Basic Information | |
---|---|
Family ID | F053086 |
Family Type | Metagenome |
Number of Sequences | 141 |
Average Sequence Length | 38 residues |
Representative Sequence | MAKSANKGKKGSAGGKNSKQNQGNATANKAKNGGKKK |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 141 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 55.32 % |
% of genes near scaffold ends (potentially truncated) | 23.40 % |
% of genes from short scaffolds (< 2000 bps) | 76.60 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (39.716 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (27.660 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.773 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.957 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.31% β-sheet: 0.00% Coil/Unstructured: 87.69% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 141 Family Scaffolds |
---|---|---|
PF00959 | Phage_lysozyme | 7.80 |
PF00565 | SNase | 5.67 |
PF00124 | Photo_RC | 3.55 |
PF13529 | Peptidase_C39_2 | 3.55 |
PF16724 | T4-gp15_tss | 2.13 |
PF03797 | Autotransporter | 2.13 |
PF00504 | Chloroa_b-bind | 1.42 |
PF01223 | Endonuclease_NS | 1.42 |
PF07460 | NUMOD3 | 1.42 |
PF13759 | 2OG-FeII_Oxy_5 | 0.71 |
PF04966 | OprB | 0.71 |
PF02698 | DUF218 | 0.71 |
PF14279 | HNH_5 | 0.71 |
PF00154 | RecA | 0.71 |
PF00268 | Ribonuc_red_sm | 0.71 |
PF01764 | Lipase_3 | 0.71 |
PF13640 | 2OG-FeII_Oxy_3 | 0.71 |
PF07230 | Portal_Gp20 | 0.71 |
PF01531 | Glyco_transf_11 | 0.71 |
PF03330 | DPBB_1 | 0.71 |
COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
---|---|---|---|
COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 1.42 |
COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.71 |
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.71 |
COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.34 % |
Unclassified | root | N/A | 27.66 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000126|BS_KBB_SWE26_205mDRAFT_c1040243 | Not Available | 741 | Open in IMG/M |
3300000756|JGI12421J11937_10057112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1233 | Open in IMG/M |
3300001847|RCM41_1012597 | All Organisms → Viruses → Predicted Viral | 1682 | Open in IMG/M |
3300001848|RCM47_1013518 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
3300001848|RCM47_1074255 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
3300001850|RCM37_1028331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1198 | Open in IMG/M |
3300001851|RCM31_10060846 | All Organisms → Viruses → Predicted Viral | 2004 | Open in IMG/M |
3300001968|GOS2236_1018302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1823 | Open in IMG/M |
3300001968|GOS2236_1060914 | Not Available | 1487 | Open in IMG/M |
3300001968|GOS2236_1074438 | Not Available | 862 | Open in IMG/M |
3300001968|GOS2236_1081272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus | 1557 | Open in IMG/M |
3300004240|Ga0007787_10479198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus | 622 | Open in IMG/M |
3300005527|Ga0068876_10173263 | Not Available | 1260 | Open in IMG/M |
3300005645|Ga0077109_1163227 | Not Available | 556 | Open in IMG/M |
3300005805|Ga0079957_1039405 | All Organisms → Viruses → Predicted Viral | 3016 | Open in IMG/M |
3300005934|Ga0066377_10267530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 529 | Open in IMG/M |
3300005943|Ga0073926_10083433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus | 642 | Open in IMG/M |
3300005955|Ga0073922_1010620 | All Organisms → Viruses → Predicted Viral | 1069 | Open in IMG/M |
3300007363|Ga0075458_10221427 | Not Available | 579 | Open in IMG/M |
3300007538|Ga0099851_1295339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 573 | Open in IMG/M |
3300007541|Ga0099848_1133137 | Not Available | 931 | Open in IMG/M |
3300007541|Ga0099848_1211087 | Not Available | 693 | Open in IMG/M |
3300007542|Ga0099846_1264583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 595 | Open in IMG/M |
3300007544|Ga0102861_1032704 | All Organisms → Viruses → Predicted Viral | 1324 | Open in IMG/M |
3300007640|Ga0070751_1347411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus | 544 | Open in IMG/M |
3300007670|Ga0102862_1021650 | All Organisms → Viruses → Predicted Viral | 1488 | Open in IMG/M |
3300008107|Ga0114340_1008150 | All Organisms → Viruses | 6113 | Open in IMG/M |
3300008110|Ga0114343_1155862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 721 | Open in IMG/M |
3300008111|Ga0114344_1092115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1110 | Open in IMG/M |
3300008113|Ga0114346_1288574 | Not Available | 575 | Open in IMG/M |
3300008448|Ga0114876_1036682 | All Organisms → Viruses → Predicted Viral | 2338 | Open in IMG/M |
3300009059|Ga0102830_1222540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 552 | Open in IMG/M |
3300009075|Ga0105090_10936624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 528 | Open in IMG/M |
3300009152|Ga0114980_10592377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 627 | Open in IMG/M |
3300009159|Ga0114978_10001817 | All Organisms → Viruses | 17936 | Open in IMG/M |
3300009159|Ga0114978_10009458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7574 | Open in IMG/M |
3300009159|Ga0114978_10027032 | All Organisms → Viruses → Predicted Viral | 4138 | Open in IMG/M |
3300009159|Ga0114978_10392843 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300009180|Ga0114979_10026131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3712 | Open in IMG/M |
3300009451|Ga0127402_1127825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 519 | Open in IMG/M |
3300009466|Ga0126448_1062468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 850 | Open in IMG/M |
3300009499|Ga0114930_10567968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 502 | Open in IMG/M |
3300010293|Ga0116204_1044777 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
3300010354|Ga0129333_10006965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10706 | Open in IMG/M |
3300010354|Ga0129333_10028032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 5331 | Open in IMG/M |
3300010354|Ga0129333_10041557 | All Organisms → Viruses → Predicted Viral | 4323 | Open in IMG/M |
3300010354|Ga0129333_10225443 | All Organisms → Viruses → Predicted Viral | 1698 | Open in IMG/M |
3300010354|Ga0129333_10801192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 803 | Open in IMG/M |
3300010370|Ga0129336_10123461 | All Organisms → Viruses → Predicted Viral | 1508 | Open in IMG/M |
3300010885|Ga0133913_12726843 | All Organisms → Viruses → Predicted Viral | 1194 | Open in IMG/M |
3300013087|Ga0163212_1001422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 10585 | Open in IMG/M |
(restricted) 3300013125|Ga0172369_10231673 | All Organisms → Viruses → Predicted Viral | 1029 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10196762 | Not Available | 1274 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10623132 | Not Available | 576 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10762537 | Not Available | 505 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10771513 | Not Available | 501 | Open in IMG/M |
(restricted) 3300013127|Ga0172365_10131323 | Not Available | 1575 | Open in IMG/M |
(restricted) 3300013128|Ga0172366_10309789 | Not Available | 979 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10023294 | Not Available | 6340 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10543949 | Not Available | 763 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10705346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 635 | Open in IMG/M |
3300013372|Ga0177922_11341635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 670 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10576128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 620 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10746583 | Not Available | 526 | Open in IMG/M |
3300017788|Ga0169931_10239511 | All Organisms → Viruses → Predicted Viral | 1495 | Open in IMG/M |
3300017963|Ga0180437_10001278 | Not Available | 43373 | Open in IMG/M |
3300019784|Ga0181359_1220398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus | 597 | Open in IMG/M |
3300020074|Ga0194113_10000060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 106832 | Open in IMG/M |
3300020074|Ga0194113_10013874 | Not Available | 9324 | Open in IMG/M |
3300020074|Ga0194113_10062124 | All Organisms → Viruses → Predicted Viral | 3512 | Open in IMG/M |
3300020074|Ga0194113_10108812 | Not Available | 2403 | Open in IMG/M |
3300020074|Ga0194113_10135691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2072 | Open in IMG/M |
3300020074|Ga0194113_10244016 | All Organisms → Viruses → Predicted Viral | 1400 | Open in IMG/M |
3300020074|Ga0194113_10287634 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
3300020074|Ga0194113_10321378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1165 | Open in IMG/M |
3300020074|Ga0194113_10469038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 910 | Open in IMG/M |
3300020074|Ga0194113_10528753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 842 | Open in IMG/M |
3300020074|Ga0194113_10535791 | Not Available | 835 | Open in IMG/M |
3300020074|Ga0194113_10581526 | Not Available | 792 | Open in IMG/M |
3300020074|Ga0194113_10817462 | Not Available | 636 | Open in IMG/M |
3300020074|Ga0194113_10858927 | Not Available | 616 | Open in IMG/M |
3300020074|Ga0194113_10969908 | Not Available | 569 | Open in IMG/M |
3300020084|Ga0194110_10639109 | Not Available | 668 | Open in IMG/M |
3300020109|Ga0194112_10604726 | Not Available | 747 | Open in IMG/M |
3300020151|Ga0211736_10193079 | All Organisms → Viruses → Predicted Viral | 1728 | Open in IMG/M |
3300020151|Ga0211736_10701477 | All Organisms → Viruses → Predicted Viral | 2150 | Open in IMG/M |
3300020161|Ga0211726_10306058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 899 | Open in IMG/M |
3300020172|Ga0211729_10848942 | All Organisms → Viruses | 2231 | Open in IMG/M |
3300020179|Ga0194134_10010107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Libanvirus → Prochlorococcus virus PTIM40 → Cyanophage P-TIM40 | 7515 | Open in IMG/M |
3300020179|Ga0194134_10242392 | Not Available | 744 | Open in IMG/M |
3300020183|Ga0194115_10014664 | All Organisms → Viruses | 6687 | Open in IMG/M |
3300020193|Ga0194131_10397682 | Not Available | 618 | Open in IMG/M |
3300020196|Ga0194124_10052290 | All Organisms → Viruses | 2543 | Open in IMG/M |
3300020198|Ga0194120_10349863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 717 | Open in IMG/M |
3300020204|Ga0194116_10093839 | Not Available | 1937 | Open in IMG/M |
3300020204|Ga0194116_10154317 | All Organisms → Viruses | 1372 | Open in IMG/M |
3300020214|Ga0194132_10185078 | Not Available | 1194 | Open in IMG/M |
3300020214|Ga0194132_10225623 | Not Available | 1040 | Open in IMG/M |
3300020214|Ga0194132_10336432 | All Organisms → Viruses | 789 | Open in IMG/M |
3300020220|Ga0194119_10225877 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
3300020220|Ga0194119_10548008 | All Organisms → Viruses | 720 | Open in IMG/M |
3300020222|Ga0194125_10303905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1055 | Open in IMG/M |
3300021376|Ga0194130_10013911 | All Organisms → Viruses | 7489 | Open in IMG/M |
3300021376|Ga0194130_10088279 | All Organisms → Viruses → Predicted Viral | 2053 | Open in IMG/M |
3300021376|Ga0194130_10194044 | All Organisms → Viruses → Predicted Viral | 1205 | Open in IMG/M |
3300021376|Ga0194130_10306624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 879 | Open in IMG/M |
3300021376|Ga0194130_10311040 | Not Available | 870 | Open in IMG/M |
3300021376|Ga0194130_10323250 | Not Available | 847 | Open in IMG/M |
3300021376|Ga0194130_10431266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 691 | Open in IMG/M |
3300021425|Ga0213866_10200081 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
3300021961|Ga0222714_10048298 | All Organisms → Viruses → Predicted Viral | 2972 | Open in IMG/M |
3300021961|Ga0222714_10290682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 900 | Open in IMG/M |
3300021961|Ga0222714_10341031 | Not Available | 808 | Open in IMG/M |
3300021962|Ga0222713_10284657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1061 | Open in IMG/M |
3300021962|Ga0222713_10534482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 695 | Open in IMG/M |
3300021963|Ga0222712_10251834 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
3300022179|Ga0181353_1146099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 547 | Open in IMG/M |
3300022190|Ga0181354_1153248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 719 | Open in IMG/M |
3300022213|Ga0224500_10157452 | Not Available | 846 | Open in IMG/M |
3300022752|Ga0214917_10000005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 250224 | Open in IMG/M |
3300024262|Ga0210003_1340196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 562 | Open in IMG/M |
3300024351|Ga0255141_1033818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 766 | Open in IMG/M |
3300024353|Ga0209979_1204324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 691 | Open in IMG/M |
3300025674|Ga0208162_1000759 | All Organisms → Viruses | 17704 | Open in IMG/M |
3300027121|Ga0255074_1002290 | All Organisms → Viruses → Predicted Viral | 2830 | Open in IMG/M |
3300027121|Ga0255074_1005507 | All Organisms → Viruses → Predicted Viral | 1758 | Open in IMG/M |
3300027494|Ga0255094_1070180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 616 | Open in IMG/M |
3300027720|Ga0209617_10238300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 692 | Open in IMG/M |
3300027763|Ga0209088_10003274 | Not Available | 9595 | Open in IMG/M |
3300027763|Ga0209088_10027198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2903 | Open in IMG/M |
3300027763|Ga0209088_10064880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1739 | Open in IMG/M |
3300027917|Ga0209536_102804928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300027940|Ga0209893_1004761 | Not Available | 977 | Open in IMG/M |
3300029930|Ga0119944_1010519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus | 1388 | Open in IMG/M |
3300029930|Ga0119944_1015777 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
3300029933|Ga0119945_1024922 | All Organisms → Viruses | 698 | Open in IMG/M |
3300031566|Ga0307378_10157030 | All Organisms → Viruses → Predicted Viral | 2286 | Open in IMG/M |
3300032173|Ga0315268_10583797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1108 | Open in IMG/M |
3300033233|Ga0334722_11315454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 505 | Open in IMG/M |
3300033816|Ga0334980_0040069 | All Organisms → Viruses → Predicted Viral | 1993 | Open in IMG/M |
3300034073|Ga0310130_0062953 | All Organisms → Viruses | 1104 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 27.66% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.93% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.09% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.96% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.26% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.26% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.55% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.55% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 3.55% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.84% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.84% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.84% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.84% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 2.13% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.13% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.13% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 2.13% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.42% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.71% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.71% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.71% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.71% |
Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.71% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.71% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.71% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.71% |
Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.71% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.71% |
Brackish Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water | 0.71% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.71% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.71% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.71% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000126 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5m | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005645 | Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009451 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
3300024353 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027494 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300027940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
BS_KBB_SWE26_205mDRAFT_10402433 | 3300000126 | Marine | MAKSSNKGKKGSNGSKQNQGNATAKNAKNGGKKK* |
JGI12421J11937_100571121 | 3300000756 | Freshwater And Sediment | MGKSTNKDKKGSAGGKQSKQNQGNATANKAKNGGKKK* |
RCM41_10125971 | 3300001847 | Marine Plankton | KSANKGKKGSGGSNSKQNQGNATAKKAKNGGKKK* |
RCM47_10135181 | 3300001848 | Marine Plankton | MAKSANKGKKGSGGSNSKQNQGNATAKKAKNGGKKK* |
RCM47_10742553 | 3300001848 | Marine Plankton | MSKSPNKGKKGSGGAGSANNKKQNSGNATAKKAKNGGKKK* |
RCM37_10283313 | 3300001850 | Marine Plankton | MSKSANKGKKGSGGAGSANNKKQNSGNANAKKAKNGGKKK* |
RCM31_100608463 | 3300001851 | Marine Plankton | MAKSANKGKKGSGGAGSANNKKQNQGNATAKKAKNGGKKK* |
GOS2236_10183022 | 3300001968 | Marine | MAKSPNKGKKGSGGAGSANNKKQNSGNATAKKAKNGGKKK* |
GOS2236_10609145 | 3300001968 | Marine | MSKSANKGKKGSGGAGSSNNKKQNSGNAIAKKAKNGGKKK* |
GOS2236_10744383 | 3300001968 | Marine | RYKLMAKSANKGKKGSGGAGSANNKKQNSGNATAKKAKNGGKKK* |
GOS2236_10812725 | 3300001968 | Marine | MAKSANKAKKGGAGSANNKKQNSGNANANKAKNGGKKK* |
Ga0007787_104791983 | 3300004240 | Freshwater Lake | PHRRSIMAKSANKGKKGSAGGKNSKQNQGNATANKAKNGGKKK* |
Ga0068876_101732632 | 3300005527 | Freshwater Lake | MAKSANKGKKGSAGGKNSKQNQGNATANKAKNGGKKK* |
Ga0077109_11632272 | 3300005645 | Brackish Water | MGKSANKGKKGSVGGKQSKQNQGNATANKAKNGGKKK* |
Ga0079957_10394054 | 3300005805 | Lake | MAKSANKGKKGSGGAGSANNKKQNAGNANAKKAKNGGKKK* |
Ga0066377_102675302 | 3300005934 | Marine | MSKSPNKGKKGSAGNKKQNQGNATANKAKNGGKKK* |
Ga0073926_100834331 | 3300005943 | Sand | SLMSKSANKGKNGSAGGQKNSKQNQGNASAKKAKNGGKKK* |
Ga0073922_10106203 | 3300005955 | Sand | MSKSPNKGKKGTAGGKQNQGNATAKKAKNGGKKK* |
Ga0075458_102214271 | 3300007363 | Aqueous | MSKSANKGNKGSAGNKKQNQGNATAKKAKNGGKKK* |
Ga0099851_12953392 | 3300007538 | Aqueous | MAKSPNKGKKGSAGGKRPKQNQGNATARKAKNGGKKR* |
Ga0099848_11331372 | 3300007541 | Aqueous | MAKSANKGKKGSGGAGSANNKKQNSGNANAKKAKNGGKKK* |
Ga0099848_12110873 | 3300007541 | Aqueous | MSKSPNKGKKGSAGGKQSKQNQGNATAKKAKNGGKK |
Ga0099846_12645831 | 3300007542 | Aqueous | MAKSPNKGKKGSNGSRQNQGNATAKKAKNGGKKK* |
Ga0102861_10327041 | 3300007544 | Estuarine | SSTPHRWSIMAKSANKGKKGSAGGKNSKQNQGNATANKAKNGGKKK* |
Ga0070751_13474111 | 3300007640 | Aqueous | MAKSANKGKKGSADNKPQNQGNATAKKAKNGGKKK* |
Ga0102862_10216503 | 3300007670 | Estuarine | MGKSTNKDKKGSAGGKQSKQNQGNATANKAKDGGKKK* |
Ga0114340_10081502 | 3300008107 | Freshwater, Plankton | MAKSANKGKKGSCGSKQNQGNATAKKAKNGGKKK* |
Ga0114343_11558621 | 3300008110 | Freshwater, Plankton | MAKSANKGKKGSAGGKQNQGNATANKAKNGGKKK* |
Ga0114344_10921152 | 3300008111 | Freshwater, Plankton | MAKSANKGKKGSGGSKQNQGNATAKKAKNGGKKK* |
Ga0114346_12885742 | 3300008113 | Freshwater, Plankton | MSKSASKGKKGSGGAGASNNKKQNSGNANAKKAKNGGKKK* |
Ga0114876_10366821 | 3300008448 | Freshwater Lake | MSKSANKGKKGSAGGKQPKQNQGNATAKKAKNGGKNM* |
Ga0102830_12225402 | 3300009059 | Estuarine | MAKSANKGKKGSAGGKQNQGNATAKKAKNGGKKK* |
Ga0105090_109366241 | 3300009075 | Freshwater Sediment | VAKSAGKGKKGSAGSKQNQGNATAKKAKNGGKKK* |
Ga0114980_105923772 | 3300009152 | Freshwater Lake | MAKSVNKGKKGSNGSKQNQGNATAKKAKNGGKKK* |
Ga0114978_1000181725 | 3300009159 | Freshwater Lake | MAKSANKGNKGSAGGKQPKQNQGNATAKKAKNGGKKK* |
Ga0114978_100094589 | 3300009159 | Freshwater Lake | MGKSANKGKKGSAGGKQSKQNQGNATANKAKNGGKKK* |
Ga0114978_100270327 | 3300009159 | Freshwater Lake | MSKSASKGKKGSAGGKQSKQNQGNATANKAKNGGKKK* |
Ga0114978_103928431 | 3300009159 | Freshwater Lake | KSANKGKKGSAGGKQSKQNQGNATANKAKNGGKKK* |
Ga0114979_100261318 | 3300009180 | Freshwater Lake | MPKSVNKGKKGSGSGNQSKQNQGNATANKAKNGGKKK* |
Ga0127402_11278251 | 3300009451 | Meromictic Pond | VPKSPNKGKNGSTGGKRPKQNQGNATAKKAKNGGKKR* |
Ga0126448_10624681 | 3300009466 | Meromictic Pond | VPKSPNKGKNGSTGGKRPKQNQGNATAKKAKNGGKKK* |
Ga0114930_105679681 | 3300009499 | Deep Subsurface | MSKSASKGKKGSAGGKQSKQNQGNATANKAKNGGK |
Ga0116204_10447773 | 3300010293 | Anoxic Lake Water | MAKSANKGKKGSTGGQKNSKQNQGNATANKAKNGGKKK* |
Ga0129333_1000696516 | 3300010354 | Freshwater To Marine Saline Gradient | MAKSPNKGKKGSAGGKQPKQNQGNATAKKAKNGGKKR* |
Ga0129333_100280323 | 3300010354 | Freshwater To Marine Saline Gradient | MSKSPNKGKKGSGGAGSANNKKQNSGNANAKKAKNGGKKK* |
Ga0129333_100415574 | 3300010354 | Freshwater To Marine Saline Gradient | MAKSANKGKKGSGGAGSANNKKQNSGNATAKKAKNGGKKK* |
Ga0129333_102254433 | 3300010354 | Freshwater To Marine Saline Gradient | MAKSANKGKKGSAGGKNSKQNQGNATANKAKNGGK |
Ga0129333_108011922 | 3300010354 | Freshwater To Marine Saline Gradient | MMAKSANKGKKGSGGSKQNQGNATAKKAKNGGKKK* |
Ga0129336_101234614 | 3300010370 | Freshwater To Marine Saline Gradient | MAKSANKGKKGSAGNKKQNQGNATANKAKNGGKKK* |
Ga0133913_127268431 | 3300010885 | Freshwater Lake | QTMGKSANKGKKGSAGGKQSKQNQGNATANKAKNGGKKK* |
Ga0163212_10014221 | 3300013087 | Freshwater | MAKSANKGKKGSPGGQKNSKQNQGNATANKAKNGGKKR* |
(restricted) Ga0172369_102316734 | 3300013125 | Freshwater | MSKSPNKGKKGSAGGQKNSKQNQGNATANKAKNGGKKK* |
(restricted) Ga0172367_101967623 | 3300013126 | Freshwater | MSKSPNKGKKGSPGGQKNSKQNQGNATANKAKNGGKKK* |
(restricted) Ga0172367_106231323 | 3300013126 | Freshwater | MAKSANKGKKGSAGGQKNSKQNQGNATANKAKNGGKKK* |
(restricted) Ga0172367_107625372 | 3300013126 | Freshwater | MSKSLNKGKKGSHGFKQNQGNATAKKAKNGGKKK* |
(restricted) Ga0172367_107715132 | 3300013126 | Freshwater | MSKSANKGKKGSTGGQKNSKQNQGNATANKAKNGGKKK* |
(restricted) Ga0172365_101313234 | 3300013127 | Sediment | VPKSPNKGKKGCAGGKRPKQNQGNATAKKAKNGGKKR* |
(restricted) Ga0172366_103097891 | 3300013128 | Sediment | KSPNKGKKGSAGGQKNSKQNQGNATANKAKNGGKKK* |
(restricted) Ga0172373_1002329411 | 3300013131 | Freshwater | VPKSPNKGKKGCAGGKRPKQNQGNATDKKAKNGGKKR* |
(restricted) Ga0172375_105439492 | 3300013137 | Freshwater | MAKSANKGKKGTTGGQKNSKQNHGNATANKAKNGGKKK* |
(restricted) Ga0172375_107053462 | 3300013137 | Freshwater | MAKSANKGKKGSPGGQKNSKQNQGNATANKAKNGGKKK* |
Ga0177922_113416352 | 3300013372 | Freshwater | MAKSVNKGKKGSTGSKQNQGNSTAKKAKNGGKKK* |
(restricted) Ga0172376_105761283 | 3300014720 | Freshwater | AKSANKGKKGSTGGQKNSKQNQGNATANKAKNGGKKK* |
(restricted) Ga0172376_107465831 | 3300014720 | Freshwater | VSKSPNKGKKGSAGGQKNSKQNQGNATANKAKNGGKKK* |
Ga0169931_102395113 | 3300017788 | Freshwater | MSKSPNKGKKGSAGGQKNSKQNQGNATANKAKNGGKKK |
Ga0180437_100012788 | 3300017963 | Hypersaline Lake Sediment | VPKSPNKGKKDCTGGKHPKQNQGNATAKKGKNGGKKR |
Ga0181359_12203983 | 3300019784 | Freshwater Lake | MAKSANKGKKGSAGGKNSKQNQGNATANKAKNGGKKK |
Ga0194113_10000060105 | 3300020074 | Freshwater Lake | MAKSPNKGKKGSSGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194113_1001387411 | 3300020074 | Freshwater Lake | MAKSPNKGKKGSPGGQKNSKQNQGNATANKAKNGGKKR |
Ga0194113_100621245 | 3300020074 | Freshwater Lake | MAKSSNKGKKGSTGNKKQNQGNVTANKAKNGGKKK |
Ga0194113_101088126 | 3300020074 | Freshwater Lake | VTKSANKGKKGSAGGKQSKQNCGNATAKKAKNGGKKK |
Ga0194113_101356913 | 3300020074 | Freshwater Lake | MAKSANKGKKGSPGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194113_102440164 | 3300020074 | Freshwater Lake | RSIMAKSPNKGKKGSTGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194113_102876342 | 3300020074 | Freshwater Lake | VAKSANKGKKGSAGGKQSKQNCGNATAKKAKNGGKKK |
Ga0194113_103213782 | 3300020074 | Freshwater Lake | MMAKSANKGKKGSGGAGSANNKKQNSGNATAKKAKNGGKRK |
Ga0194113_104690382 | 3300020074 | Freshwater Lake | MAKSPNKGKKGSPGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194113_105287532 | 3300020074 | Freshwater Lake | MSKSPNKGKKGSPGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194113_105357911 | 3300020074 | Freshwater Lake | GRTSPTSHRSVMAKSPNKGKKGSTGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194113_105815263 | 3300020074 | Freshwater Lake | MAKSANKGKKGSSGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194113_108174623 | 3300020074 | Freshwater Lake | MAKSPNKGKKGSSGGQKNSKQNQGNATANKAKNGGKKR |
Ga0194113_108589272 | 3300020074 | Freshwater Lake | MSKSPNKGKKGSSGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194113_109699082 | 3300020074 | Freshwater Lake | MAKSPNKGKKGSAGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194110_106391091 | 3300020084 | Freshwater Lake | KSSNKGKKGSGGAGSANNKKQNSGNATAKKAKNGGKRK |
Ga0194112_106047263 | 3300020109 | Freshwater Lake | MMSKSPNKGKKGSTGGQKNSKQNQGNATANKAKNGGKKK |
Ga0211736_101930791 | 3300020151 | Freshwater | HGGIMAKSANKGKKGSAGGKNSKQNQGNATANKAKNGGKKK |
Ga0211736_107014772 | 3300020151 | Freshwater | MSKSANKGKKGSAGNKKQNQGNATANKAKNGGKKK |
Ga0211726_103060582 | 3300020161 | Freshwater | MAKSANKNKKGTSGGKNSKQNQGNATANKAKNGGKKK |
Ga0211729_108489422 | 3300020172 | Freshwater | MAKSANKGKKGSAGGKYSKQNQGNATANKAKNGGKKK |
Ga0194134_100101078 | 3300020179 | Freshwater Lake | MSKSPNKGKKGSPGGQKNSKQNQGNATAKKAKNGG |
Ga0194134_102423922 | 3300020179 | Freshwater Lake | MSKSPNKGKKGSTGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194115_1001466413 | 3300020183 | Freshwater Lake | MSKSPNRGKKGSPGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194131_103976822 | 3300020193 | Freshwater Lake | MAKSPNKGKKGSGGAGSANNKKQNSGNATAKKAKNGGKRK |
Ga0194124_100522909 | 3300020196 | Freshwater Lake | RSMMSKSPNRGKKGSPGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194120_103498631 | 3300020198 | Freshwater Lake | LMAKSSNKGKKGSTGNKKQNQGNVTANKAKNGGKKK |
Ga0194116_100938392 | 3300020204 | Freshwater Lake | MHRSIMSKSPNKGKKGSSGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194116_101543173 | 3300020204 | Freshwater Lake | MAKSANKGKKGGAGSVNNKKQNSGNANAKKAKNGG |
Ga0194132_101850784 | 3300020214 | Freshwater Lake | MMSKSPNKGKKGSPGGQKNSKQNQGNATANKAKNGGKKN |
Ga0194132_102256234 | 3300020214 | Freshwater Lake | MAKSANKGKKGSTGGQKNSKQNQGNATANKAKNGGKKR |
Ga0194132_103364323 | 3300020214 | Freshwater Lake | MAKSPNKGKKGSTGGQKNSKQNQGNATAKKAKNGGK |
Ga0194119_102258771 | 3300020220 | Freshwater Lake | MAKSANKGKKGSPGGQKNSKQNQGNATANKAKNGGK |
Ga0194119_105480081 | 3300020220 | Freshwater Lake | MSKSANKGKKGSTGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194125_103039051 | 3300020222 | Freshwater Lake | SSTSHRSVMAKSANKGKKGSTGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194130_100139119 | 3300021376 | Freshwater Lake | MAKSPNKGKKGSTGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194130_100882791 | 3300021376 | Freshwater Lake | MAKSANKGKKGSTGGQKNSKQNQGNATANKAKNGG |
Ga0194130_101940443 | 3300021376 | Freshwater Lake | MAKSANKGKKGSGGAGSANNKKQNSGNATAKKAKNGGKKK |
Ga0194130_103066242 | 3300021376 | Freshwater Lake | MMSKSPNKGKKGSPGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194130_103110403 | 3300021376 | Freshwater Lake | MAKSANKGKKGSTGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194130_103232502 | 3300021376 | Freshwater Lake | MMAKSANKGKKGSTGGQKNSKQNQGNATANKAKNGGKKK |
Ga0194130_104312663 | 3300021376 | Freshwater Lake | MAKSANKGKKGSTGGQKNSKQNQGNAIANKAKNGGKKK |
Ga0213866_102000813 | 3300021425 | Seawater | MSKSPNKGKKGSSGGKQSKQNQGNATARKAKNGGKKR |
Ga0222714_100482983 | 3300021961 | Estuarine Water | MAKSANKGKKGSGGAGSANNKKQNSGNANAKKAKNGGKKK |
Ga0222714_102906822 | 3300021961 | Estuarine Water | MAKSANKGKKGGAGSANNKNQNSGNATAKKAKNGGKKK |
Ga0222714_103410312 | 3300021961 | Estuarine Water | MSKSPNKGKKGSGGAGSANNKKQNSGNANAKKAKNGGKKK |
Ga0222713_102846573 | 3300021962 | Estuarine Water | MGKSTNKDKKGSAGGKQSKQNQGNATANKVKNGGKKK |
Ga0222713_105344823 | 3300021962 | Estuarine Water | MAKSANKGKKGSAGNKKQNQGNATANKAKNGGKKK |
Ga0222712_102518341 | 3300021963 | Estuarine Water | GVRHTPHRSIMSKSPNKGKKGSGGAGSANNKKQNSGNANAKKAKNGGKKK |
Ga0181353_11460991 | 3300022179 | Freshwater Lake | RSIMAKSANKGKKGSAGGKNSKQNQGNATANKAKNGGKKK |
Ga0181354_11532483 | 3300022190 | Freshwater Lake | MGKSANKGKKGSVGGKQSKQNQGNATANKAKNGGKKK |
Ga0224500_101574522 | 3300022213 | Sediment | MSKSANKGNKGSAGNKKQNQGNATAKKAKNGGKKK |
Ga0214917_10000005218 | 3300022752 | Freshwater | MAKSANKAKKGGAGSANNKKQNSGNANANKAKNGGKKK |
Ga0210003_13401961 | 3300024262 | Deep Subsurface | VPKSPNKGKNGSTGGKRPKQNQGNAAAKKAKNGGKKK |
Ga0255141_10338182 | 3300024351 | Freshwater | MAKSANKGKKGGAGSANNKKQNSGNANAKQAKNGGKKK |
Ga0209979_12043243 | 3300024353 | Deep Subsurface | MSKSASKGKKGSAGGKQSKQNQGNATANKAKNGGKKK |
Ga0208162_100075923 | 3300025674 | Aqueous | MAKSPNKGKKGSAGGKRPKQNQGNATARKAKNGGKKR |
Ga0255074_10022904 | 3300027121 | Freshwater | MSKSANKGKNGSAGGQKNSKQNQGNASAKKAKNGGKKK |
Ga0255074_10055076 | 3300027121 | Freshwater | RWSIMAKSANKGKKGSAGGKNSKQNQGNATANKAKNGGKKK |
Ga0255094_10701801 | 3300027494 | Freshwater | TSHRSLMSKSANKGKNGSAGGQKNSKQNQGNASAKKAKNGGKKK |
Ga0209617_102383001 | 3300027720 | Freshwater And Sediment | TPHRWSIMAKSANKGKKGSAGGKNSKQNQGNATANKAKNGGKKK |
Ga0209088_100032749 | 3300027763 | Freshwater Lake | MAKSANKGNKGSAGGKQPKQNQGNATAKKAKNGGKKK |
Ga0209088_100271987 | 3300027763 | Freshwater Lake | MPKSVNKGKKGSGSGNQSKQNQGNATANKAKNGGKKK |
Ga0209088_100648802 | 3300027763 | Freshwater Lake | MGKSANKGKKGSAGGKQSKQNQGNATANKAKNGGKKK |
Ga0209536_1028049281 | 3300027917 | Marine Sediment | VSKSPNKGKKGSAGGKQSKQNQGNATAKKAKNGGKK |
Ga0209893_10047613 | 3300027940 | Sand | MGKSTNKDKKGSAGGKQSKQNQGNATANKAKDGGK |
Ga0119944_10105193 | 3300029930 | Aquatic | MAKSANKAKKGGAGSANNKKQNQGNATANKAKNGGKKK |
Ga0119944_10157771 | 3300029930 | Aquatic | MSKSANKGKKGSSGGQKNSKQNQGNASAKKAKNGG |
Ga0119945_10249221 | 3300029933 | Aquatic | MAKSANKGKKGGAGSANNKKQNSGNAVAKKAKNGGKKK |
Ga0307378_101570305 | 3300031566 | Soil | VELLMSKSPNKGKKGTPGGKQNQGNATAKKAKNGGKKK |
Ga0315268_105837973 | 3300032173 | Sediment | MAKSANKGKKGSAGGKNSKQNHGNATANKAKNGGKKK |
Ga0334722_113154542 | 3300033233 | Sediment | MMAKSSNKGKKGSNGSKQNQGNAIAKKAKNGGKKK |
Ga0334980_0040069_167_289 | 3300033816 | Freshwater | MSKSANKGKKGSGGAGSANNKKQNSGNANAKKAKNGGKKK |
Ga0310130_0062953_606_716 | 3300034073 | Fracking Water | VAKSANKGKKGSNGNGSKQNQGNATAKKAKNGGKKK |
⦗Top⦘ |