 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F053304 |
| Family Type | Metagenome |
| Number of Sequences | 141 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MTTVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTISEV |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 73.05 % |
| % of genes near scaffold ends (potentially truncated) | 26.95 % |
| % of genes from short scaffolds (< 2000 bps) | 86.52 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.213 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (29.787 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.723 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.652 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.71% β-sheet: 39.02% Coil/Unstructured: 29.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF02945 | Endonuclease_7 | 17.02 |
| PF00589 | Phage_integrase | 2.13 |
| PF02511 | Thy1 | 0.71 |
| PF09374 | PG_binding_3 | 0.71 |
| PF04389 | Peptidase_M28 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.21 % |
| All Organisms | root | All Organisms | 29.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 29.79% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 18.44% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.64% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 6.38% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 4.26% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.55% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.55% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.84% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.84% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 2.13% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.13% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.42% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.42% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.42% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.42% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.71% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.71% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.71% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.71% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.71% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.71% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.71% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.71% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.71% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.71% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300003583 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024328 | Seawater microbial communities from Monterey Bay, California, United States - 44D | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
| 3300032257 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_1000989311 | 3300000101 | Marine | MTTVKVFVHDVFLCTIPEXKVXXMFAYLRRKGITNVTISEV* |
| DelMOSum2011_100379823 | 3300000115 | Marine | MIKVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTISEV* |
| DelMOSpr2010_100780952 | 3300000116 | Marine | MTKVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTISE* |
| DelMOSpr2010_101496722 | 3300000116 | Marine | MIKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTISEV* |
| DelMOWin2010_100481493 | 3300000117 | Marine | MTAVKVFVHDVFLCTIPEDKMESMFAYLRRKGITNVTIRE* |
| DelMOWin2010_100830401 | 3300000117 | Marine | MTTVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTISE* |
| DelMOWin2010_101312073 | 3300000117 | Marine | VKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTIRE* |
| DelMOWin2010_102246411 | 3300000117 | Marine | MTTVKVFVHDVFLCTIPEDKVEGMFAYLRRKGITNVTISEV* |
| DelMOWin2010_102292652 | 3300000117 | Marine | VFVHDVFLCTIPEDKVEGMFAYLRRKGITSVTISEV* |
| JGI26253J51717_10022665 | 3300003583 | Marine | MTKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTISEV* |
| Ga0066605_101648474 | 3300004279 | Marine | MTKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTISE* |
| Ga0070727_103095012 | 3300005590 | Marine Sediment | MTTVKVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISEV* |
| Ga0078746_10428413 | 3300005821 | Marine Sediment | TGGFMMSTVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTIREV* |
| Ga0078893_117462892 | 3300005837 | Marine Surface Water | MTTVKVFVHDVFLCTIPENKVDSMFAYLRSKGVTNVTIREV* |
| Ga0070742_101378992 | 3300005942 | Estuarine | MIKVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTISE* |
| Ga0075474_100061905 | 3300006025 | Aqueous | MTTVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTIREV* |
| Ga0075474_100566853 | 3300006025 | Aqueous | MTTVKVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTIRE* |
| Ga0075478_100145376 | 3300006026 | Aqueous | MTTVKVFVHDVFLCTIPEDKIEGMFAYLRRKGITNVTISE* |
| Ga0075462_100172194 | 3300006027 | Aqueous | TTVKVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISGV* |
| Ga0075466_11791281 | 3300006029 | Aqueous | MTTVKVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISE |
| Ga0099972_118928021 | 3300006467 | Marine | MTKVKVFVHDVFLCTIPENKIEGMFAYLRRKGITNVTISEV* |
| Ga0098048_10604244 | 3300006752 | Marine | MIKVKVFVHDVFLCTIPENKVESMFAYLRRKGVTNVTIREV* |
| Ga0098048_10883282 | 3300006752 | Marine | MTTVKVFVHDVFLCTIPENKIEGMFAYLRRKGITNVTISEV* |
| Ga0098048_11216582 | 3300006752 | Marine | MTTVKVFVHDVFLCTIPENKIEGMFAYLRRKGITNVTISE* |
| Ga0098048_12022191 | 3300006752 | Marine | MTTVKVFVHDVFLCTIPENKVEGMFAYLRRKGVTNVTISEV* |
| Ga0098054_10383044 | 3300006789 | Marine | MTTVKVFVHDVFFCTIPEDKVESMFAYLRRKGITNVTIREV* |
| Ga0098054_11761321 | 3300006789 | Marine | MIKVKVFVHDVFLCTIPENKVESMFAYLRRKGVTNVTISEV* |
| Ga0098055_12203111 | 3300006793 | Marine | KVFVHDVFLCTIPENKIEGMFAYLRRKGITNVTISEV* |
| Ga0098055_12448843 | 3300006793 | Marine | MTTVKVFVHDVFLCTIPENKVEGMFAYLRRKGVTNVTISE* |
| Ga0098055_12809011 | 3300006793 | Marine | MTTVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTICE* |
| Ga0070749_103492243 | 3300006802 | Aqueous | MTTVKVFVHDVFLCTIPEDKVEGMFAYLRRKGITSVTISEV* |
| Ga0070749_104873281 | 3300006802 | Aqueous | VKVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISEV* |
| Ga0070749_105069281 | 3300006802 | Aqueous | KGMTTVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTIREV* |
| Ga0075467_102020713 | 3300006803 | Aqueous | MSTVKVFVHDVFLCTIPENKVDSMFAYLRRKGITNVTISEV* |
| Ga0070754_102554582 | 3300006810 | Aqueous | MTTVKVFVHDVFLCTIPEDKVEGMFAYLRRKGITNVTIRE* |
| Ga0075481_101700414 | 3300006868 | Aqueous | MTTVKVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTIS |
| Ga0075481_102388471 | 3300006868 | Aqueous | KVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISEV* |
| Ga0075479_102514852 | 3300006870 | Aqueous | KVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTIRE* |
| Ga0075479_103737362 | 3300006870 | Aqueous | MTTVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTIRE* |
| Ga0070750_102629352 | 3300006916 | Aqueous | MTTVKVVVHDVFLCTKPEDKIEGMFAYLRRKGITNVTISE* |
| Ga0070750_103734862 | 3300006916 | Aqueous | VHDVFLCTIPEDKVEGMFAYLRRKGITSVTISEV* |
| Ga0070750_104019263 | 3300006916 | Aqueous | MTTVRVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISEV* |
| Ga0070748_13625241 | 3300006920 | Aqueous | KVFVHDVFLCTIPEDKVEGMFAYLRRKGITNVTISGV* |
| Ga0098051_10592343 | 3300006924 | Marine | MTTVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTICE* |
| Ga0098051_10722874 | 3300006924 | Marine | MTTVKVFVHDVFLCTIPESKVESMFAYLRRKGITNVTISE* |
| Ga0098051_11487751 | 3300006924 | Marine | MTKVKVFVHDVFLCTIPENKVESMFAYLRRKGVTNVTISEV* |
| Ga0098050_10636045 | 3300006925 | Marine | GGFMMIKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTISEV* |
| Ga0098046_10457841 | 3300006990 | Marine | MTTVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTISE* |
| Ga0075468_101926922 | 3300007229 | Aqueous | FVHDVFLCTIPEDKVEGMFAYLRRKGITNVTISEV* |
| Ga0075460_100298054 | 3300007234 | Aqueous | TVKVFVHDVFLCTIPEDKVEGMFAYLRRKGITNVTISGV* |
| Ga0070747_12558091 | 3300007276 | Aqueous | KVFVHDVFLCTIPEDKVEGMFAYLRRKGITNVTISEV* |
| Ga0070752_13160361 | 3300007345 | Aqueous | MTTVKVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISE* |
| Ga0099847_12008272 | 3300007540 | Aqueous | MTTVKVFVHDVFLSTLPDDKVEGMFAYLRRKGITNVTIREV* |
| Ga0114904_11283081 | 3300008218 | Deep Ocean | MSTVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTISEV* |
| Ga0114910_11560772 | 3300008220 | Deep Ocean | MGEGGNVMSTVKVFLHDVFLCTIPENKVEGMFAYLRRKGITNVTISEV* |
| Ga0102963_12083631 | 3300009001 | Pond Water | MIKVKVFVHDVFLCTIPENKIEGMLAYLRRKGITNVIVREV* |
| Ga0102811_11823242 | 3300009024 | Estuarine | MTKVKVFVYDVFLCTIPENKIEGMFAYLRRKGITNVTISE* |
| Ga0114902_11630932 | 3300009413 | Deep Ocean | MGEGGGVMTTVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTISEV* |
| Ga0114909_11725082 | 3300009414 | Deep Ocean | MGEGGNVMSTVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTIRE* |
| Ga0114919_108379522 | 3300009529 | Deep Subsurface | MTTVKVFVHDVFLCTMPENKVEGMFAYLRRKGITNVTIREV* |
| Ga0114901_10100542 | 3300009604 | Deep Ocean | MTTVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTISEV* |
| Ga0098049_11068092 | 3300010149 | Marine | MIKVKVFVHDVFLCTIPENKIEGMFAYLRRKGITNVTISE* |
| Ga0098049_11399913 | 3300010149 | Marine | MIKVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTIREV* |
| Ga0098056_12056061 | 3300010150 | Marine | MIKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTI |
| Ga0151669_1609412 | 3300011128 | Marine | MTKVKVFVHDVFLCTIPENKVESMFAYLRRKGVTTVTISE* |
| Ga0151674_10846502 | 3300011252 | Marine | MTTVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTISE* |
| Ga0151675_10171612 | 3300011254 | Marine | MTTVKVFVHDVFLCTIPENKVESMFAYLRRKGVTNVTISE* |
| Ga0151677_10123004 | 3300011258 | Marine | MTKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTIRE* |
| Ga0151677_10381173 | 3300011258 | Marine | MIKVKVFVHDVFLCTIPEGKVEGMFAYLRRKGITNVTIREV* |
| Ga0180120_101191423 | 3300017697 | Freshwater To Marine Saline Gradient | MTTVKVFVHDVFLCTIPEDKVDSMFAYLRRKGITNVTISEV |
| Ga0180120_101471433 | 3300017697 | Freshwater To Marine Saline Gradient | MTTVKVFVHDVFLCTIPENKVDSMFAYLRRKGITNVTISEV |
| Ga0180120_104448562 | 3300017697 | Freshwater To Marine Saline Gradient | FVHDVFLCTIPEDKVEGMFAYLRRKGITNVTISGV |
| Ga0181377_10251455 | 3300017706 | Marine | MTKVKVFVHDVFLCTIPENRVEGMFAYLRRKGITNVTISE |
| Ga0181377_10712763 | 3300017706 | Marine | MSKVKVFVHDVFLCTIPENKVESMLSYLRRKGITNVTISE |
| Ga0181403_10381512 | 3300017710 | Seawater | MIKVKVFVYDVFLCTIPENKVESMFAYLCRKGVTNITISE |
| Ga0181391_10893922 | 3300017713 | Seawater | MTKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTIRE |
| Ga0181381_10351622 | 3300017726 | Seawater | MIKVKVFVYDVFLCTIPENKVESMFAYLCRKGVTNVTISE |
| Ga0181401_10266833 | 3300017727 | Seawater | MIKVKVFVHDVFLCTVPEDKVESMFAYLRRKGVTNVTIREV |
| Ga0181433_11697253 | 3300017739 | Seawater | MTTVKVFVHDVFLCTIPEDKVEGMFAYLRRKGVTNVTIREV |
| Ga0181407_11367802 | 3300017753 | Seawater | MIKVKVFVHDVFLCTIPENKIEGMFAYLRRKGITNVTIRE |
| Ga0181413_10540692 | 3300017765 | Seawater | MIKVKVFVHDVFLCTIPENKIEGMFAYLRRKGITNVTISE |
| Ga0181406_12259003 | 3300017767 | Seawater | MTKVKVFVHDVFLCTIPENKVESMFAYLRRKGVTNVTIREV |
| Ga0181394_10884643 | 3300017776 | Seawater | MIKVKVFVHDVFLCTIPEDKVESMFAYLRRKGVTNVTIREV |
| Ga0181394_12254292 | 3300017776 | Seawater | MTKVKVFVHDVFLCTIPENKVESMFAYLRRKGVTNVTIRE |
| Ga0181380_12263851 | 3300017782 | Seawater | MIKVKVFVHDVFLCTIPEDKVESMFAYLRRKGVTNVTISEV |
| Ga0181559_100697575 | 3300018415 | Salt Marsh | MTTVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTIRE |
| Ga0194023_10861672 | 3300019756 | Freshwater | MTTVKVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISEV |
| Ga0211576_102480082 | 3300020438 | Marine | MIKVKVFVNDVYLCTMLECKIEDMLSYLRRKGITNVTIRE |
| Ga0206677_100654624 | 3300021085 | Seawater | MTKVKVFVHDVFLCTIPEDKVESMFAYLRRKGVTNVTIREV |
| Ga0206677_102398852 | 3300021085 | Seawater | MIKVKVFVHDVFLCTIPENKVESMFAYLRRKGVTNVTIREV |
| Ga0213863_103800792 | 3300021371 | Seawater | FVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISEV |
| Ga0213869_100288907 | 3300021375 | Seawater | MTTVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTIRE |
| Ga0213861_100456403 | 3300021378 | Seawater | MTTVKVFVHDVFLCTIPENKIEGMFAYLRRKGITNVTIRE |
| Ga0222717_100068873 | 3300021957 | Estuarine Water | MIKVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTISE |
| Ga0222717_100759775 | 3300021957 | Estuarine Water | MTKVKVFVHDVFLCTIPENKIEGMFAYLRRKGITNVTISEV |
| Ga0222718_104719342 | 3300021958 | Estuarine Water | IKVKVFVHDVFLCTIPENKVESMFAYLRRKGVTNVTISEV |
| Ga0222715_101247044 | 3300021960 | Estuarine Water | MIKVKVFVHDVFLCTIPENKVESMFAYLRRKGVTNVTISEV |
| Ga0222719_102350482 | 3300021964 | Estuarine Water | MTKVKVFVHDVFLCTIPENKVESMFAYLRRKGVTNVTISEV |
| Ga0212025_10113761 | 3300022057 | Aqueous | MTTVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTISEV |
| Ga0196895_10342822 | 3300022067 | Aqueous | PKVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISEV |
| Ga0196889_10806963 | 3300022072 | Aqueous | MTTVKVFVHDVFLCTIPEDKVEGMFAYLRRKGITNVTISEV |
| Ga0224906_10061168 | 3300022074 | Seawater | MIKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTISE |
| Ga0224906_10267052 | 3300022074 | Seawater | MTTVKVFVHDVFLCTIPENKVESMFAYLRRKGVTNVTIREV |
| Ga0224906_10911973 | 3300022074 | Seawater | KVFVHDVFLCTIPEDKVESMFAYLRRKGVTNVTIREV |
| Ga0196891_10808111 | 3300022183 | Aqueous | TTVKVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISEV |
| Ga0196899_10373004 | 3300022187 | Aqueous | MTTVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTIREV |
| Ga0196899_11307622 | 3300022187 | Aqueous | MTTVKVFVHDVFLCTIPEDKVEGMFAYLRRKGITSVTISEV |
| Ga0224502_101575852 | 3300022218 | Sediment | MIKVKVFVHDVFLCTIPENKVESMFAYLRRKGVTNVTISE |
| Ga0224504_101281793 | 3300022308 | Sediment | MIKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTIRE |
| (restricted) Ga0233432_102739402 | 3300023109 | Seawater | MIKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTISEV |
| (restricted) Ga0233432_103700751 | 3300023109 | Seawater | MIKVKVFVHDVFLCTIPEDKVESMLSYLRRKGITNVTIRE |
| (restricted) Ga0233410_102916792 | 3300023276 | Seawater | MTKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTISE |
| (restricted) Ga0255039_100511621 | 3300024062 | Seawater | MTKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTISEV |
| Ga0228635_11352142 | 3300024328 | Seawater | MTTVKVFVHDVFFCTIPEDKIEGMFAYLRRKGITNVTIREV |
| (restricted) Ga0255047_104052212 | 3300024520 | Seawater | FVHDVFLCTIPENKVESMFAYLRRKGITNVTISEV |
| Ga0208298_10274965 | 3300025084 | Marine | MTTVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTISE |
| Ga0208434_10901632 | 3300025098 | Marine | MTTVKVFVHDVFLCTIPENKIEGMFAYLRRKGITNVTISEV |
| Ga0208434_10952823 | 3300025098 | Marine | MIKVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTISE |
| Ga0208434_11105562 | 3300025098 | Marine | MTTVKVFVHDVFLCTIPENKVEGMFAYLRRKGVTNVTIRE |
| Ga0208013_10097545 | 3300025103 | Marine | MTTVKVFVHDVFFCTIPEDKVESMFAYLRRKGITNVTIREV |
| Ga0208793_10538551 | 3300025108 | Marine | GGFMMIKVKVFVHDVFLCTIPENKVESMFAYLRRKGITNVTISEV |
| Ga0208793_10566105 | 3300025108 | Marine | MIKVKVFVQDVFLCTIPENKVESMFAYLRRKGVTNVTIREV |
| Ga0208684_10498732 | 3300025305 | Deep Ocean | MSTVKVFVHDVFLCTIPENKVEGMFAYLRRKGITNVTISEV |
| Ga0208148_10395801 | 3300025508 | Aqueous | FVHDVFLCTIPEDKVEGMFAYLRRKGITNVTISEV |
| Ga0208149_10129373 | 3300025610 | Aqueous | MTTVKVFVHDVFLCTIPEDKIEGMFAYLRRKGITNVTISE |
| Ga0208149_10850473 | 3300025610 | Aqueous | MTTVKVFVHDVFLCTIPEDKVGSMFAYLRRKGITN |
| Ga0208134_10695441 | 3300025652 | Aqueous | VFVHDVFLCTIPEDKVEGMFAYLRRKGITNVTISEV |
| Ga0208162_10762592 | 3300025674 | Aqueous | MTTVRVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISEV |
| Ga0208162_11374973 | 3300025674 | Aqueous | TVKVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTISEV |
| Ga0208150_12220151 | 3300025751 | Aqueous | KVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTIRE |
| Ga0208899_11056963 | 3300025759 | Aqueous | MTTVKVFVHDVFLCTIPEDKVEGMFAYLRRKGITNVTIRE |
| Ga0208427_12071981 | 3300025771 | Aqueous | MTTVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTIRE |
| Ga0208427_12652591 | 3300025771 | Aqueous | MTTVKVFVHDVFLCTIPEDKVGSMFAYLRRKGITNVTIRE |
| Ga0208545_100183614 | 3300025806 | Aqueous | TVKVFVHDVFLCTIPEDKVEGMFAYLRRKGITNVTISEV |
| Ga0208645_11582103 | 3300025853 | Aqueous | MIKVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTIREV |
| Ga0209631_100936043 | 3300025890 | Pelagic Marine | MTTVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTISE |
| Ga0316201_109674592 | 3300032136 | Worm Burrow | MGEGGSVMSTVKVFVHDVFLCTIPENKVDSMFAYLRRKGITNVTISEV |
| Ga0316208_10859741 | 3300032254 | Microbial Mat | VKVFVHDVFLCTIPENKVGSMFAYLRRKGITNVTIREV |
| Ga0316205_101005624 | 3300032257 | Microbial Mat | MTTVKVFVHDVFLCTIPEDKVEGMFAYLRRKGITNVTISGV |
| Ga0316202_101324113 | 3300032277 | Microbial Mat | MITVKVFVHDVFLCTIPENKVGSMFAYLRRKGITNVTIREV |
| Ga0348336_051347_1039_1164 | 3300034375 | Aqueous | MTTVKVFVHDVFLCTIPEDKVESMFAYLRRKGITNVTIREV |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |