NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F053100

Metagenome Family F053100

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F053100
Family Type Metagenome
Number of Sequences 141
Average Sequence Length 48 residues
Representative Sequence VWYTSPPALSDMSCRSRVICVGMLAEPARCDTPVPQPLSVMNSVKAKKW
Number of Associated Samples 8
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 72.34 %
% of genes near scaffold ends (potentially truncated) 27.66 %
% of genes from short scaffolds (< 2000 bps) 19.15 %
Associated GOLD sequencing projects 6
AlphaFold2 3D model prediction Yes
3D model pTM-score0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.291 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules
(59.575 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(100.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 3.90%    β-sheet: 0.00%    Coil/Unstructured: 96.10%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF00665rve 12.95
PF00078RVT_1 9.35
PF13456RVT_3 3.60
PF07727RVT_2 3.60
PF14223Retrotran_gag_2 2.88
PF14244Retrotran_gag_3 2.16
PF10551MULE 0.72
PF12972NAGLU_C 0.72
PF07731Cu-oxidase_2 0.72
PF13952DUF4216 0.72
PF00098zf-CCHC 0.72
PF14392zf-CCHC_4 0.72
PF13976gag_pre-integrs 0.72
PF02992Transposase_21 0.72
PF08284RVP_2 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 12.95
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 12.95
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 12.95
COG4584TransposaseMobilome: prophages, transposons [X] 12.95
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.72

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006943|Ga0099822_1003332All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta20556Open in IMG/M
3300006943|Ga0099822_1004373All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata18396Open in IMG/M
3300006943|Ga0099822_1006929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata14713Open in IMG/M
3300006943|Ga0099822_1008544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata13072Open in IMG/M
3300006943|Ga0099822_1009955All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11872Open in IMG/M
3300006943|Ga0099822_1011743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata10628Open in IMG/M
3300006943|Ga0099822_1017261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7750Open in IMG/M
3300006943|Ga0099822_1017385All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7693Open in IMG/M
3300006943|Ga0099822_1017767All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7536Open in IMG/M
3300006943|Ga0099822_1020078All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6697Open in IMG/M
3300006943|Ga0099822_1023592All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5638Open in IMG/M
3300006943|Ga0099822_1024268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5453Open in IMG/M
3300006943|Ga0099822_1024479All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5400Open in IMG/M
3300006943|Ga0099822_1026558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4885Open in IMG/M
3300006943|Ga0099822_1026659All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4860Open in IMG/M
3300006943|Ga0099822_1027652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4637Open in IMG/M
3300006943|Ga0099822_1030651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4036Open in IMG/M
3300006943|Ga0099822_1032342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3731Open in IMG/M
3300006943|Ga0099822_1033429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3543Open in IMG/M
3300006943|Ga0099822_1034941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3304Open in IMG/M
3300006943|Ga0099822_1036450All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3086Open in IMG/M
3300006943|Ga0099822_1037236All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2981Open in IMG/M
3300006943|Ga0099822_1037698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2920Open in IMG/M
3300006943|Ga0099822_1038699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2796Open in IMG/M
3300006943|Ga0099822_1041670All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2456Open in IMG/M
3300006943|Ga0099822_1041920All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2427Open in IMG/M
3300006943|Ga0099822_1042513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2369Open in IMG/M
3300006943|Ga0099822_1046408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2031Open in IMG/M
3300006943|Ga0099822_1054840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1501Open in IMG/M
3300006943|Ga0099822_1056921All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1407Open in IMG/M
3300006943|Ga0099822_1057084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1400Open in IMG/M
3300006943|Ga0099822_1058265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1350Open in IMG/M
3300006943|Ga0099822_1058453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1343Open in IMG/M
3300006943|Ga0099822_1075986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata876Open in IMG/M
3300006943|Ga0099822_1078329All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata837Open in IMG/M
3300006943|Ga0099822_1079171All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata824Open in IMG/M
3300006943|Ga0099822_1080600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata801Open in IMG/M
3300006943|Ga0099822_1092149All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata667Open in IMG/M
3300006943|Ga0099822_1093567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata654Open in IMG/M
3300006944|Ga0099823_1044969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2968Open in IMG/M
3300006944|Ga0099823_1045221All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2946Open in IMG/M
3300006944|Ga0099823_1064747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1788Open in IMG/M
3300006944|Ga0099823_1104242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata838Open in IMG/M
3300006944|Ga0099823_1105806All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata820Open in IMG/M
3300006944|Ga0099823_1138445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata562Open in IMG/M
3300006944|Ga0099823_1138539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata562Open in IMG/M
3300021320|Ga0214544_1000393All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata77487Open in IMG/M
3300021320|Ga0214544_1000707All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata64266Open in IMG/M
3300021320|Ga0214544_1000995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna56574Open in IMG/M
3300021320|Ga0214544_1002031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata42684Open in IMG/M
3300021320|Ga0214544_1002128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna41760Open in IMG/M
3300021320|Ga0214544_1003513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata32303Open in IMG/M
3300021320|Ga0214544_1003726All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta31147Open in IMG/M
3300021320|Ga0214544_1003737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata31075Open in IMG/M
3300021320|Ga0214544_1004113All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata29423Open in IMG/M
3300021320|Ga0214544_1004536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata27838Open in IMG/M
3300021320|Ga0214544_1005026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna26005Open in IMG/M
3300021320|Ga0214544_1005990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata22934Open in IMG/M
3300021320|Ga0214544_1006170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata22415Open in IMG/M
3300021320|Ga0214544_1006295All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae22043Open in IMG/M
3300021320|Ga0214544_1006320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata21970Open in IMG/M
3300021320|Ga0214544_1006678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata21016Open in IMG/M
3300021320|Ga0214544_1007456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata19179Open in IMG/M
3300021320|Ga0214544_1007580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata18906Open in IMG/M
3300021320|Ga0214544_1008688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata16628Open in IMG/M
3300021320|Ga0214544_1008776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna16474Open in IMG/M
3300021320|Ga0214544_1008782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata16458Open in IMG/M
3300021320|Ga0214544_1008906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata16269Open in IMG/M
3300021320|Ga0214544_1008906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata16269Open in IMG/M
3300021320|Ga0214544_1009083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata15880Open in IMG/M
3300021320|Ga0214544_1009728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata14789Open in IMG/M
3300021320|Ga0214544_1009744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata14759Open in IMG/M
3300021320|Ga0214544_1010337All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata13804Open in IMG/M
3300021320|Ga0214544_1010895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata13020Open in IMG/M
3300021320|Ga0214544_1011104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata12716Open in IMG/M
3300021320|Ga0214544_1011282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata12442Open in IMG/M
3300021320|Ga0214544_1011295All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata12429Open in IMG/M
3300021320|Ga0214544_1011341All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata12375Open in IMG/M
3300021320|Ga0214544_1012431All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11076Open in IMG/M
3300021320|Ga0214544_1013405All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata9944Open in IMG/M
3300021320|Ga0214544_1013986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata9340Open in IMG/M
3300021320|Ga0214544_1014862All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8450Open in IMG/M
3300021320|Ga0214544_1014997All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8330Open in IMG/M
3300021320|Ga0214544_1015146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8203Open in IMG/M
3300021320|Ga0214544_1015873All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7593Open in IMG/M
3300021320|Ga0214544_1016670All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata6973Open in IMG/M
3300021320|Ga0214544_1016802All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata6890Open in IMG/M
3300021320|Ga0214544_1016808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata6884Open in IMG/M
3300021320|Ga0214544_1017795All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata6202Open in IMG/M
3300021320|Ga0214544_1017910All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata6127Open in IMG/M
3300021320|Ga0214544_1018424All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5801Open in IMG/M
3300021320|Ga0214544_1018468All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5770Open in IMG/M
3300021320|Ga0214544_1018491All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5756Open in IMG/M
3300021320|Ga0214544_1018785All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5570Open in IMG/M
3300021320|Ga0214544_1019759All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5025Open in IMG/M
3300021320|Ga0214544_1020141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4835Open in IMG/M
3300021320|Ga0214544_1020897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4482Open in IMG/M
3300021320|Ga0214544_1020952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4449Open in IMG/M
3300021320|Ga0214544_1021671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4121Open in IMG/M
3300021320|Ga0214544_1022024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3977Open in IMG/M
3300021320|Ga0214544_1022747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3692Open in IMG/M
3300021320|Ga0214544_1023179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3530Open in IMG/M
3300021320|Ga0214544_1023189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3527Open in IMG/M
3300021320|Ga0214544_1023665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3371Open in IMG/M
3300021320|Ga0214544_1023778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3335Open in IMG/M
3300021320|Ga0214544_1023778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3335Open in IMG/M
3300021320|Ga0214544_1024178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3217Open in IMG/M
3300021320|Ga0214544_1024644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3074Open in IMG/M
3300021320|Ga0214544_1033742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1484Open in IMG/M
3300021320|Ga0214544_1037106All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1218Open in IMG/M
3300021321|Ga0214542_1015969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7532Open in IMG/M
3300021321|Ga0214542_1016576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7070Open in IMG/M
3300021321|Ga0214542_1019570All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5277Open in IMG/M
3300021321|Ga0214542_1021276All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4508Open in IMG/M
3300021321|Ga0214542_1021522All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4395Open in IMG/M
3300021321|Ga0214542_1022204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4126Open in IMG/M
3300021321|Ga0214542_1023264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3752Open in IMG/M
3300021321|Ga0214542_1037805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1358Open in IMG/M
3300021324|Ga0214545_1007556All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata18048Open in IMG/M
3300021324|Ga0214545_1008335All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna16606Open in IMG/M
3300021324|Ga0214545_1009846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata14273Open in IMG/M
3300021324|Ga0214545_1013386All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata10188Open in IMG/M
3300021324|Ga0214545_1020819All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5112Open in IMG/M
3300021324|Ga0214545_1020894All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5078Open in IMG/M
3300021324|Ga0214545_1022128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4545Open in IMG/M
3300021324|Ga0214545_1022789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4295Open in IMG/M
3300021324|Ga0214545_1059161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata630Open in IMG/M
3300021324|Ga0214545_1065152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata539Open in IMG/M
3300021327|Ga0214543_1020378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus5367Open in IMG/M
3300021327|Ga0214543_1024916All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3577Open in IMG/M
3300027296|Ga0209389_1042688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3424Open in IMG/M
3300027296|Ga0209389_1065788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2115Open in IMG/M
3300027296|Ga0209389_1083835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1472Open in IMG/M
3300027296|Ga0209389_1089986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1304Open in IMG/M
3300027296|Ga0209389_1107437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata934Open in IMG/M
3300027296|Ga0209389_1110612All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata879Open in IMG/M
3300027296|Ga0209389_1115574All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata800Open in IMG/M
3300027357|Ga0209589_1013625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata10528Open in IMG/M
3300027357|Ga0209589_1020427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata6206Open in IMG/M
3300027357|Ga0209589_1028604All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3375Open in IMG/M
3300027357|Ga0209589_1050758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1007Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Root NodulesHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules59.57%
Root NodulesHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules40.43%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006943Root nodule microbial communities of legume samples collected from California USA - Cow pea white BWHost-AssociatedOpen in IMG/M
3300006944Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BWHost-AssociatedOpen in IMG/M
3300021320Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3Host-AssociatedOpen in IMG/M
3300021321Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1Host-AssociatedOpen in IMG/M
3300021324Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4Host-AssociatedOpen in IMG/M
3300021327Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2Host-AssociatedOpen in IMG/M
3300027296Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes)Host-AssociatedOpen in IMG/M
3300027357Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0099822_100333233300006943Root NodulesVWYTSPPALSDMSCRSRVICVGMLTELARCDTPVPQPLSVMNNVKAKKW*
Ga0099822_1004373413300006943Root NodulesVWYTSPPALSDGSCRSRVICVGCVGMLAEPVRCGTLVPQPLSVMNNVKAKKW*
Ga0099822_1006929213300006943Root NodulesVWYTSALALADMSFWSRVMCVGMLAEPAKCDTPVPQPLSVMNNVKAKKW*
Ga0099822_100854463300006943Root NodulesVWYTNPPALSDMSCRSRVICVGMLAEPARCDTQVPQPLSVVNSVKVKKW*
Ga0099822_100995563300006943Root NodulesVWYTSPPALSDMSYRSRVISVGMLAEPARCDTPVPQPLTVMNNVKAKKW*
Ga0099822_1011743153300006943Root NodulesVWYTSPPALSDMSCRSRVICVGMLAELARCDTLVPQPLSVMNSVKAKKW*
Ga0099822_101726153300006943Root NodulesVGYTSPLALSDKTCRSRVTCVGMLAEPARCDTPVPQPLSVMNSVKAKKVVTV*
Ga0099822_101738553300006943Root NodulesVWYTSLPALFDVSCWSRVICVGCVGMLAEPARCGTPVPQPLSVVNSVKAKKW*
Ga0099822_1017767143300006943Root NodulesVQYTSPPALSDKICRSRVICVDMLAEPARCDTPVPQPLSVMNSVKAKRW*
Ga0099822_1020078143300006943Root NodulesVWYISPPTLADMSCRSRVICVGMLAEPARCDTPVPQPLSVMNSVKAEKW*
Ga0099822_102359223300006943Root NodulesVWYTSPLALSDGSCRSRVICVGMLAELARCGTPVPQPLSVMNIVKAKKW*
Ga0099822_102426863300006943Root NodulesVWYTSLPALSDGSCRSRVICVGMLAEPARCGTPVPQPLSVVNSVKAKKW*
Ga0099822_102447953300006943Root NodulesVWYTSPPALSDRSCRSRVICVGMLAEPARCDTPVPQPLSVMNIVKAKKGVIV*
Ga0099822_102655883300006943Root NodulesSDMSCRSRVICVNMLAEPARCDTPVPQPLSVVNSVKAKKL*
Ga0099822_102665953300006943Root NodulesVWYTNPPALTDMSCRSRVICVSMLARPARCGTPVPQPLSVMNIVKAEKW*
Ga0099822_102765263300006943Root NodulesVWYTSPPALSDGSYRSRVICVGMLAEPARCGTPVPQPLSVMNSVKAKKW*
Ga0099822_103065153300006943Root NodulesVWYTSPPALSDMSCWSRVICVGMLAEPARCDTLVPQPLSVMNNVKAKKW*
Ga0099822_103234283300006943Root NodulesVWYTSPPAFFDMSCRSRVICVGMLAELARCGTLVPQPLSVMNSVKAKKW*
Ga0099822_103342923300006943Root NodulesVWYTSPPALSDVGYRSRVICVGMLAEPAKCDTPVPQPLSVVNNVKAKKW*
Ga0099822_103494123300006943Root NodulesVWYTSPPALFDGSCRSRVICVGMLTAPARCGTPVPQPLSVMNSVKAKKW*
Ga0099822_103645093300006943Root NodulesWYTSPPALSDGSCRSRVICVGCVGMLAEPARCGTPVPQPLSLMNSVKAKKW*
Ga0099822_103723693300006943Root NodulesVWYTSSPTLFDIGCRSRVICVGMLAEPARCDTPVPQPLSVVNSVKAKKW*
Ga0099822_103769813300006943Root NodulesVWYTSPPALTDMSCRSRVICVGMLAEPARCGTPVPQPLSVMNSVKAKKWLSSEGR*
Ga0099822_103869913300006943Root NodulesVWYTSPLALSDMGCRSRVICVGMLAEPARCDTLVSQPLSVVNSVKAKKW*
Ga0099822_104167023300006943Root NodulesVWYTSPPALSDGSCGSRVICVGCVGMLAEPARCGTPISQPLSVMNSVKAKKW*
Ga0099822_104192083300006943Root NodulesRYTSPPALSDMSCRSRMICVDKLAEPARCDTPVPQPLSVVNSVKAKKVITVRG*
Ga0099822_104251363300006943Root NodulesVWYTSPLALSDGSCRSRVICVGCVGMLAEPVRCGTPVPQPLSVMNSVKAKKW*
Ga0099822_104640833300006943Root NodulesVWYTSPLALSDGSCRSRVICVGCVGMLAELARCGTPVPQPLSVVNSVKAKKW*
Ga0099822_105484053300006943Root NodulesWYTSPPALSDRSYRSRVICVGMLAEPARCDTQVPQALSVMNNVKAKKVVTV*
Ga0099822_105692133300006943Root NodulesLSDMSCRSRVICVGMLAEPARCDTPVPQPLSVMNIVKAKKW*
Ga0099822_105708433300006943Root NodulesRSRVICVGMLAEPARCDTPVPQPLSVMNSVKAKKW*
Ga0099822_105826513300006943Root NodulesSPPALSDMGCRSRMICVGKLAEPARCDTPVPQPLSVVNSVKT*
Ga0099822_105845333300006943Root NodulesSDMGCRSRMTCVGELAKPARCDTPVPQPLSVVNSVKAWKCQ*
Ga0099822_107598623300006943Root NodulesSDKGCRSRMICVDKLAEPARCDTPVPQPLSVVNSVKA*
Ga0099822_107832923300006943Root NodulesLSDMSGRSRVICVNMLAEPARCDTPVPQPLSVVNSVKAKKF*
Ga0099822_107917133300006943Root NodulesSDMSCRPRVICVNVLAEPARCDTPVPQPLSVVNNVKAKNL*
Ga0099822_108060023300006943Root NodulesDMSCRSRVICVNMLAEPARCDTPVPQPLSVVNSVKAKKL*
Ga0099822_109214913300006943Root NodulesRSRVICVGMLAEPARCETQVPQPLSVMNNVKAKKVVTI*
Ga0099822_109356713300006943Root NodulesPPALSDMGCRSRMICVGKLAEPARCDTPVPQPLSVVNSVKGLEFAIVRR*
Ga0099823_104496923300006944Root NodulesVWYTSPPALSNKIYRSRVICVDMLVEPAGCDTPVPQPLSVMNSVKAKRW*
Ga0099823_104522133300006944Root NodulesVWYTSPPALSDMSCRSRVIYVGMLAEPARCDTLVPQPLRVMNSVKAKKW*
Ga0099823_106474743300006944Root NodulesSRVICVGMLAEPARCDTLVPQPLSVMNNVKAKKW*
Ga0099823_110424213300006944Root NodulesPALSDMGCRSRMICVGKLAEPARCDTPVPQPLSVVNSVKA*
Ga0099823_110580633300006944Root NodulesRSRVICVNMLAEPARCDTPVPQPLSVVNSVKAKKL*
Ga0099823_113844513300006944Root NodulesVWYTSPPALSDMSCWSRVICVGMLAEPARCDTLVPQPLSVM
Ga0099823_113853913300006944Root NodulesTSPPALSDRSYRSRVICVGMLAEPARCDTQVPQALSVMNNVKAKKVVTV*
Ga0214544_1000393393300021320Root NodulesVWYTSPPALSDMSCQSRVICVGMLAEPARCDTPVPQPLSVMNIVKAKKW
Ga0214544_100070793300021320Root NodulesVWYTSPPALSDGSCRSRVICVGCVGMLAEPVRCGTLVPQPLSVMNNVKAKKW
Ga0214544_1000995343300021320Root NodulesVWYNSAPALSDMSCRSRVICVNMLAEPARCDTPIPQPLSVVNSVKAKKL
Ga0214544_1002031213300021320Root NodulesVWYTSPPALSDMRCRSRVICVGILAELARCDTPVPQPLSVMNSVKAKKW
Ga0214544_100212873300021320Root NodulesVWYISPPTLADMSCRSRVICVGMLAEPARCDTPVPQPLSVMNSVKAEKW
Ga0214544_1003513153300021320Root NodulesVWYTSPPALSDMSYRSRVISVGMLAEPARCDTPVPQPLTVMNNVKAKKW
Ga0214544_100372633300021320Root NodulesVWYTSPLALSDMSCRSRVICVGMLAEPARCGTPVPQPLSVVNNVKAKRW
Ga0214544_1003737143300021320Root NodulesVWYTSPPALSDGSCRSRVICVGCVGMLAEPARCGTPVPQPLSLMNSVKAKKW
Ga0214544_1004113233300021320Root NodulesVLYTSPPALADMGCRLRVIYVGMLAESARCDTPVPQPLSVMNSVKAKKW
Ga0214544_1004536203300021320Root NodulesVWYTSPPALSDGSCRSRVICVGCVGMLAEPARCGTPVPQPLSVANSVKAKMW
Ga0214544_1005026193300021320Root NodulesVWYTNPPALSDMSCRSRVICVGMLAEPARCDTQVPQPLSVVNSVKVKKW
Ga0214544_1005990103300021320Root NodulesVWYTSPPALSDMSCRSRVICVGMLAELARCDTLVPQPLSVMNSVKAKKW
Ga0214544_100617093300021320Root NodulesVWYTSPPALSDMSCRLRVICVGMLAEPARCDTPVPQPLSVMNSVKAKKW
Ga0214544_1006295193300021320Root NodulesVWYTSPPALSDMSCRSRVICVGMLTELARCDTPVPQPLSVMNNVKAKKW
Ga0214544_100632043300021320Root NodulesVWYTSPPALSDMSCRSRVICVGMLAEPVRCDTPVPQPLSVMNSVKAKKW
Ga0214544_1006678153300021320Root NodulesVWYTSPPALFDMSCRSRVICVGMLAKLARCDTPVPQPLSVMNSVKAKKW
Ga0214544_100745663300021320Root NodulesVWYTSPPALSDMSCRSRVICVNMLAEPARCDTPVPQPLSMVNSVKAKKL
Ga0214544_100758073300021320Root NodulesVWYTSPLALSDMGCRSRVICVGMLAEPARCDTLVSQPLSVVNSVKAKKW
Ga0214544_100868863300021320Root NodulesVWYTNPPALTDMSCRSRVICVSMLARPARCGTPVPQPLSVMNIVKAEKW
Ga0214544_100877693300021320Root NodulesVRYTSPPALSDMSCRLRMICIDKLAEPARCDTPVPQPLSVVNNVKAKKVVTVRG
Ga0214544_1008782123300021320Root NodulesVWYTSPPAFFDMSCRSRVICVGMLAELARCGTLVPQPLSVMNSVKAKKW
Ga0214544_1008906183300021320Root NodulesVGYTSPLALSDKTCRSRVTCVGMLAEPARCDTPVPQPLSVMNSVKAKKVVTV
Ga0214544_100890623300021320Root NodulesVWYTSPPALSDGSRRSRVIYVGCVGILAEPTRCGTLVPQPLSVANSVKAKKW
Ga0214544_1009083233300021320Root NodulesVWYTSPPALSDGSCRSRVICVGCVGMLAGPARCGTPVPQPLSVVNSVKAKKW
Ga0214544_1009728163300021320Root NodulesVWYTSPPALADMSCRSRVICVGMLAEPARCDTPVPQPFSVMNSVKAEK
Ga0214544_100974463300021320Root NodulesVWYTSLPALSDGSCRSRVICVGMLAEPARCGTPVPQPLSVVNSVKAKKW
Ga0214544_101033773300021320Root NodulesVRYTSPPALSDMSYRSRMICVDKLAKPARCDTPVPQPLSVVNSVKAKKVVTVRG
Ga0214544_101089533300021320Root NodulesVWYTSLPALFDVSCWSRVICVGCVGMLAEPARCGTPVPQPLSVVNSVKAKKW
Ga0214544_101110413300021320Root NodulesVWYTSLLALSGMSCRSRVICVGMLTEPARCDTPVPQPLSVMNSVKAKKW
Ga0214544_1011282123300021320Root NodulesVWYTSPPALSNKIYRSRVICVDMLVEPAGCDTPVPQPLSVMNSVKAKRW
Ga0214544_1011295173300021320Root NodulesVWYTSPLTLSDMRCWSRVICVDMLAEPARCDTPVPQPLSVVNSVKAKKW
Ga0214544_101134173300021320Root NodulesVRYTSPPALSDMSCRSRMICVDKLAEPARCDTPVPQPLSVVNSVKAKKVVTVRG
Ga0214544_1012431173300021320Root NodulesVRYTSPPALSDKICRSRVICIGKLVEPARCDTPVPQPLSVMNSVKAKRW
Ga0214544_101340513300021320Root NodulesVWYTSPPALSDMSYWSRVICVGILAEPARCDTPVPQPLSVMNNVKAKKW
Ga0214544_1013986113300021320Root NodulesVWYTSPPALSDRSCRSRVICVGMLAESARCDTPVPQPLSVMNSVKAKKVVTV
Ga0214544_101486253300021320Root NodulesVWYTSPPALSDGSYRSRVICVGMLAEPARCGTPVPQPLSVMNSVKAKKW
Ga0214544_101499733300021320Root NodulesVWYTSPPALSDGSCRSRGICVGCVGMLAEPARCDTPVPQPLSVVNSVKAKKW
Ga0214544_1015146123300021320Root NodulesVRYTSPPALSDMSCRSRMICVDKLAEPARCDTPVPQPLSVVNSVKAKKVITVRG
Ga0214544_101587383300021320Root NodulesVRYTSPPALSDMSCRSRMICVDKLAEPARCDTLVPQPLSVVNSFKAKKVVTVRG
Ga0214544_101667013300021320Root NodulesVWYTNPPALSDRSDRSRVICVGMLAEPARCETQVPQPLSVMNNVKAKKVVTI
Ga0214544_101680223300021320Root NodulesVWYTSPPALSDMSYRSRVICVNMLAEPARCDTPVPQPLSVVNSVKAKKL
Ga0214544_101680863300021320Root NodulesVWYTSPPALYDGSCRSRVICVGMLAEPVRCGTPVPQPLSVMNSVKAKKW
Ga0214544_101779513300021320Root NodulesVWYTSPPALSDMSCRSRVICGNMLAEPARCDTPVPQPLSVVNSVKAKKL
Ga0214544_101791093300021320Root NodulesVWYTSPPALSDGSCGSRVICVGCVGMLAEPARCGTPISQPLSVMNSVKAKKW
Ga0214544_101842423300021320Root NodulesVWYTSPPALSDMRCRSRVICVGMLAEPARCDTPVPQPLSVVNSVKAKKVVTVRR
Ga0214544_101846893300021320Root NodulesVWYTSSPTLFDIGCRSRVICVGMLAEPARCDTPVPQPLSVVNSVKAKKW
Ga0214544_101849133300021320Root NodulesVWYTSPPALSDGSCRSRVIYVRMLAEPARCGTPVPQPLSVMNSVKAKKW
Ga0214544_101878573300021320Root NodulesVWYTSPPALSDMSCRSRVIYVGMLAEPARCDTPVPQPLSVVNSVKAKKW
Ga0214544_101975913300021320Root NodulesVWYTSPPALSDRSCRSRVICVGMLAEPARCDTPVPQPLSVMNIVKAKKGVIV
Ga0214544_102014113300021320Root NodulesVWYTSPPALSDMSCWSRVICVGMLAEPARCDTLVPQPLSVMNNVKAKKW
Ga0214544_102089763300021320Root NodulesVWYTSPPALSDGSCRSRVICVGCVGMLAEPARCDTPVPQPLSVVNSVKAKKW
Ga0214544_102095223300021320Root NodulesVWYTSPPALSDMSCRSRVICVNMLAEPARCDTPVPQPLSVVNSVKAKKL
Ga0214544_102167163300021320Root NodulesVWYTSPPALSDMSCRSRVICVDMLAEPARCDTPVPQPLSVMNSVKAKKW
Ga0214544_102202413300021320Root NodulesVWYTSPPALSDMSCRSRVIYVGMLAEPARCDTLVPQPLRVMNSVKAKKW
Ga0214544_102274753300021320Root NodulesVWYTSPLALSDGSCRSRVICVGCVGMLAEPVRCGTPVPQPLSVMNSVKAKKW
Ga0214544_102317953300021320Root NodulesVWYTSPPALSDMSCRSRVICVNMLAESARCDTPVPQPLSVVNNVKAKKL
Ga0214544_102318993300021320Root NodulesVWYTSPPALFDGSCRSRVICVGMLTAPARCGTPVPQPLSVMNSVKAKKW
Ga0214544_102366513300021320Root NodulesVWYTNPPALSDRSYRSRVICVGMLAEPARCETQVPQPLSVMNNVKAKKVVTV
Ga0214544_102377833300021320Root NodulesVWYTSPPALADMSCRSRVICVGMLAEPARCDTPVPQPLSVMNSVKAKKW
Ga0214544_102377843300021320Root NodulesVWYTSPLALSDGSCRSRVICVGCVGMLAELARCGTPVPQPLSVVNSVKAKKW
Ga0214544_102417813300021320Root NodulesVWYTSPPALSDISCRSRVICVGMLAEPARCDTPVPQPLSVMNSVKAR
Ga0214544_102464483300021320Root NodulesVWYTSPPALTDMSCRSRVICVGMLAEPARCGTPVPQPLSVMNSVKAKKWLSSEGR
Ga0214544_103374243300021320Root NodulesDMSCRSRVICVGMLAEPARCDTPVPQPLSVVNSVKAKKW
Ga0214544_103710633300021320Root NodulesLSDMSCRPRVICVNVLAEPARCDTPVPQPLSVVNNVKAKNL
Ga0214542_101596973300021321Root NodulesVRYISPPALSDMSCQPRVICVNMLAEPARCDTPVPQPLSVVNSVKAKNS
Ga0214542_101657623300021321Root NodulesVWYTSPLALSDGSCRSRVICVGMLAELARCGTPVPQPLSVMNIVKAKKW
Ga0214542_101957013300021321Root NodulesVWYTSPPALSDMSCRSKVICVGMLAGPARCDTSVPQPLSVMNNVKAKKW
Ga0214542_102127643300021321Root NodulesVWYTSPPALSDISCRSRVICVGMLAEPARCDTPVPQPLSVMNSVKAKKW
Ga0214542_102152273300021321Root NodulesPALSDGSCRSRVICVGCVGMLAEPARCGTPVPQPLSVANSVKAKMW
Ga0214542_102220473300021321Root NodulesVWYTSPPALSDVGYRSRVICVGMLAEPAKCDTPVPQPLSVVNNVKAKKW
Ga0214542_102326443300021321Root NodulesVRYTSPPALSDMSCRSRMICVDKLAEAARCDTPVPQPLSVVNSVKAKKVVTVRG
Ga0214542_103780513300021321Root NodulesTSPPALSDMGCRSRMICVGKLAEPARCDTPVPQPLSVVNSVKT
Ga0214545_1007556223300021324Root NodulesVWYTSALALADMSFWSRVMCVGMLAEPAKCDTPVPQPLSVMNNVKAKKW
Ga0214545_1008335253300021324Root NodulesVWYTSPPALSDMSCRSRVICVGMLAEPARCDTLVPQPLSVVNSVKAKKW
Ga0214545_100984613300021324Root NodulesVWYISPPALSDMSCRPRVICVNVLAEPARCDTPVPQPLSVVNNVKA
Ga0214545_1013386103300021324Root NodulesVQYTSPPALSDKICRSRVICVDMLAEPARCDTPVPQPLSVMNSVKAKRW
Ga0214545_102081913300021324Root NodulesSDGSCRSRVICVGCVGMLAEPARCGTPVPQPLSVANSVKAKMW
Ga0214545_102089473300021324Root NodulesVWYTSPPALSDRSCRSRVICVGMLAEPARCDTLVPQPLSVMNSVKAKKW
Ga0214545_102212873300021324Root NodulesDMGCRSSMICVGKLAEPARCDTPVPQPLSVVNSVKA
Ga0214545_102278963300021324Root NodulesVWYTSPPALSDMSYRSRVICVGMLAEPARCDTPVPQPLSVMNNVKAKKW
Ga0214545_105916123300021324Root NodulesLSDMGCRSRMICVDKLAEPARCDTPVPQPLSVVNSVKA
Ga0214545_106515233300021324Root NodulesALSDMGCRSRMICVGKLAEPARCDTPVPQPLSVVNSVKA
Ga0214543_102037813300021327Root NodulesVWYTSPPALSDMSCRSRVICVGMLAEPARCDTPVPQPLSVMNSVKAKKW
Ga0214543_102491653300021327Root NodulesVWYTSPPALSDRSCRSRVICVGCVGMLAEPVRCGTPVPQPLSVMNNVKAKKW
Ga0209389_104268883300027296Root NodulesVWYTSPPTLSDMSCRSRVICVGMLAEPARCDTPVPQPLSVMNSVKAKKW
Ga0209389_106578813300027296Root NodulesKQDNPSSLICVNMLAEPARCDTLVSQPLSVVNSVKAKKL
Ga0209389_108383513300027296Root NodulesSPPALSDMSCRSRMICVGMLTEPARCDTPVPQPLSVMNDVKAKKW
Ga0209389_108998613300027296Root NodulesSPPALSDMGCRSRMICVGKLAEPARCDTPVPQPLSVVNSVKT
Ga0209389_110743733300027296Root NodulesLSDMKCRSRVICVGRLAKPARCDTLVPQPLSVVNNVKAKRW
Ga0209389_111061223300027296Root NodulesMGCRSRMICVDKLAEPARCDTPVPQPLNVVNSVKA
Ga0209389_111557423300027296Root NodulesLSDMSCRSRVICVNMLAEPARCDTPVPQPLSVVNSVKAKKL
Ga0209589_101362593300027357Root NodulesVWYTSPPVLSDMSCRSRVICVGCVGMLAEPARCDTPVPQPLSVVNNVKAKKW
Ga0209589_102042763300027357Root NodulesVWYTSPPALSDMSCRSRVICVNMLAEPARCDTLVPQPLSVVNSVKAKKL
Ga0209589_102860443300027357Root NodulesPPALSDMGCRSRMICVGKLAEPARCDTPVPQPLSVVNSVKA
Ga0209589_105075813300027357Root NodulesALSDMGCRSRMICVDKLAEPARCDTPVPQPLSVVNSVKA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.