphereMMFAAAVWHRSGRATPSLRDAPQQQSMEMVGTETIYRNRNAVQTNPATSVRRSVG
Ga0207699_1138575523300025906Corn, Switchgrass And Miscanthus RhizosphereMMFAAVVGHCFGRATPSLRNAPPWQSREIVRGENHLS
Ga0207684_1007191243300025910Corn, Switchgrass And Miscanthus RhizosphereMMFAAVVGHRSGRATPSLRDAPQRQCTEIVGRETIYRNRNAVQTNPATSE
Ga0207663_1021960013300025916Corn, Switchgrass And Miscanthus RhizosphereMMFAAAVWHRSGRATPSLRDAPQQQSMEMVGTETIYRNRNAVQTNPATSI
Ga0207663_1028622133300025916Corn, Switchgrass And Miscanthus RhizosphereMMFAAVVGHGSGRATPSLRHAPQRQSMEIVRRETIYRNRNAVQTNPATSVAP
Ga0207700_1007012953300025928Corn, Switchgrass And Miscanthus RhizosphereMMFAAAVGHRSGRATPSLRDAPQQQSMEMVGTETIYRNRNAVQTNPATSDG
Ga0207700_1070181613300025928Corn, Switchgrass And Miscanthus RhizosphereMMFAAVVGHGSGRATPSLRHAPQRQSMEIVRRETIYRNRNAVQTNPATSAEA
Ga0207664_1030251333300025929Agricultural SoilMMFAAAVWHRSGRATPSLRDAPQQQSMEMVGTETIYRNRNAVQTNPATSHHRRMGGSA
Ga0207664_1194778423300025929Agricultural SoilMMFAAVVGHCCGRATPFLRNAPQRQSMEIVRGETIYRNRNAVQTNPATSLATA
Ga0207665_1011805523300025939Corn, Switchgrass And Miscanthus RhizosphereMMFAAAVGHRSGRATPSLRDAPQQQSMEMVGTETIYRNRNAVQTNPATSHDLAENAVVVW
Ga0207703_1211935023300026035Switchgrass RhizosphereMMFAAAVGHRSGRATPSLRDAPQQQSMELVGRETIYRNRNAVQTNPATSAGEGL
Ga0207702_1063735823300026078Corn RhizosphereMFAAAVGHRSGRATPSLRDAPQQQSMELVGRETIYRNRNAVQTNPATSRNA
Ga0207803_101867523300027000Tropical Forest SoilMKFAAVVGHRSGRATPSLRDAPQRQSMQTVGRETIYRNRNAAQTNPATSYRR
Ga0207726_101298733300027045Tropical Forest SoilMKFAAVVGHRSGRATPSLRDAPQRQSMQTVGRETIYRNRNAA
Ga0207762_102566113300027063Tropical Forest SoilMKFAAVVGHRSGRATPSLRDAPQRQSMQTVGRETIYRNRNA
Ga0209732_101161013300027117Forest SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSW
Ga0207780_103014313300027313Tropical Forest SoilMKFAAVVGHRSGRATPSLRDAPQRQSMQTVGRETI
Ga0209008_102549513300027545Forest SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSQNPGS
Ga0209517_1053168233300027854Peatlands SoilMKFAAVVGHRSGRATPSLRDAPQRQSMETVGRETIYRNRNAVQTNPATSVQ
Ga0209169_1046287013300027879SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSWSTISGFLTGF
Ga0209275_1012031633300027884SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSEHGGSWL
Ga0209380_1050322223300027889SoilMCAAAVGHRSGRATPSLRDAPQQQSMEIVGRETIYRNRNAVQTNPATS
Ga0209067_1009042833300027898WatershedsMMFAAVVGHCSSRATPSLRYAPPRQSMEIVRGETIYRNRNAVQSNPATSALAAA
Ga0209006_1090138723300027908Forest SoilMCAAAVGHRSGRATPSLRDAPQQQSMEIVGRETIYRN
Ga0209006_1145595513300027908Forest SoilVTFAAVAGHRSGRATPSLRAVPQRQSTETTGRETIY
Ga0209698_1014088143300027911WatershedsMMFAAVVGHCSSRATPSLRYAPPRQSMEIVRGETIYRNRNAVQSNPATSRYYP
Ga0265351_102393923300028020SoilMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNA
Ga0265319_104625913300028563RhizosphereMTFAAVAGQRSGRAAPSLRAAQQRQSMETTGRETIYRNRNAVQTKPATSLR
Ga0265318_1004155943300028577RhizosphereMTFAAVAGQRSGRAAPSLRAAPPRQSMETTGRETIYRNRNAVQTKPATSP
Ga0265318_1027722213300028577RhizosphereMFAAAVGHRSGRATPSRRDAPQQQSKEIVGRETIYR
Ga0302234_1028456413300028773PalsaMKFAAVVGHRCGRATPSLRDAPQRQSMERIGWESIYRDRNAVQTNPATSIVP
Ga0302229_1038302813300028879PalsaMNFATVGGRRSGRAAPSLRDTPQRQLTSTTGRTSIYRKRNAVQTKPAT
Ga0311352_1060460413300029944PalsaMNFATVGARRSGRAAPSLRDTPQRQLTSKTGRTSIYRKRNAVQTKP
Ga0311353_1031911533300030399PalsaVKFAAVAGHRSGRATPSLRDAPQRQSMERIGWESIYRDRN
Ga0311372_1122995423300030520PalsaVKFAAVAGHRSGRATPSLRDAPQRQSMERIGWESIYRDRNAVQTNPATSDIAETVYHLGDLL
Ga0265765_100362243300030879SoilMKSAAVVGHRSGRATPSLRDAHQRQPTSTTGRASIYRKRN
Ga0302325_1098141113300031234PalsaMNFATVGGRRSGRAAPSLRDTPQRQLTSKTGRTSIYRKRNAVQTKP
Ga0302324_10062950613300031236PalsaVKFAAVAGHRSGRATPSLRDAPQRQSMERIGWESIYRDRNAVQTNPATS
Ga0265332_1034875223300031238RhizosphereMTFAAVAGQRSGRAAPSLRAAPPRQSMETTGRETIYRNRNAVQTKPATSV
Ga0302326_1071323513300031525PalsaMKFAAVVGHRSGRATPSLRDAPQRQSMETVGWETIYRNRNAVQTNPTTSSVNG
Ga0318534_1046877823300031544SoilMMFAAVMGHCSGRAAPSLRNAPPRQPREIVRRETIYRNRNAVQTNPATSI
Ga0318528_1075234123300031561SoilMMFAAVVGHCSGRATPSLRNAPPRQPREIVRRETIYRNRNAVQTNPATSK
Ga0318560_1036990913300031682SoilMMFAAVVGHCSGRATPSLRNAPPRQPREIVRRETIYRNRNAVQTNPATSPRLSSAT
Ga0307474_1130935013300031718Hardwood Forest SoilMMFAAAVGHRSGRATPSLRDAPQRQSMEIVGRETIY
Ga0318501_1017772533300031736SoilMMFAAVMGHCSGRAAPSLRNAPPRQPREIVRRETIYRNRNAVQTNPATSG
Ga0318554_1052582113300031765SoilMKIAAVVGHRFGRATPSLRDAPQRLSMERNGRESIYRN
Ga0306919_1084399913300031879SoilMMFAAVVGHCSGRATPSLRNAPPRQPREIVRRETIYRNRNAVQTNPATSGFDPASA
Ga0306923_1048270213300031910SoilMMFAAVVGHCSGRATPSLRNAPPRQPREIVRRETI
Ga0310910_1016954943300031946SoilVKIAAVVGHRFGRATPSLRDAPQRLSMERNGRESI
Ga0318562_1012209913300032008SoilMMFAAVVGHCSGRATPSLRNAPPRQPREIVRRETIYRNRNAVQTNPATSVRLFVYWTRE
Ga0318505_1058810623300032060SoilMMFAAVVGHCSGRATPSLRNAPPRQPREIVRRETIYRNRNAVQTNPATSN
Ga0318553_1016409513300032068SoilMKIAAVVGHRFGRATPSLRDAPQRLSMERNGRESI
Ga0308173_1050092413300032074SoilMFAAVAGHRSGRATPSLRDGPATAIDGDSWQETIYRDRNAVQTNPATSVTVPPRLHLAV
Ga0318525_1010388513300032089SoilMMFAAVVGHCSGRATPSLRNAPPRQPREIVRRETIYRNRNAVQTNPATSGCLRVCNIF
Ga0335078_1194722533300032805SoilMMFAAVVGHCSSRATPSLRNAPPRQSREIVRRETIYRNRNA
Ga0335080_1036787113300032828SoilMMFAAAVGHRSGRATPSLRDAPQPQSIEMVGRETIYRNRNAVQTNAATSFLGIEKR
Ga0335081_1089958723300032892SoilMTFAAAVGHRFGRATPSLRDAPQRQSMDIVGRETIYRNRNAVQTNPAISHRTNHSSRRSQCQETS
Ga0335072_1041698733300032898SoilMFAAVVGRCFGRAMPSLRNAPPRQSMEIVCGETIYRNRNAVQTNPAISLHHVEPARVLGRVMELDAL
Ga0335072_1045112013300032898SoilMMFAAVVGHCCGRATPSLRNAPPRQSREIVCGETIYRNRNAVQTNPANSARHARPAP
Ga0310914_1039924433300033289SoilMMFAAVVGHCSGRATPSLRNAPPRQPREIVRRETIYRNRNA
Ga0316214_107257923300033545RootsMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPATSKYQ
Ga0316212_101047313300033547RootsMMFAAAVGHRSGRATPSLRGAPQRQSMEIVRRETIYRNRNAVQTNPAT
Ga0370515_0087795_2_1093300034163Untreated Peat SoilMMFAAAVGHRSGRATPSRRGAPQRQSMEIVRRETIY
Ga0370515_0435144_447_5513300034163Untreated Peat SoilMMFAAAVGHRSGRATPTLSDAPQRQSIETIGRETI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.