Basic Information | |
---|---|
Family ID | F053142 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 141 |
Average Sequence Length | 42 residues |
Representative Sequence | MSETLTKIVVNCETGEQQILPLTAEEIAQREADAAAFAVAEAE |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 141 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 97.12 % |
% of genes near scaffold ends (potentially truncated) | 73.76 % |
% of genes from short scaffolds (< 2000 bps) | 60.28 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (55.319 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (19.149 % of family members) |
Environment Ontology (ENVO) | Unclassified (61.702 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.631 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.76% β-sheet: 14.08% Coil/Unstructured: 59.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 141 Family Scaffolds |
---|---|---|
PF13392 | HNH_3 | 2.13 |
PF00041 | fn3 | 2.13 |
PF01844 | HNH | 0.71 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 55.32 % |
All Organisms | root | All Organisms | 44.68 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002471|metazooDRAFT_1500133 | All Organisms → Viruses → Predicted Viral | 1963 | Open in IMG/M |
3300003411|JGI25911J50253_10082118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1019 | Open in IMG/M |
3300005805|Ga0079957_1316892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300006802|Ga0070749_10444522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300007171|Ga0102977_1019388 | Not Available | 1034 | Open in IMG/M |
3300007541|Ga0099848_1107186 | Not Available | 1067 | Open in IMG/M |
3300008107|Ga0114340_1015772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3619 | Open in IMG/M |
3300008107|Ga0114340_1156575 | Not Available | 831 | Open in IMG/M |
3300008108|Ga0114341_10282328 | Not Available | 875 | Open in IMG/M |
3300008116|Ga0114350_1058249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1954 | Open in IMG/M |
3300008117|Ga0114351_1294471 | Not Available | 1401 | Open in IMG/M |
3300009155|Ga0114968_10181265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1231 | Open in IMG/M |
3300009159|Ga0114978_10498703 | Not Available | 715 | Open in IMG/M |
3300009165|Ga0105102_10735836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300009181|Ga0114969_10686504 | Not Available | 553 | Open in IMG/M |
3300009684|Ga0114958_10296159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. 15-1 | 792 | Open in IMG/M |
3300010354|Ga0129333_10615850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300010885|Ga0133913_10833624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2400 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10209913 | Not Available | 1317 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10700070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10125733 | Not Available | 2090 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10130582 | All Organisms → Viruses → Predicted Viral | 2035 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10139277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1945 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10167622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1710 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10705925 | Not Available | 636 | Open in IMG/M |
3300013372|Ga0177922_10552467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300013372|Ga0177922_11137062 | Not Available | 2358 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10111442 | All Organisms → Viruses → Predicted Viral | 1918 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10151323 | Not Available | 1546 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10200853 | Not Available | 1268 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10622619 | Not Available | 590 | Open in IMG/M |
3300017761|Ga0181356_1055216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1361 | Open in IMG/M |
3300017774|Ga0181358_1038326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1850 | Open in IMG/M |
3300017778|Ga0181349_1076824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1275 | Open in IMG/M |
3300017778|Ga0181349_1179757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
3300017780|Ga0181346_1066658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1436 | Open in IMG/M |
3300017785|Ga0181355_1088883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1286 | Open in IMG/M |
3300017788|Ga0169931_10178962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1847 | Open in IMG/M |
3300017788|Ga0169931_10564586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
3300020074|Ga0194113_10061822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3523 | Open in IMG/M |
3300020074|Ga0194113_10323511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
3300020083|Ga0194111_10824277 | Not Available | 557 | Open in IMG/M |
3300020084|Ga0194110_10451481 | Not Available | 853 | Open in IMG/M |
3300020109|Ga0194112_10138493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2086 | Open in IMG/M |
3300020179|Ga0194134_10049869 | All Organisms → Viruses → Predicted Viral | 2318 | Open in IMG/M |
3300020183|Ga0194115_10082958 | Not Available | 1850 | Open in IMG/M |
3300020190|Ga0194118_10576602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300020193|Ga0194131_10080348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1888 | Open in IMG/M |
3300020193|Ga0194131_10083080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1836 | Open in IMG/M |
3300020196|Ga0194124_10050887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2588 | Open in IMG/M |
3300020198|Ga0194120_10347084 | Not Available | 722 | Open in IMG/M |
3300020200|Ga0194121_10402738 | Not Available | 677 | Open in IMG/M |
3300020204|Ga0194116_10030339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4210 | Open in IMG/M |
3300020204|Ga0194116_10105104 | All Organisms → Viruses → Predicted Viral | 1794 | Open in IMG/M |
3300020221|Ga0194127_10338055 | Not Available | 1008 | Open in IMG/M |
3300020578|Ga0194129_10210107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1175 | Open in IMG/M |
3300021091|Ga0194133_10543422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300021962|Ga0222713_10489906 | Not Available | 737 | Open in IMG/M |
3300021962|Ga0222713_10805420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300021963|Ga0222712_10405229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
3300022179|Ga0181353_1050925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
3300022407|Ga0181351_1012323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3503 | Open in IMG/M |
3300023179|Ga0214923_10310677 | Not Available | 852 | Open in IMG/M |
3300023184|Ga0214919_10407025 | Not Available | 879 | Open in IMG/M |
3300024358|Ga0255173_1018826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1223 | Open in IMG/M |
3300024866|Ga0255272_1021930 | Not Available | 1593 | Open in IMG/M |
3300025307|Ga0208566_1157774 | Not Available | 631 | Open in IMG/M |
3300025451|Ga0208426_1055496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300026459|Ga0255170_1091313 | Not Available | 503 | Open in IMG/M |
3300026473|Ga0255166_1010054 | Not Available | 2120 | Open in IMG/M |
3300026473|Ga0255166_1102958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300027782|Ga0209500_10299382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. 15-1 | 682 | Open in IMG/M |
3300027782|Ga0209500_10351108 | Not Available | 609 | Open in IMG/M |
3300027793|Ga0209972_10404182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300027797|Ga0209107_10024762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3446 | Open in IMG/M |
3300027806|Ga0209985_10070210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1877 | Open in IMG/M |
(restricted) 3300027970|Ga0247837_1081683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Jiella → unclassified Jiella → Jiella sp. R10 | 1673 | Open in IMG/M |
3300028103|Ga0255172_1094000 | Not Available | 532 | Open in IMG/M |
3300028394|Ga0304730_1185441 | Not Available | 802 | Open in IMG/M |
(restricted) 3300028559|Ga0247831_1168318 | Not Available | 848 | Open in IMG/M |
(restricted) 3300028559|Ga0247831_1252641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300031758|Ga0315907_10131875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2126 | Open in IMG/M |
3300031758|Ga0315907_10390348 | Not Available | 1124 | Open in IMG/M |
3300031758|Ga0315907_10665848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
3300031787|Ga0315900_10086480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3109 | Open in IMG/M |
3300031787|Ga0315900_10095150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2920 | Open in IMG/M |
3300031787|Ga0315900_10163091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2039 | Open in IMG/M |
3300031857|Ga0315909_10186604 | Not Available | 1660 | Open in IMG/M |
3300031857|Ga0315909_10717684 | Not Available | 646 | Open in IMG/M |
3300031951|Ga0315904_10148267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2381 | Open in IMG/M |
3300031951|Ga0315904_10963622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300031963|Ga0315901_10198558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1740 | Open in IMG/M |
3300031963|Ga0315901_11110209 | Not Available | 543 | Open in IMG/M |
3300031963|Ga0315901_11155391 | Not Available | 528 | Open in IMG/M |
3300032093|Ga0315902_10265654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1655 | Open in IMG/M |
3300032093|Ga0315902_11118114 | Not Available | 576 | Open in IMG/M |
3300032116|Ga0315903_10069736 | Not Available | 3473 | Open in IMG/M |
3300032116|Ga0315903_11104772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300034068|Ga0334990_0657866 | Not Available | 546 | Open in IMG/M |
3300034082|Ga0335020_0565064 | Not Available | 535 | Open in IMG/M |
3300034117|Ga0335033_0563105 | Not Available | 536 | Open in IMG/M |
3300034120|Ga0335056_0322981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300034284|Ga0335013_0138542 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
3300034284|Ga0335013_0850346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52 | 506 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 19.15% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.31% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 15.60% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.48% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.51% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.09% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.96% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.13% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.13% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.13% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.42% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.42% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.71% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.71% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.71% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.71% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.71% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.71% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.71% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.71% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024356 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d | Environmental | Open in IMG/M |
3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025307 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m (SPAdes) | Environmental | Open in IMG/M |
3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026459 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d | Environmental | Open in IMG/M |
3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
metazooDRAFT_15001335 | 3300002471 | Lake | MTDTKIVVNCETGETQVVTLTAEEIAQREADAAAFAAEQAEREAAE |
JGI25911J50253_100821181 | 3300003411 | Freshwater Lake | MSTLTKIVVNCETGEEQILNLTAEEISDLEASAAAYEVEQAAKIAADQAKAELKA |
Ga0063232_102310432 | 3300004054 | Freshwater Lake | MSEAPTKIVVDCSTGETQIIPLTAEEITQRETDAAAYAVAQAEREEAEAAT |
Ga0068877_100986591 | 3300005525 | Freshwater Lake | MTDTPTKIVVDCSTGEVKELPLTAEEIAQREADAAAFAEAEAVRQAEEAAKAA |
Ga0049080_103023461 | 3300005582 | Freshwater Lentic | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAQAAATAKAEED |
Ga0079957_13168923 | 3300005805 | Lake | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAQAAA |
Ga0070749_104445221 | 3300006802 | Aqueous | MSEVLTKVVVNCATGEQSVVPLTPEEITQREADAVAFAE |
Ga0102977_10193883 | 3300007171 | Freshwater Lake | MTDTKIVVDCTTGETQVVTLTAEEIAQREADAQAF |
Ga0099848_11071863 | 3300007541 | Aqueous | MAETLTKVVVNCETGVQEILPLTAEEIADRETAAAAYAEQK |
Ga0114340_10157721 | 3300008107 | Freshwater, Plankton | MSEELTKVIVDCSTGVQSIVPLTAEEIAQREIDMAAAEEARIARE |
Ga0114340_11565751 | 3300008107 | Freshwater, Plankton | MSEELTKAIVDCSTGVQSIVPLTAEEIAQREIDMAAAEEARIARE |
Ga0114341_102823281 | 3300008108 | Freshwater, Plankton | MTETLTKIVVDCSTGQQSIVPLTAEEIAQREADAAA |
Ga0114350_10582495 | 3300008116 | Freshwater, Plankton | MTDTPTKIVVDCSTGEVKELPLTAEEIAQREADAAAFAE |
Ga0114351_12944713 | 3300008117 | Freshwater, Plankton | MSEVLTKVVVDCSTGISEVVPLSAEEIAQREADALAYAQRKA |
Ga0114355_11965121 | 3300008120 | Freshwater, Plankton | MSETLTKIIVNCGTGVVAEVPLTGEEIAQREADAAAAATAQAEEEA |
Ga0114363_10832101 | 3300008266 | Freshwater, Plankton | MTDTPTKIVVDCSTGEVKELPLTAEEIAQREADAAAFAEAKAVRQAEEAAKA |
Ga0114880_12726692 | 3300008450 | Freshwater Lake | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAQEAATAKAEEDAKAAQ |
Ga0102830_12009331 | 3300009059 | Estuarine | MTDTKVVVNCTTGETSIVTLDSEEIAQREADALAFSAAETARLEA |
Ga0114963_101781133 | 3300009154 | Freshwater Lake | MSEALTAIEINCETGEVIERPLTAEEITQREADAAAAVTRKAEEDAAA |
Ga0114963_104706301 | 3300009154 | Freshwater Lake | MSDTPTKIVVDCSTGEQQILELTAAEIAQRNQDAADAAARREEEEAAA |
Ga0114968_101812653 | 3300009155 | Freshwater Lake | MSETLTKIIVDCSTGVVAEVPLTGEEIAQRETDAAAFAVEQAAR |
Ga0114977_104181763 | 3300009158 | Freshwater Lake | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAAAAATAKAEEDAKAAQDA |
Ga0114978_104987031 | 3300009159 | Freshwater Lake | MADTPTKIVVDCSTGETQIIPLTAEEISQRDQDAAAYATAQAEREE |
Ga0114975_103747381 | 3300009164 | Freshwater Lake | MADTPTKIVVDCSTGETQIIPLTAEEISQRDQDAAAYATAQAEREEA |
Ga0105102_107358361 | 3300009165 | Freshwater Sediment | MSETLTKIVVNCETGVVAEIPLTGEEIAQREADAQAAAAKKAEED |
Ga0114969_106865042 | 3300009181 | Freshwater Lake | MSEAPTKVVVDCSTGETQIIPLTAEEISQREADAAAYATA |
Ga0114958_102961593 | 3300009684 | Freshwater Lake | MSDTPTKIVVDCSTGEQQILELTAAEIAQRDQDAADAAARR |
Ga0129333_106158502 | 3300010354 | Freshwater To Marine Saline Gradient | MSEVLTKVVVDCSTGEQTVVPLTAEEIAQREADAAAFAEAEAARQ |
Ga0133913_108336241 | 3300010885 | Freshwater Lake | MSEVLTKVVVDCSTGISEVVPLSAEEIAQREIDIAAN |
(restricted) Ga0172373_102099134 | 3300013131 | Freshwater | MSEPLTKIVVNCETGEQQVLPLTAEEIAQRETDAAAFAVAEAERIAAAE |
(restricted) Ga0172373_107000701 | 3300013131 | Freshwater | MSETLTKIVVNCETGEQQVLPLTAEEIAQRKTDAAAFDVAE |
(restricted) Ga0172372_100552367 | 3300013132 | Freshwater | MATSQKLIVDCATGTETLVDLTAEEIAQREADAAAFAVAEAE |
(restricted) Ga0172372_101257332 | 3300013132 | Freshwater | MSEVLTAIEVNCATGETITRPLTAEEIAQREADAAAYA |
(restricted) Ga0172372_101305821 | 3300013132 | Freshwater | MTEVLTKVVVDCSTGEQTVVPLTAEEIAQREADAA |
(restricted) Ga0172372_101392775 | 3300013132 | Freshwater | MSETLTKLVVNCETGEQQVLPLTAEEIAQREADAAAFAVAEAERIAAA |
(restricted) Ga0172372_101676224 | 3300013132 | Freshwater | MSETLTKIVVNCETGEQQVLPLTAEEIAQREADAA |
(restricted) Ga0172372_107059251 | 3300013132 | Freshwater | MTETLTKLVVNCETGEQQILPLTAEEIAQREADAAAFAV |
Ga0177922_105524671 | 3300013372 | Freshwater | MTEILTKTVVDCSTGEQSVIPFTAEEIAQHEADAAAYA |
Ga0177922_111370621 | 3300013372 | Freshwater | MSESLTKIVINCETKEETIVPLTAEEIAQREADAAAFAVAEAE |
(restricted) Ga0172376_101114421 | 3300014720 | Freshwater | MSETLTKIVVNCETGEQQILPLTAEEIAQREADAAAFAVAEAERIAA |
(restricted) Ga0172376_101513234 | 3300014720 | Freshwater | MSETLTKIVVNCETGEQEVLPLTAEEIAQREADAAAFAVAE |
(restricted) Ga0172376_102008531 | 3300014720 | Freshwater | MSEPLTKIVVNCETGEQQVLPLTAEEIAQRETDAAAFA |
(restricted) Ga0172376_102495741 | 3300014720 | Freshwater | MTEVLSKVVVDCSTGEQTVVPLTAEEIAQREADAAAFAEAEAARMAA |
(restricted) Ga0172376_106226192 | 3300014720 | Freshwater | MTEVLTKVVVDCSTGEQTVVPLTAEEIAQREADAAAFAEAE |
Ga0181356_10552161 | 3300017761 | Freshwater Lake | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAAAASTAKAEED |
Ga0181358_10383264 | 3300017774 | Freshwater Lake | MSEVLTKVVVDCSTGVTEIVPLTAEEIAQREADAAAYAIAEAER |
Ga0181349_10768241 | 3300017778 | Freshwater Lake | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAAAAAT |
Ga0181349_11797571 | 3300017778 | Freshwater Lake | MSETLTKIVVNCETGISAEIPLTGEEIAQREADAAAAATAKAEED |
Ga0181346_10666583 | 3300017780 | Freshwater Lake | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAAAAATAKAE |
Ga0181348_10155171 | 3300017784 | Freshwater Lake | MSETLTKIIVNCETGVVAEIPLTGEEIAQREADAQAAATAQAEEDAK |
Ga0181348_10882493 | 3300017784 | Freshwater Lake | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAQAFAAAKAEEDAKAAQDAEA |
Ga0181355_10888831 | 3300017785 | Freshwater Lake | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAAAAATAKAA |
Ga0169931_101789624 | 3300017788 | Freshwater | MSETLTKVVVNCETGEQQVLPLTAEEIAQRETDAAAFAVAEAE |
Ga0169931_105645863 | 3300017788 | Freshwater | MSEALTKIVVNCETGEEQILPLTAEEIAQREADAAAYAAQK |
Ga0181359_10186011 | 3300019784 | Freshwater Lake | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAAAAATAKAEEDAKAA |
Ga0181359_10290881 | 3300019784 | Freshwater Lake | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAAAAATAQAEEEAKA |
Ga0181359_11192153 | 3300019784 | Freshwater Lake | MTDTKIVVNCETGETTVVTLTSEEIAQREADAAAFAVAEAERLAVEEAAA |
Ga0194113_100618221 | 3300020074 | Freshwater Lake | MPETLTKIVVNCETGEQQILPLTAAEIAQREADAAAYA |
Ga0194113_103235111 | 3300020074 | Freshwater Lake | MPETLTKIVVNCETGEQQILPLTAAEIAQREADAAAYAAEKAA |
Ga0194113_111237691 | 3300020074 | Freshwater Lake | MSRPTKIVVDCTTGVESILELTDEEIVQLEADRVAYEAEMATRQAAEEAK |
Ga0194111_108242772 | 3300020083 | Freshwater Lake | MPETLTKIVVNCETGEQQILPLTAAEIAQREADAAAYAAEK |
Ga0194110_104514811 | 3300020084 | Freshwater Lake | MSEALTKVVINCTTGERQVLALTAEEIAQREADAAAFAVAEAE |
Ga0194112_101384931 | 3300020109 | Freshwater Lake | MSETLTKIVVNCETGEQQILPLTAEEIAQREADAAAFAVAEAERIAAA |
Ga0211734_102210703 | 3300020159 | Freshwater | MTTDIPTKVVVNCTTGVMETIPLTAEEIAAQEAAAAAFAIEQAEREAA |
Ga0194134_100498695 | 3300020179 | Freshwater Lake | MSETLTKIVVNCETGEQQILPLTAAEIAQREADAAAYAAEKAA |
Ga0194115_100829581 | 3300020183 | Freshwater Lake | MSETLTKLVVNCETGEQQVLPLTAEEIAQREADAAAFAVAEAERI |
Ga0194118_105766021 | 3300020190 | Freshwater Lake | MTETLTKIIVDCSTGQQTIVPLTAEEIAQREADAVAFAEIKAAEEA |
Ga0194131_1002196711 | 3300020193 | Freshwater Lake | MSETLTAIEVDCSTGKTTIRPLTAGEIAQREADAAAYA |
Ga0194131_100803484 | 3300020193 | Freshwater Lake | MSETLTKIVVNCETGEQQVLPLTAEEIAQREADAAAFAVAEAERIAAAEA |
Ga0194131_100830804 | 3300020193 | Freshwater Lake | MSETLTKTVVNCETGEQQVLPLTAEEIAQREADAAAFAVAEAERIAAAEA |
Ga0194124_100508871 | 3300020196 | Freshwater Lake | MSETLTKIVVNCETGEQQILPLTAEEIAQREADAAAFAVAEAERI |
Ga0194128_1002751811 | 3300020197 | Freshwater Lake | MSETLTAIEVDCSTGKTTIRPLTAGEIAQREADAA |
Ga0194120_103470842 | 3300020198 | Freshwater Lake | MSEALTKVVINCTTGERQVLALTAEEIAQREADAAAFAVAEA |
Ga0194121_104027381 | 3300020200 | Freshwater Lake | MSETLTKIVVNCETGEQQILPLTAEEIAQREADAAAFAVAEAE |
Ga0194116_100303399 | 3300020204 | Freshwater Lake | MPETLTKIVVNCETGEQQILPLTAAEIAQREADAAAYAAEKAAADA |
Ga0194116_101051044 | 3300020204 | Freshwater Lake | MPETLTKIVVNCETGEQQILPLTAAEIAQREADAAAY |
Ga0194119_101653121 | 3300020220 | Freshwater Lake | MSETLTAIEVDCSTGKTTIRPLTAGEIAQREADAAAYALRKAEEEA |
Ga0194127_103380551 | 3300020221 | Freshwater Lake | MPETLTKIVVNCETGEQQILPLTAAEIAQREADAA |
Ga0194129_102101073 | 3300020578 | Freshwater Lake | MSETLTKIVVNCETGEQQILPLTAEEIAQREADAAAFAV |
Ga0194133_105434221 | 3300021091 | Freshwater Lake | MTETLTKIIVDCSTGQQTIVPLTAEEIAQREIDAEYFAEMQAQE |
Ga0213921_10396493 | 3300021952 | Freshwater | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAQAAAAKAHEEE |
Ga0222713_104899063 | 3300021962 | Estuarine Water | MTDTKIVVNCETGETTVVTLTSEEIAQREADAAAF |
Ga0222713_108054201 | 3300021962 | Estuarine Water | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAQA |
Ga0222712_104052291 | 3300021963 | Estuarine Water | MTDTKIVVNCETGETTVVTLTSEEIAQREADAAAFAVEQA |
Ga0181353_10509251 | 3300022179 | Freshwater Lake | MTDTKIVVDCTTGETQVVTLTAEEIAQREADAAAYAE |
Ga0181351_10123236 | 3300022407 | Freshwater Lake | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAAAAATA |
Ga0214923_103106771 | 3300023179 | Freshwater | MSEVLTKVVVDCSTGVSEILPLTAEEIAQREADAAAYAIAEAERTAQ |
Ga0214919_104070252 | 3300023184 | Freshwater | MTAPTKIVVDCSTGETSIIELTAEEIAQREVDAAAFAVEQAE |
Ga0255169_10070091 | 3300024356 | Freshwater | MTETLTKIVVDCTTGEQSIVPLTAEEIAQREADAAAYAEAEAARVAAE |
Ga0255173_10188263 | 3300024358 | Freshwater | MSETLTKIVVNCETGVTEEVPLTAEEIAQREADAAAWAEQKAAAEA |
Ga0255173_10611582 | 3300024358 | Freshwater | MTDTPTKIIVDCSTGEQQIVPLTAEEIAQREADAA |
Ga0255164_10042411 | 3300024495 | Freshwater | MSEVLTKIIVDCSTGEQTVVPLTAEEIAQREADAAAFAEAEAARQAAEEA |
Ga0255164_10074705 | 3300024495 | Freshwater | MSEVLTKIIVDCFTGEQSIVPLTPEEISEREQIAISF |
Ga0255272_10219304 | 3300024866 | Freshwater | MTETLTKIVVDCTTGEQSIVPLTAEEIAQREADAAAYADRKQLVWRQKKQ |
Ga0208566_11577741 | 3300025307 | Freshwater | MSEVLTKVVVDCSTGVQEIIPLTAEEITQRETDAAAYAVDQAAREE |
Ga0208426_10554963 | 3300025451 | Aqueous | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAAA |
Ga0255170_10913131 | 3300026459 | Freshwater | MAETLTKIVVDCATGTETVVPLTAEEIAQREADAAAYAEEKAAEEA |
Ga0255166_10100541 | 3300026473 | Freshwater | MSEVLTKVVVDCSTGEQTVVPLTAEEIAQREADAAAFAEAE |
Ga0255166_11029582 | 3300026473 | Freshwater | MSEVLTKIVVDCSTGQQTVVPLTAEEIAQREADAA |
Ga0209553_11611531 | 3300027688 | Freshwater Lake | MSEVLTKIIVNCETGVVAEIPLTGEEIAQREVDAATAATEQAAREAEEA |
Ga0209500_102993821 | 3300027782 | Freshwater Lake | MSDTPTKIVVDCSTGEQQIIELTAQEIAQRDQDAADA |
Ga0209500_103511082 | 3300027782 | Freshwater Lake | MADTPTKIVVDCSTGETQIIPLTAEEISQRDQDAA |
Ga0209972_104041821 | 3300027793 | Freshwater Lake | MTDTPTKIVVDCSTGEVKELPLTAEEIAQREADAAAFAEAEAV |
Ga0209107_100247628 | 3300027797 | Freshwater And Sediment | MTDTKIVVNCETGETQVVTLTSEEIAQREADAAAFAIAEAE |
Ga0209107_105444551 | 3300027797 | Freshwater And Sediment | MSVPTKIIVNCETGVSAEVPLTNEEIAQREADAAAFATAEAERVAAQEA |
Ga0209985_100702101 | 3300027806 | Freshwater Lake | MTDTPTKIVVDCSTGEVTELPLTAEEIAQREADAIA |
(restricted) Ga0247837_10816831 | 3300027970 | Freshwater | MSETLTKIVVNCETGVQEIIPLTVEEIAQREADATAYAAQKAIDD |
Ga0209079_103100833 | 3300027972 | Freshwater Sediment | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAQAFAAKKHEEDAKAAQD |
Ga0247723_11176121 | 3300028025 | Deep Subsurface Sediment | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAQAAATAKAEEDA |
Ga0255172_10940003 | 3300028103 | Freshwater | MTETLTKIVVDCTTGEQSIVPLTAEEIAQREADAAAYAEAEA |
Ga0304730_11854411 | 3300028394 | Freshwater Lake | MSEAPTKVVVDCSTGETQIIPLTAEEIAQRDQDAAAY |
(restricted) Ga0247831_11683183 | 3300028559 | Freshwater | MSETLTKIVVNCETGVQEIIPLTVEEIAQREADAAAYAAQKAIDDAAQA |
(restricted) Ga0247831_12526411 | 3300028559 | Freshwater | MSETLTKIVVNCETGVQEIIPLTVEEIAQREADATAYAAQKAIDDAAQ |
Ga0315907_101318755 | 3300031758 | Freshwater | MTDTPTKIVVDCSTGEVKELPLTAEEIAQREADAAAFAEAKAVRQAE |
Ga0315907_101640894 | 3300031758 | Freshwater | MTDTPSKVIINCETGEQEIVPLTAEEIAQAEADQAA |
Ga0315907_103903481 | 3300031758 | Freshwater | MSTLTKLVVNCETGEEQIVNLTPEEIADRDALAAAYEAEQ |
Ga0315907_106658481 | 3300031758 | Freshwater | MTDTKIVVNCETGETQVVTLTAEEIAQREVDAAAFAAA |
Ga0315900_100864806 | 3300031787 | Freshwater | MSETLTKIVVNCETGVVAEIPLTGEEIAQREADAQA |
Ga0315900_100951506 | 3300031787 | Freshwater | MTDTPTKIVVDCSTGEVKELPLTAEEIAQREADAAAFA |
Ga0315900_101630915 | 3300031787 | Freshwater | MTEVLTKVVVDCSTGEQTIVPLTADEIAQREADASAFAEAEAARVAA |
Ga0315909_100987111 | 3300031857 | Freshwater | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAQAATTAKAEADAKA |
Ga0315909_101648421 | 3300031857 | Freshwater | MTDTPTKIVVDCSTGEVKELPLTAEEIAQREADAAAFAEAEAVRQAEEA |
Ga0315909_101866041 | 3300031857 | Freshwater | MSNLTKIVVNCETGEEQILNLTPEEIADLESSAAAYQ |
Ga0315909_107176841 | 3300031857 | Freshwater | MSEVLTKVVVNCATGEESVVALTPEEIAQREADAA |
Ga0315904_101482671 | 3300031951 | Freshwater | MTDTPTKIVVDCSTGEVKELPLTAEEIAQREADAAA |
Ga0315904_109636221 | 3300031951 | Freshwater | MDKVIVDCSTGETTIVPLTAEEIAQREADAAAFAAEQAAR |
Ga0315901_101985584 | 3300031963 | Freshwater | MTDTPTKIVVDCSTGEVKELPLTAEEIAQREADAAAFAEAEAVRQAE |
Ga0315901_111102092 | 3300031963 | Freshwater | MAETPTKMVVNCTTGETQILPLTAAEIAQRDQDAAAAQAEREA |
Ga0315901_111553912 | 3300031963 | Freshwater | MTETLTKIVVDCTTGQQSIIPLTAEEIAQREADASAYAE |
Ga0315906_112075391 | 3300032050 | Freshwater | MNDVLTKVIVDCSTGESQVIPLTAEEIAQREADIA |
Ga0315902_102656541 | 3300032093 | Freshwater | MTDTPTKIVVDCSTGEVKELPLTAEEIAQREADAAAFAEAEAIR |
Ga0315902_111181142 | 3300032093 | Freshwater | MTDTPTKIVVDCSTGEVKELPLTAEEIAQREADAAAF |
Ga0315903_100697364 | 3300032116 | Freshwater | MTETLTKIVVDCSTGQQSIVPLTAEEIAQREADAAAYAEAEAARVA |
Ga0315903_104205713 | 3300032116 | Freshwater | MTEVLSKIVVDCSTGQQSIVPLTAEEIAQREADAAAYAEAEAARVAAEEAKTNLKNS |
Ga0315903_111047723 | 3300032116 | Freshwater | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAQ |
Ga0334990_0657866_2_121 | 3300034068 | Freshwater | MSEVLTNIEVNCTTGEVTERPLTAEEIAQREADAAAAVAA |
Ga0335020_0565064_426_533 | 3300034082 | Freshwater | MSEAPTKVVVDCSTGETQIIPLTAEEISQREADAAA |
Ga0335033_0563105_2_109 | 3300034117 | Freshwater | MSVPTKIIVNCETGVSAEVPLTNEEIAQREADAAAF |
Ga0335056_0322981_1_123 | 3300034120 | Freshwater | MSETLTKIIVNCETGVVAEVPLTGEEIAQREADAQAAAAKK |
Ga0335013_0138542_3_119 | 3300034284 | Freshwater | MSETLTKIVVNCETGVVAEIPLTGEEIAQREADAAQAES |
Ga0335013_0850346_1_132 | 3300034284 | Freshwater | MSETLTKIIVDCSTGVVAEIPLTGEEIAQRDIDTAQAETDRIAL |
⦗Top⦘ |