Basic Information | |
---|---|
Family ID | F052528 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 142 |
Average Sequence Length | 42 residues |
Representative Sequence | VGRVTSAVPGLALAYVRVEVPDDAELSVEGRPARLR |
Number of Associated Samples | 124 |
Number of Associated Scaffolds | 142 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.77 % |
% of genes near scaffold ends (potentially truncated) | 91.55 % |
% of genes from short scaffolds (< 2000 bps) | 85.92 % |
Associated GOLD sequencing projects | 121 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (52.817 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.422 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.239 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.408 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 9.38% Coil/Unstructured: 90.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 142 Family Scaffolds |
---|---|---|
PF02653 | BPD_transp_2 | 4.93 |
PF08669 | GCV_T_C | 4.23 |
PF04239 | DUF421 | 4.23 |
PF12697 | Abhydrolase_6 | 4.23 |
PF02423 | OCD_Mu_crystall | 3.52 |
PF00005 | ABC_tran | 2.11 |
PF00291 | PALP | 2.11 |
PF13783 | DUF4177 | 1.41 |
PF01565 | FAD_binding_4 | 1.41 |
PF05974 | DUF892 | 1.41 |
PF13463 | HTH_27 | 1.41 |
PF08352 | oligo_HPY | 1.41 |
PF01047 | MarR | 1.41 |
PF02608 | Bmp | 0.70 |
PF13489 | Methyltransf_23 | 0.70 |
PF00535 | Glycos_transf_2 | 0.70 |
PF14362 | DUF4407 | 0.70 |
PF00588 | SpoU_methylase | 0.70 |
PF02371 | Transposase_20 | 0.70 |
PF02836 | Glyco_hydro_2_C | 0.70 |
PF00211 | Guanylate_cyc | 0.70 |
PF01571 | GCV_T | 0.70 |
PF05014 | Nuc_deoxyrib_tr | 0.70 |
PF13692 | Glyco_trans_1_4 | 0.70 |
PF04525 | LOR | 0.70 |
PF13673 | Acetyltransf_10 | 0.70 |
PF07077 | DUF1345 | 0.70 |
PF05872 | HerA_C | 0.70 |
PF00082 | Peptidase_S8 | 0.70 |
PF14329 | DUF4386 | 0.70 |
PF02416 | TatA_B_E | 0.70 |
PF07508 | Recombinase | 0.70 |
PF00561 | Abhydrolase_1 | 0.70 |
PF07452 | CHRD | 0.70 |
PF01614 | IclR | 0.70 |
COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
---|---|---|---|
COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 4.23 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 3.52 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 1.41 |
COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.70 |
COG0433 | Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domains | Replication, recombination and repair [L] | 0.70 |
COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.70 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.70 |
COG1744 | Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupN | Signal transduction mechanisms [T] | 0.70 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.70 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.70 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.70 |
COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.70 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.70 |
COG3613 | Nucleoside 2-deoxyribosyltransferase | Nucleotide transport and metabolism [F] | 0.70 |
COG4291 | Uncharacterized membrane protein | Function unknown [S] | 0.70 |
COG4894 | Putative phospholipid scramblase YxjI, Tubby2 superfamily | Lipid transport and metabolism [I] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 52.82 % |
Unclassified | root | N/A | 47.18 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090004|P1_DRAFT_NODE_49947_len_975_cov_7_065641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1025 | Open in IMG/M |
2170459006|GBPF9FW02HW4H6 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
3300001686|C688J18823_10557418 | Not Available | 733 | Open in IMG/M |
3300003321|soilH1_10095681 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
3300004153|Ga0063455_100211524 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300005093|Ga0062594_103362842 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300005331|Ga0070670_101061577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
3300005335|Ga0070666_11071933 | Not Available | 599 | Open in IMG/M |
3300005366|Ga0070659_101573189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
3300005438|Ga0070701_10704526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
3300005439|Ga0070711_100570631 | Not Available | 941 | Open in IMG/M |
3300005526|Ga0073909_10323812 | Not Available | 707 | Open in IMG/M |
3300005535|Ga0070684_102205549 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005575|Ga0066702_10093105 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
3300005840|Ga0068870_11021689 | Not Available | 591 | Open in IMG/M |
3300005840|Ga0068870_11306544 | Not Available | 529 | Open in IMG/M |
3300005894|Ga0075270_1071037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
3300005902|Ga0075273_10100751 | Not Available | 574 | Open in IMG/M |
3300006034|Ga0066656_10805308 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300006755|Ga0079222_10154280 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300006876|Ga0079217_11494125 | Not Available | 534 | Open in IMG/M |
3300006914|Ga0075436_100765664 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300006954|Ga0079219_11018162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 690 | Open in IMG/M |
3300007076|Ga0075435_100058687 | All Organisms → cellular organisms → Bacteria | 3117 | Open in IMG/M |
3300009012|Ga0066710_100328687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2251 | Open in IMG/M |
3300009012|Ga0066710_100363502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2144 | Open in IMG/M |
3300009012|Ga0066710_102972486 | Not Available | 661 | Open in IMG/M |
3300009098|Ga0105245_11119455 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300009098|Ga0105245_12181724 | Not Available | 608 | Open in IMG/M |
3300009098|Ga0105245_12715572 | Not Available | 548 | Open in IMG/M |
3300009147|Ga0114129_13211276 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300009162|Ga0075423_10349848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1550 | Open in IMG/M |
3300009174|Ga0105241_11269554 | Not Available | 700 | Open in IMG/M |
3300009520|Ga0116214_1354075 | Not Available | 568 | Open in IMG/M |
3300009553|Ga0105249_12189602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
3300009789|Ga0126307_11147893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
3300010037|Ga0126304_11037125 | Not Available | 560 | Open in IMG/M |
3300010039|Ga0126309_10583263 | Not Available | 701 | Open in IMG/M |
3300010041|Ga0126312_10842295 | Not Available | 666 | Open in IMG/M |
3300010136|Ga0127447_1177125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
3300010147|Ga0126319_1002330 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300010147|Ga0126319_1417666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 559 | Open in IMG/M |
3300010361|Ga0126378_12169020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
3300010371|Ga0134125_11492471 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300010373|Ga0134128_12336803 | Not Available | 589 | Open in IMG/M |
3300010397|Ga0134124_12789567 | Not Available | 532 | Open in IMG/M |
3300012008|Ga0120174_1036795 | Not Available | 1427 | Open in IMG/M |
3300012208|Ga0137376_10654947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 907 | Open in IMG/M |
3300012208|Ga0137376_11625539 | Not Available | 537 | Open in IMG/M |
3300012354|Ga0137366_11126731 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300012386|Ga0134046_1159023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
3300012396|Ga0134057_1330464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
3300012489|Ga0157349_1007232 | Not Available | 823 | Open in IMG/M |
3300012492|Ga0157335_1010032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
3300012515|Ga0157338_1026164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
3300012951|Ga0164300_10549603 | Not Available | 671 | Open in IMG/M |
3300012960|Ga0164301_11894171 | Not Available | 504 | Open in IMG/M |
3300012961|Ga0164302_11277338 | Not Available | 592 | Open in IMG/M |
3300012971|Ga0126369_13321718 | Not Available | 527 | Open in IMG/M |
3300012985|Ga0164308_12101090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia alni → Frankia alni ACN14a | 526 | Open in IMG/M |
3300013104|Ga0157370_10785782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
3300014157|Ga0134078_10187680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
3300014166|Ga0134079_10619531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300014301|Ga0075323_1061203 | Not Available | 752 | Open in IMG/M |
3300014307|Ga0075304_1130497 | Not Available | 592 | Open in IMG/M |
3300014325|Ga0163163_12445226 | Not Available | 580 | Open in IMG/M |
3300014969|Ga0157376_10820224 | Not Available | 944 | Open in IMG/M |
3300014969|Ga0157376_12519809 | Not Available | 554 | Open in IMG/M |
3300015356|Ga0134073_10416443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300015373|Ga0132257_100264184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2059 | Open in IMG/M |
3300016341|Ga0182035_11323173 | Not Available | 645 | Open in IMG/M |
3300017657|Ga0134074_1115825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 925 | Open in IMG/M |
3300017961|Ga0187778_10594366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 741 | Open in IMG/M |
3300017973|Ga0187780_10828065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 670 | Open in IMG/M |
3300018032|Ga0187788_10414862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
3300018061|Ga0184619_10146757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1075 | Open in IMG/M |
3300018071|Ga0184618_10284000 | Not Available | 703 | Open in IMG/M |
3300018081|Ga0184625_10155130 | Not Available | 1196 | Open in IMG/M |
3300018422|Ga0190265_12129619 | Not Available | 665 | Open in IMG/M |
3300018431|Ga0066655_10917448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300018431|Ga0066655_11067317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
3300018466|Ga0190268_11113073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
3300018476|Ga0190274_11801138 | Not Available | 707 | Open in IMG/M |
3300018482|Ga0066669_10276691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1346 | Open in IMG/M |
3300019356|Ga0173481_10670112 | Not Available | 556 | Open in IMG/M |
3300019361|Ga0173482_10310761 | Not Available | 698 | Open in IMG/M |
3300021415|Ga0193694_1044320 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300021510|Ga0222621_1117644 | Not Available | 565 | Open in IMG/M |
3300025900|Ga0207710_10087101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1456 | Open in IMG/M |
3300025935|Ga0207709_10508299 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300025939|Ga0207665_10015704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4970 | Open in IMG/M |
3300025939|Ga0207665_10409505 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300025944|Ga0207661_10469551 | Not Available | 1148 | Open in IMG/M |
3300025993|Ga0208415_1009589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 903 | Open in IMG/M |
3300026089|Ga0207648_10701646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 938 | Open in IMG/M |
3300026095|Ga0207676_12573057 | Not Available | 505 | Open in IMG/M |
3300026142|Ga0207698_12589153 | Not Available | 517 | Open in IMG/M |
3300026277|Ga0209350_1131962 | Not Available | 562 | Open in IMG/M |
3300027787|Ga0209074_10571806 | Not Available | 500 | Open in IMG/M |
3300027909|Ga0209382_10108779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3242 | Open in IMG/M |
3300028556|Ga0265337_1130694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
3300028710|Ga0307322_10144313 | Not Available | 631 | Open in IMG/M |
3300028714|Ga0307309_10107006 | Not Available | 673 | Open in IMG/M |
3300028716|Ga0307311_10123411 | Not Available | 735 | Open in IMG/M |
3300028716|Ga0307311_10197402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
3300028719|Ga0307301_10063656 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300028720|Ga0307317_10012214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2565 | Open in IMG/M |
3300028720|Ga0307317_10316439 | Not Available | 527 | Open in IMG/M |
3300028784|Ga0307282_10048217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1896 | Open in IMG/M |
3300028787|Ga0307323_10066908 | Not Available | 1275 | Open in IMG/M |
3300028793|Ga0307299_10173232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
3300028796|Ga0307287_10056782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1446 | Open in IMG/M |
3300028819|Ga0307296_10596675 | Not Available | 604 | Open in IMG/M |
3300028828|Ga0307312_10275774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1092 | Open in IMG/M |
3300028828|Ga0307312_10774964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
3300028872|Ga0307314_10261255 | Not Available | 540 | Open in IMG/M |
3300028880|Ga0307300_10259415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus → Kineococcus rhizosphaerae | 579 | Open in IMG/M |
3300028884|Ga0307308_10216767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 917 | Open in IMG/M |
3300030006|Ga0299907_10175495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1771 | Open in IMG/M |
3300030007|Ga0311338_10615353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1114 | Open in IMG/M |
3300031446|Ga0170820_12454603 | Not Available | 596 | Open in IMG/M |
3300031671|Ga0307372_10135392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1796 | Open in IMG/M |
3300031740|Ga0307468_100796292 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300031799|Ga0318565_10200075 | Not Available | 971 | Open in IMG/M |
3300031799|Ga0318565_10557232 | Not Available | 552 | Open in IMG/M |
3300031879|Ga0306919_10586575 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300032065|Ga0318513_10313607 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300032067|Ga0318524_10405917 | Not Available | 711 | Open in IMG/M |
3300032897|Ga0335071_11905476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
3300032954|Ga0335083_10679690 | Not Available | 838 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.93% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.82% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.82% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.11% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.11% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.11% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.11% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.11% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.11% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.11% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.11% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.41% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.41% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.41% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.41% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.41% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.41% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.41% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.70% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.70% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.70% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.70% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.70% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.70% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.70% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.70% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.70% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.70% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.70% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.70% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.70% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005894 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 | Environmental | Open in IMG/M |
3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
3300014307 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300025427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
P1_DRAFT_00354140 | 2088090004 | Soil | HEGKVVGRVTSAVPGLALGYVRVQVPDDAELQIDGAPARLH |
L01_01675880 | 2170459006 | Grass Soil | VGRITSSVPGLALAYVRVSVPADAVLDVDGRSARLH |
C688J18823_101243576 | 3300001686 | Soil | RQADEVTYEGEVVGRVTSAVPGLALAYVRVEVPDGAELEVGGKPARLQ* |
C688J18823_105574181 | 3300001686 | Soil | PETEIELAGKTVGRVTSAVPGLALGYVRTEVPDDAVLSIGAARARLH* |
soilH1_100956818 | 3300003321 | Sugarcane Root And Bulk Soil | RVTSAVDGLALAYVRVEVPDDAELDVAGARARLHWPTERP* |
Ga0063455_1002115243 | 3300004153 | Soil | AEIAYDGKVVGRVTSAVPGVALGYVRVEVPDDAELAVGDAAARLVG* |
Ga0062594_1033628422 | 3300005093 | Soil | IVHDGKAVGRVTSAVLGVALGYVRVEVPEGAEVRAGGAVARLR* |
Ga0070670_1010615772 | 3300005331 | Switchgrass Rhizosphere | EVDADAEIRLGEKAVGRVTSVVPGLALAYVRTEVPDDAVLEIGAARARLH* |
Ga0070666_110719333 | 3300005335 | Switchgrass Rhizosphere | DEIRLGEKTVGRITSAVPGVALGYVRVEVPDDAQLDVEGEPARLRS* |
Ga0070659_1015731893 | 3300005366 | Corn Rhizosphere | GDEVAFEGKSVGRVTSAVPGRALGYVRVEVPDGAGVMVGGKDARLH* |
Ga0070701_107045261 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | GKAVGRVTSAVAGLALGYVRVEVVEHADLRVGSSEARLR* |
Ga0070711_1005706311 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VVYGEKEVGRVTSAVPGLALAYVRVEVPDDAELSVGSASARLH* |
Ga0073909_103238121 | 3300005526 | Surface Soil | VVGRVTSAVPGLALAYVRVEVPDGAELTVSGRPARIH* |
Ga0070684_1022055492 | 3300005535 | Corn Rhizosphere | HDGKAVGRVTSAVPGVALGYVRVEVPEGTEVRAGGAVARLR* |
Ga0066702_100931051 | 3300005575 | Soil | VVGRITSAVPGLALGYVRTEVPDDAELRIGDRRARLH* |
Ga0068852_1002740295 | 3300005616 | Corn Rhizosphere | LHDGKDVGRVTSSVAGLALAYVRVSVPEDAALEVGGSPARLHWPTGRP* |
Ga0068870_110216893 | 3300005840 | Miscanthus Rhizosphere | QVGRITSAVPGVALAYVREEVPDDAEVSVGGATARLHLAPARP* |
Ga0068870_113065441 | 3300005840 | Miscanthus Rhizosphere | IVLEGKAVGRVTSAVAGLALGYVRVEVVEHADLRVGSSEARLR* |
Ga0075270_10710371 | 3300005894 | Rice Paddy Soil | VGRVTSAVPGLALAYVRVEVPDDAELSVEGRPARLR* |
Ga0075273_101007512 | 3300005902 | Rice Paddy Soil | VTSAVPGLALGYVRVEVPDDAELEVEGLPARLRALETS* |
Ga0066656_108053081 | 3300006034 | Soil | HEGKDVGRVTSSVSGLALAYVRVSVPDDAVLDVGGAEARLH* |
Ga0079222_101542801 | 3300006755 | Agricultural Soil | HDGQVVGRVTSAVPGIALAYVRVEVADGADLQVGGRPARLH* |
Ga0079217_114941253 | 3300006876 | Agricultural Soil | LGEKTIGRITSSVPGLALAYVRVEVPADAELSVGGAKARSAA* |
Ga0075436_1007656641 | 3300006914 | Populus Rhizosphere | EIEYGGKQVGRITSAVPGVALAYVREEVPDDAEVSVGGATARLHLAPARP* |
Ga0079219_110181624 | 3300006954 | Agricultural Soil | GRITSVAGDVALGYVRTEVPDEAELRIGTARARLD* |
Ga0075435_1000586875 | 3300007076 | Populus Rhizosphere | TSAVPGFALGYVRTEVPDEAELSVGGAVARLHLTPARP* |
Ga0066710_1003286875 | 3300009012 | Grasslands Soil | VGRVTSAVPGLALGYVRVGVPDGAELEVGGAAARLH |
Ga0066710_1003635021 | 3300009012 | Grasslands Soil | AVVFGEREVGRVTSAVPGLALAYVRVEVPDDAELRVGSAAARLH |
Ga0066710_1029724861 | 3300009012 | Grasslands Soil | VGRVTSAVPGVALAYVRNEVPDDAELSVGGATARLDLAPARP |
Ga0105245_111194553 | 3300009098 | Miscanthus Rhizosphere | LGEKTVGRVTSAVPGVALGYVRVEVSDDAQLDVEGEPARLRS* |
Ga0105245_121817241 | 3300009098 | Miscanthus Rhizosphere | AEILHEGKVVGRVTSAVPGLALAYVRTAVPADAELEITY* |
Ga0105245_127155723 | 3300009098 | Miscanthus Rhizosphere | EIAYDGKVVGRVTSAVPGVALGYVRVEVPEDAALAVGDAAARLVG* |
Ga0114129_132112761 | 3300009147 | Populus Rhizosphere | GKTVGRITSAVPGFALGYVRTEVPDEAELSVGGAVARLHLTPARP* |
Ga0075423_103498481 | 3300009162 | Populus Rhizosphere | IFHGEKAVGRVTSAVPGRALGYIRREVPDDAELRIGGAEARLHLPSPRP* |
Ga0105241_112695543 | 3300009174 | Corn Rhizosphere | EVAFEGKPVGRVTSAVPGRALGYVRVEVPDGAGVMVGGKDARLH* |
Ga0116214_13540751 | 3300009520 | Peatlands Soil | RTVGRVTSAVPGLALGYLRTDVPGDATLEIAGRNVRIH* |
Ga0105249_118805681 | 3300009553 | Switchgrass Rhizosphere | PGDEILLEGRVVGRVTSAVPGRALGYVRVEVPDDSELSIRGRLARLH* |
Ga0105249_121896022 | 3300009553 | Switchgrass Rhizosphere | VLLEGKPVGRITSSVDGLALAYVRVEVPEDAPLEVAGAPARLH* |
Ga0126307_111478931 | 3300009789 | Serpentine Soil | VTSSVPGLALAYVRVEVPEDVELAVGGRTARQLH* |
Ga0126304_110371251 | 3300010037 | Serpentine Soil | VGRVTSSIAGLALAYVRTDVSEDAELTVAGATASTVR* |
Ga0126309_105832633 | 3300010039 | Serpentine Soil | VTSAVPGRALGYVRREVADDTALTIDGQDARLHLTTPRP* |
Ga0126312_108422953 | 3300010041 | Serpentine Soil | GDKIVGRVTSSVAGLALAYVRVEVPEDAELAVGGRRARQLH* |
Ga0127447_11771251 | 3300010136 | Grasslands Soil | PGRALGYVRREVPDDEVLSIGGQEARLHLTTPRP* |
Ga0126319_10023301 | 3300010147 | Soil | KTVGRVTSAVPGLALGYVRREVDDDAELEIGGAEARLHLATPRP* |
Ga0126319_14176661 | 3300010147 | Soil | AAPDPETEIQLDGKTVGRVTSAVPGLALGYVRVEVPADALLSVGGMKARLH* |
Ga0134111_102853481 | 3300010329 | Grasslands Soil | TSAVPGLALAYVRNEVPDGAELEVEGRAATLTAPRP* |
Ga0126378_121690201 | 3300010361 | Tropical Forest Soil | KAVGRVTSAVPGKALGYVRREVPDDAVLEVGGAEARLHLHPARP* |
Ga0134125_114924714 | 3300010371 | Terrestrial Soil | TSAVDGLALGYVRVEVPDDAELIVGGKPARLHWPPERP* |
Ga0134128_121571711 | 3300010373 | Terrestrial Soil | ARQGDPVLHEGAAVGRGTSAVPGLALAYVRVEVPDDADLRVGGAPARLRR* |
Ga0134128_123368032 | 3300010373 | Terrestrial Soil | DGKDVGRITSSVDGLALGYVRAEGADDAELSVEGRPARLRPLA* |
Ga0134124_127895671 | 3300010397 | Terrestrial Soil | KAVGRVTSVVPGLALAYVRTEVPDDAVLEIGAARARLH* |
Ga0120174_10367953 | 3300012008 | Permafrost | TSAVPGRALGYVRREVPDDAELRIGRAEARLHLPTARP* |
Ga0137376_106549473 | 3300012208 | Vadose Zone Soil | GEKAVGRVTSAVPGNALGYVRVEVPDDAELDVAGRPARLRKTP* |
Ga0137376_116255392 | 3300012208 | Vadose Zone Soil | VGRITSAVPGRALGYVRVEVPDDAELEIGSVRGRLR* |
Ga0150985_1007239142 | 3300012212 | Avena Fatua Rhizosphere | GDPPPPEAPVAYEGKEVGRITSAVPGLALAFVRVSVPDDAVLEVGGRRARLH* |
Ga0150985_1052349331 | 3300012212 | Avena Fatua Rhizosphere | EGRQADEVTYEGEVVGRVTSAVPGLALAYVRVEVPDGAELEVGGKPARPQ* |
Ga0137366_111267311 | 3300012354 | Vadose Zone Soil | KAVGRVTSAVPGLALGYVRVEVADEAALQVEGRPARLRP* |
Ga0134046_11590231 | 3300012386 | Grasslands Soil | DEILYEGKVVGRVTSAVPGLALAYVRVEVPADAPVTIGEVRARIRS* |
Ga0134057_13304643 | 3300012396 | Grasslands Soil | ADEVTYEGDVVGRVTSAVPGLALAYVRVEVPDGAELEVGGKPARLQ* |
Ga0157349_10072324 | 3300012489 | Unplanted Soil | EGKAVGRVTSAVAGLALGYVRVEVVEHADLRVGSSEARLR* |
Ga0157335_10100321 | 3300012492 | Arabidopsis Rhizosphere | PGRALGYVRREVPDDAELRIGGAGARLHLPSPRP* |
Ga0157338_10261643 | 3300012515 | Arabidopsis Rhizosphere | VTSAVPGRALGYVRREVPDDAVLKIGGAEARLHFSPARP* |
Ga0164300_105496031 | 3300012951 | Soil | SAVSGKALGYVRREVSDDAVLQIGGAEARLHLATPRP* |
Ga0164301_118941711 | 3300012960 | Soil | TPVRLREKDVARSTSAAPCLALAYVPVEVPDDAELRVGDASARLRR* |
Ga0164302_112773381 | 3300012961 | Soil | YGEKEVGRVTSSVPGLALAYVRVEVPDDAELRIGSAAARLH* |
Ga0126369_133217183 | 3300012971 | Tropical Forest Soil | TSSVDGLALGYVRVEVPDDATLDVGGEAARLHWPVERP* |
Ga0164308_121010903 | 3300012985 | Soil | SAVPGVALAYVRNEVPDDAELSVGGATARLDLAPARP* |
Ga0157370_107857823 | 3300013104 | Corn Rhizosphere | GDEIVLEGKAVGRVTSAVAGLALGYVRVEVVEHADLRVGSSEARLR* |
Ga0134078_101876803 | 3300014157 | Grasslands Soil | DEIFLGDKAVGRVTSAAPGNALGYVRREVPEDAELRIGGASARLH* |
Ga0134079_106195311 | 3300014166 | Grasslands Soil | RGKSVGRVTSAVHGLALAYVRKEVPDDAELSVGDATARLHLPSARP* |
Ga0075323_10612032 | 3300014301 | Natural And Restored Wetlands | KAVGRVTSAVPGLALAYVRVEVPDGAELEVEGRTARFRPA* |
Ga0075304_11304971 | 3300014307 | Natural And Restored Wetlands | KVVGRVTSAVPGKALGYVRREVPDDAELEIAGQPARLH* |
Ga0163163_124452263 | 3300014325 | Switchgrass Rhizosphere | DEIVLEGKAVGRVTSAVPGVALGYVRVEVPDDAELLVGATRVRLRSQGAQQ* |
Ga0157376_108202241 | 3300014969 | Miscanthus Rhizosphere | AVGRVTSVVPGLALGYMRVEVSEDAELSVGGKPARLH* |
Ga0157376_125198092 | 3300014969 | Miscanthus Rhizosphere | EVRDGEIVVGRVTSAVPGLALAYVRVEVPEGAELTVSGRPARIH* |
Ga0134073_104164431 | 3300015356 | Grasslands Soil | VTSAVHGLALAYVRKEVPDDAELSVGDATARLHLPSARP* |
Ga0132257_1002641843 | 3300015373 | Arabidopsis Rhizosphere | RVTSAVPGRALAYVRVEVPDDAPLSVGGTRARLH* |
Ga0182035_113231731 | 3300016341 | Soil | RQADEVYEGERVVGRVTSAVPGLALAYVRVEVPDGAELTVSGRPARIH |
Ga0134074_11158253 | 3300017657 | Grasslands Soil | GRVTSAVPGLALAYVRVEVPQGAELAVGGKPARLQ |
Ga0187778_105943662 | 3300017961 | Tropical Peatland | VLDGKVVGRVTSAVPGLALGYVRVEVPDEARLEIGGRAARLR |
Ga0187780_108280651 | 3300017973 | Tropical Peatland | GRVTSAVPGLALGYVRVEVPDEARLEIGGRAARLR |
Ga0187788_104148623 | 3300018032 | Tropical Peatland | VGRITSAVPGLALGFVRREVPDDAELTVAEEPSRLHSPG |
Ga0184619_101467573 | 3300018061 | Groundwater Sediment | VGRVTSAVPGVALAYVRNEVPDDAALSVGGATARLDLAPARP |
Ga0184618_102840003 | 3300018071 | Groundwater Sediment | DKVVGRVTSAVPGRALGYVRREVADDAELQIRGTSARLH |
Ga0184625_101551301 | 3300018081 | Groundwater Sediment | AVGRVTSAIPGRALAYVRTEVPEDAELDVSGRTARLAG |
Ga0190265_121296191 | 3300018422 | Soil | TEIRAGDKVVGRVTSAVPGLALGYVRTEVADDAVLEIDGVEARLH |
Ga0066655_109174481 | 3300018431 | Grasslands Soil | SAVPGFALGYVRTEVPDDAELSVGGAVARLHLTPPRP |
Ga0066655_110673171 | 3300018431 | Grasslands Soil | IRLNEKIVGRVTSALPRRALGYVRTEVPDDAELRIGSARARLH |
Ga0190268_111130733 | 3300018466 | Soil | IRLGEKAVGRVTSVVPGLALAYVRTEVPDDAVLEIGAARARLHLATSRP |
Ga0190274_118011382 | 3300018476 | Soil | EGEKAVGRVTSSVPGLALAYVRTTVPHDAALTVDGARASLR |
Ga0066669_102766911 | 3300018482 | Grasslands Soil | DVVGRVTSAVPGLALAYVRVEVPDGAELEVGGKPARLQ |
Ga0173481_106701121 | 3300019356 | Soil | RVTSAVPGRALGYVRREVPDDAVLQIGAAEARLHLPSPRP |
Ga0173482_103107611 | 3300019361 | Soil | FGDKEVGRITSSVPGLALAYVRVEVPAEAELRAGGATARIR |
Ga0193735_10503121 | 3300020006 | Soil | SPGDEIEYQGKSVGRVTSAVPGVALAYVRNEVPDDAELSVGGATARLDLAPARP |
Ga0193694_10443203 | 3300021415 | Soil | VGRVTSAVPGKALGYVRREVPDDAELEIGGQPARLH |
Ga0222621_11176441 | 3300021510 | Groundwater Sediment | SVGRVTSAVPGLALGYVRTEVPDDAELEIAGASARLH |
Ga0208077_10652851 | 3300025427 | Arctic Peat Soil | ETPVSFAGKDVGRITSSVPGVALAYVRVEVPDDAELEVAGIRARLH |
Ga0207710_100871013 | 3300025900 | Switchgrass Rhizosphere | KAVGRVTSAVPGRALGYVRREVPDDAVLRIGGAEARLHLATPRP |
Ga0207709_105082993 | 3300025935 | Miscanthus Rhizosphere | EYQGKSVGRVTSAVPGVALAYVRSEVPDDAELSVGGVTARLDLAPARP |
Ga0207665_100157041 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VLDGKAVGRVTSAAPGKALGYVRREVPDDAGLQVGGAEARLHLLPARP |
Ga0207665_104095053 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | QGKPVGRVTSAVPGVALAYVRNEVPDDAELSVGGATARLDLAPARP |
Ga0207661_104695512 | 3300025944 | Corn Rhizosphere | VHAGKAVGRVTSAVPGVALGFVRVEVPEDAELLVESRPARLRP |
Ga0208415_10095891 | 3300025993 | Rice Paddy Soil | AVPGLALAYVRREVEDDAELEIGGATARLHLPAPRP |
Ga0207639_117902722 | 3300026041 | Corn Rhizosphere | VLDVEAATPGDEIIHDGKAVGRVTSAVPGVALGYVRVEVPEGTEVRAGGAVARLR |
Ga0207648_107016461 | 3300026089 | Miscanthus Rhizosphere | EIVLEGKAVGRVTSAVAGLALGYVRVEVVEHADLRVGSSEARLR |
Ga0207676_125730571 | 3300026095 | Switchgrass Rhizosphere | DKEVGRITSSVPGLALAYVRVEVPVEAELRAGGATARIR |
Ga0207698_125891533 | 3300026142 | Corn Rhizosphere | EKEVGRVTSAVDGLALAYVRVEVPDDAQLIVAGAPARLHWPPERP |
Ga0209350_11319622 | 3300026277 | Grasslands Soil | GDEIEHDGKSVGRVTSAVPGVALAYVRNEVPDDAELSVGGATARLDLAPARP |
Ga0209074_105718061 | 3300027787 | Agricultural Soil | HDGQVVGRVTSAVPGIALAYVRVEVADGADLQVGGRPARLH |
Ga0209382_101087791 | 3300027909 | Populus Rhizosphere | VFDGEKAVGRVTSSVPGLALAYVRTTVPPDAALTVDGATASLR |
Ga0265337_11306941 | 3300028556 | Rhizosphere | HDGKEVGRITSAVPGLALAYVRVSVPDGAVLDVDGRPARLH |
Ga0307322_101443133 | 3300028710 | Soil | LYGERTVGRVTSAVPGRALGFVRREVPDDAELRIGGAEARLHLTPPRP |
Ga0307309_101070062 | 3300028714 | Soil | VVFGEKEVGRVTSAVPGLALAYVRVEVPADAELQVGDATARVRA |
Ga0307311_101234112 | 3300028716 | Soil | QGKSVGRVTSAVPGLALAYVRKEVPDDAELSIGGTTARLHLAPARP |
Ga0307311_101974023 | 3300028716 | Soil | ILHDGKTVGRVTSAVPGRALGYVRREVPKDALLQVGGADARLH |
Ga0307301_100636564 | 3300028719 | Soil | EILLREKAVGRVTSAVPGRALGYVRREVPKDALLQIGGADARLH |
Ga0307317_100122141 | 3300028720 | Soil | VPGRALGYVRREVPDDAELSIGAQEARLHLPPPRP |
Ga0307317_103164391 | 3300028720 | Soil | EIVHEGKPVGRVTTSVPGLALGYVRTEVPEDAELEIAGATARLH |
Ga0307282_100482171 | 3300028784 | Soil | YGEKTVGRVTSAVPGRALGFVRREVPDDAELRIGGAEARLHLTPPRP |
Ga0307323_100669084 | 3300028787 | Soil | TSAVPGRALGFVRREVPDDAELRIGGAEARLHLTPPRP |
Ga0307299_101732324 | 3300028793 | Soil | RVTSAVPGRALGFVRREVPDDAELRIGGAEARLHLTPPRP |
Ga0307287_100567821 | 3300028796 | Soil | GKSVGRVTSAVPGVALAYVRNEVPDDAELSVGGATARLDLAPARP |
Ga0307296_105966753 | 3300028819 | Soil | QGKSVGRVTSAVPGVALAYVRNEVPDDAELSVGGATARLDLAPARP |
Ga0307312_102757743 | 3300028828 | Soil | SAVPGRALGYVRREVPDDAELSIGAQEARLHLPPPRP |
Ga0307312_107749643 | 3300028828 | Soil | LLGEKPVGRVTSAVPGRALGYVRREVPDDAVLKIGDAEARLHLPSPRP |
Ga0307314_102612553 | 3300028872 | Soil | AVPGRALGFVRREVPDDAELRIGGAEARLHLTPPRP |
Ga0307300_102594151 | 3300028880 | Soil | DPPAFDAELLYGEKPVGRVTSAVDGHALAYVRVEVPDDAELRAGDTVARLVG |
Ga0307308_102167673 | 3300028884 | Soil | GEKAVGRVTSAVPGRALAYIRREVSDDAVLQIGGAEARLHLPSPRP |
Ga0299907_101754955 | 3300030006 | Soil | VGRVTSSVPGLALAYVRREVPEEAELVVGGRAATQLH |
Ga0311338_106153531 | 3300030007 | Palsa | SGDAVRHGERDVGTVTSSVPGLALAYLRTEVPDDASLEVGGRPARIH |
Ga0170820_124546033 | 3300031446 | Forest Soil | GKDVGRITSAVPGLALAFIRVEVPDDATLEIDGRSARLH |
Ga0307372_101353923 | 3300031671 | Soil | GCVVGRVTSAVAGLALAYVRVDVPAGADLDVAGRAARTRIPPGADG |
Ga0307468_1007962923 | 3300031740 | Hardwood Forest Soil | ADEVVHEGAAVGRVTSAVPGLALAYVRVEVPDGAELEVGGRKARLH |
Ga0318565_102000753 | 3300031799 | Soil | FEGKDVGRVTSAVPGLALAYVRVEVPDDATLDVDGRTARLH |
Ga0318565_105572323 | 3300031799 | Soil | VYEGERVVGRVTSAVPGLALAYVRVEVPEGAELTVSGRPARIH |
Ga0306919_105865753 | 3300031879 | Soil | PVTYEGKEVGRLTSAVPGLALAYVRVEVPDSAVLDVGSATARVH |
Ga0318513_103136073 | 3300032065 | Soil | GKEVGRLTSVVPGLALAYVRVEVPDSAVLDVGSATARVH |
Ga0318524_104059173 | 3300032067 | Soil | GRVTSAVPGLALAYVRVEVPDDATLDVDGRTARLH |
Ga0335071_119054761 | 3300032897 | Soil | HESSAVGRVTSAVDGLALAYVRVEVPDGAELTVAGRPARIH |
Ga0335083_106796903 | 3300032954 | Soil | GEKEVGRVTSSVPGLALAYVRVEVPEDAELSVGGTAARLH |
Ga0364943_0102659_828_998 | 3300034354 | Sediment | LLEIDSASSGEEITYEGKAVGRVTSAIPGRALAYVRTEVPEDAELDVAGRTARLAG |
Ga0373948_0008078_3_164 | 3300034817 | Rhizosphere Soil | PGDEIEYGGKQVGRITSAVPGVALAYVREEVPDDAEVSVGGATARLHLAPARP |
⦗Top⦘ |