Basic Information | |
---|---|
Family ID | F053790 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 140 |
Average Sequence Length | 43 residues |
Representative Sequence | MSERVYVCVVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLME |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 140 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 82.48 % |
% of genes near scaffold ends (potentially truncated) | 22.86 % |
% of genes from short scaffolds (< 2000 bps) | 67.86 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (37.857 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (31.429 % of family members) |
Environment Ontology (ENVO) | Unclassified (58.571 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (80.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.68% β-sheet: 18.31% Coil/Unstructured: 69.01% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 140 Family Scaffolds |
---|---|---|
PF02915 | Rubrerythrin | 37.14 |
PF00301 | Rubredoxin | 16.43 |
PF00383 | dCMP_cyt_deam_1 | 5.71 |
PF00011 | HSP20 | 5.00 |
PF03104 | DNA_pol_B_exo1 | 2.14 |
PF04308 | RNaseH_like | 1.43 |
PF14090 | HTH_39 | 0.71 |
PF05226 | CHASE2 | 0.71 |
PF13472 | Lipase_GDSL_2 | 0.71 |
PF03480 | DctP | 0.71 |
PF13759 | 2OG-FeII_Oxy_5 | 0.71 |
PF13177 | DNA_pol3_delta2 | 0.71 |
PF03819 | MazG | 0.71 |
PF00211 | Guanylate_cyc | 0.71 |
PF11160 | Hva1_TUDOR | 0.71 |
PF11056 | UvsY | 0.71 |
PF01075 | Glyco_transf_9 | 0.71 |
PF01467 | CTP_transf_like | 0.71 |
PF13671 | AAA_33 | 0.71 |
PF02916 | DNA_PPF | 0.71 |
PF00154 | RecA | 0.71 |
PF01653 | DNA_ligase_aden | 0.71 |
PF01818 | Translat_reg | 0.71 |
PF10431 | ClpB_D2-small | 0.71 |
PF03851 | UvdE | 0.71 |
PF14236 | DUF4338 | 0.71 |
PF00085 | Thioredoxin | 0.71 |
COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
---|---|---|---|
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 5.00 |
COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 2.14 |
COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.71 |
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.71 |
COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.71 |
COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.71 |
COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.71 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 62.14 % |
Unclassified | root | N/A | 37.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000268|M3P_10213857 | Not Available | 563 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1002588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12550 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1012926 | Not Available | 4335 | Open in IMG/M |
3300001605|Draft_10113677 | All Organisms → Viruses → Predicted Viral | 1908 | Open in IMG/M |
3300001836|RCM27_1006916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 776 | Open in IMG/M |
3300001836|RCM27_1022989 | Not Available | 601 | Open in IMG/M |
3300001837|RCM39_1002312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1413 | Open in IMG/M |
3300001849|RCM26_1076204 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300001850|RCM37_1002923 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300001850|RCM37_1009060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
3300001850|RCM37_1108032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300001851|RCM31_10344552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 538 | Open in IMG/M |
3300002301|JGI24891J29808_1018417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
3300002307|JGI24890J29729_1000008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 264637 | Open in IMG/M |
3300002835|B570J40625_100015499 | Not Available | 13347 | Open in IMG/M |
3300002835|B570J40625_100592336 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
3300003375|JGI26470J50227_1065108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
3300003375|JGI26470J50227_1069510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
3300003787|Ga0007811_1002239 | All Organisms → Viruses → Predicted Viral | 2587 | Open in IMG/M |
3300003796|Ga0007865_1003292 | All Organisms → Viruses → Predicted Viral | 2065 | Open in IMG/M |
3300003806|Ga0007864_1008842 | Not Available | 798 | Open in IMG/M |
3300003806|Ga0007864_1010799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300003812|Ga0007861_1020961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300004112|Ga0065166_10067900 | Not Available | 1230 | Open in IMG/M |
3300004112|Ga0065166_10230509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
3300004684|Ga0065168_1077207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
3300004685|Ga0065177_1006782 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
3300004685|Ga0065177_1055714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 741 | Open in IMG/M |
3300004686|Ga0065173_1014371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1456 | Open in IMG/M |
3300004686|Ga0065173_1079742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
3300004686|Ga0065173_1092124 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300004692|Ga0065171_1001740 | Not Available | 3487 | Open in IMG/M |
3300004770|Ga0007804_1093277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
3300004770|Ga0007804_1145002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thiothrix → Thiothrix caldifontis | 596 | Open in IMG/M |
3300004777|Ga0007827_10160278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
3300005517|Ga0070374_10051616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2140 | Open in IMG/M |
3300005527|Ga0068876_10185935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1210 | Open in IMG/M |
3300005662|Ga0078894_10997656 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300005662|Ga0078894_11398772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
3300005805|Ga0079957_1008388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7994 | Open in IMG/M |
3300005805|Ga0079957_1252228 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300006071|Ga0007876_1054594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1076 | Open in IMG/M |
3300006072|Ga0007881_1037129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1298 | Open in IMG/M |
3300006100|Ga0007806_1047879 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300006108|Ga0007862_1002532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4818 | Open in IMG/M |
3300006109|Ga0007870_1044436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
3300006129|Ga0007834_1029673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1408 | Open in IMG/M |
3300006129|Ga0007834_1126393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300008055|Ga0108970_10061923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 4620 | Open in IMG/M |
3300008110|Ga0114343_1014620 | Not Available | 4228 | Open in IMG/M |
3300008110|Ga0114343_1097007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1028 | Open in IMG/M |
3300008113|Ga0114346_1045544 | All Organisms → cellular organisms → Bacteria | 2216 | Open in IMG/M |
3300008116|Ga0114350_1062596 | Not Available | 1303 | Open in IMG/M |
3300008117|Ga0114351_1006207 | Not Available | 8910 | Open in IMG/M |
3300008120|Ga0114355_1064071 | Not Available | 2044 | Open in IMG/M |
3300008258|Ga0114840_1024746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
3300008259|Ga0114841_1134061 | Not Available | 1011 | Open in IMG/M |
3300008261|Ga0114336_1176909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300008266|Ga0114363_1029257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2340 | Open in IMG/M |
3300008267|Ga0114364_1068482 | Not Available | 1203 | Open in IMG/M |
3300009164|Ga0114975_10732705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300009169|Ga0105097_10888299 | Not Available | 511 | Open in IMG/M |
3300009239|Ga0103858_10052463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 966 | Open in IMG/M |
3300009247|Ga0103861_10062129 | Not Available | 594 | Open in IMG/M |
3300010334|Ga0136644_10098715 | Not Available | 1818 | Open in IMG/M |
3300010354|Ga0129333_10169399 | Not Available | 1997 | Open in IMG/M |
3300010354|Ga0129333_11433494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300011268|Ga0151620_1002102 | Not Available | 7547 | Open in IMG/M |
3300011268|Ga0151620_1018936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2409 | Open in IMG/M |
3300012347|Ga0157142_1000039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 72100 | Open in IMG/M |
3300012347|Ga0157142_1036553 | Not Available | 714 | Open in IMG/M |
3300012348|Ga0157140_10000338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5802 | Open in IMG/M |
3300012667|Ga0157208_10005218 | All Organisms → Viruses → Predicted Viral | 2091 | Open in IMG/M |
3300012667|Ga0157208_10028918 | Not Available | 743 | Open in IMG/M |
3300013093|Ga0164296_1023441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3726 | Open in IMG/M |
3300013094|Ga0164297_10274177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10050508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3315 | Open in IMG/M |
3300014962|Ga0134315_1017744 | Not Available | 1107 | Open in IMG/M |
3300017766|Ga0181343_1130587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300019784|Ga0181359_1181938 | Not Available | 693 | Open in IMG/M |
3300020533|Ga0208364_1016791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1055 | Open in IMG/M |
3300020536|Ga0207939_1002845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3599 | Open in IMG/M |
3300020733|Ga0214172_1020966 | Not Available | 1059 | Open in IMG/M |
3300021127|Ga0214193_1027411 | Not Available | 675 | Open in IMG/M |
3300021131|Ga0214206_1001461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5488 | Open in IMG/M |
3300021137|Ga0214165_1074031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300021142|Ga0214192_1014101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3068 | Open in IMG/M |
3300021962|Ga0222713_10241016 | Not Available | 1184 | Open in IMG/M |
3300021962|Ga0222713_10478897 | Not Available | 749 | Open in IMG/M |
3300021962|Ga0222713_10491270 | Not Available | 736 | Open in IMG/M |
3300021963|Ga0222712_10012251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7640 | Open in IMG/M |
3300021963|Ga0222712_10078396 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
3300021963|Ga0222712_10305558 | Not Available | 996 | Open in IMG/M |
3300021963|Ga0222712_10344370 | Not Available | 921 | Open in IMG/M |
3300022156|Ga0213934_1015189 | Not Available | 1007 | Open in IMG/M |
3300022555|Ga0212088_10472578 | Not Available | 818 | Open in IMG/M |
3300022602|Ga0248169_107374 | Not Available | 9788 | Open in IMG/M |
3300022602|Ga0248169_107720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9384 | Open in IMG/M |
3300022602|Ga0248169_140480 | All Organisms → Viruses → Predicted Viral | 2264 | Open in IMG/M |
3300022602|Ga0248169_141341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2225 | Open in IMG/M |
3300022748|Ga0228702_1029272 | Not Available | 1685 | Open in IMG/M |
3300023700|Ga0228707_1048354 | Not Available | 614 | Open in IMG/M |
3300024482|Ga0255265_1008854 | Not Available | 1966 | Open in IMG/M |
3300024544|Ga0255294_1100606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300024554|Ga0255242_1060425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300024564|Ga0255237_1078747 | Not Available | 756 | Open in IMG/M |
3300024567|Ga0256307_1161175 | Not Available | 515 | Open in IMG/M |
3300024866|Ga0255272_1097047 | Not Available | 738 | Open in IMG/M |
3300025369|Ga0208382_1011614 | All Organisms → Viruses → Predicted Viral | 1356 | Open in IMG/M |
3300025372|Ga0207957_1011109 | Not Available | 1229 | Open in IMG/M |
3300025379|Ga0208738_1006560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2109 | Open in IMG/M |
3300025379|Ga0208738_1006696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2087 | Open in IMG/M |
3300025379|Ga0208738_1058577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300025383|Ga0208250_1062823 | Not Available | 520 | Open in IMG/M |
3300025387|Ga0207959_1000781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7745 | Open in IMG/M |
3300025392|Ga0208380_1001721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4980 | Open in IMG/M |
3300025396|Ga0208874_1034146 | Not Available | 758 | Open in IMG/M |
3300025413|Ga0208614_1021932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1040 | Open in IMG/M |
3300025418|Ga0208253_1000346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 20183 | Open in IMG/M |
3300025418|Ga0208253_1049394 | Not Available | 717 | Open in IMG/M |
3300025424|Ga0208617_1082162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300025426|Ga0208739_1074880 | Not Available | 528 | Open in IMG/M |
3300025435|Ga0208618_1071770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300025781|Ga0208386_1040095 | Not Available | 651 | Open in IMG/M |
3300028025|Ga0247723_1000595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 24098 | Open in IMG/M |
3300031758|Ga0315907_10087678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2678 | Open in IMG/M |
3300031758|Ga0315907_10436460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
3300031784|Ga0315899_10208029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1968 | Open in IMG/M |
3300031787|Ga0315900_10411181 | Not Available | 1063 | Open in IMG/M |
3300031857|Ga0315909_10882909 | Not Available | 554 | Open in IMG/M |
3300032668|Ga0316230_1212159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300032668|Ga0316230_1279131 | Not Available | 558 | Open in IMG/M |
3300032677|Ga0316227_1058889 | All Organisms → Viruses → Predicted Viral | 1611 | Open in IMG/M |
3300032677|Ga0316227_1286343 | Not Available | 547 | Open in IMG/M |
3300034062|Ga0334995_0070003 | Not Available | 2767 | Open in IMG/M |
3300034092|Ga0335010_0350428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300034102|Ga0335029_0000683 | Not Available | 27203 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 31.43% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.86% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.14% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.43% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.71% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 5.71% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.00% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.29% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 3.57% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.57% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.57% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.14% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.43% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.43% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.43% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.43% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.43% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.43% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.71% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.71% |
Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.71% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.71% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.71% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.71% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.71% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000268 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 | Environmental | Open in IMG/M |
3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
3300001837 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3a | Environmental | Open in IMG/M |
3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300002301 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI co-culture FSW-F8 | Environmental | Open in IMG/M |
3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
3300003796 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 | Environmental | Open in IMG/M |
3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
3300003812 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
3300006107 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07 | Environmental | Open in IMG/M |
3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
3300006129 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012347 | Freshwater microbial communities from Fish Creek, Ontario, Canada - S48 | Environmental | Open in IMG/M |
3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
3300021127 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 epilimnion | Environmental | Open in IMG/M |
3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300023700 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024482 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024544 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024554 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024564 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025418 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025424 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 (SPAdes) | Environmental | Open in IMG/M |
3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025435 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (SPAdes) | Environmental | Open in IMG/M |
3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032668 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025 | Environmental | Open in IMG/M |
3300032677 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
M3P_102138571 | 3300000268 | Lotic | MSEQQERIYVCVVCGHQLNESDWLSLPDEVNCPECGVSKNDYVLME* |
TBL_comb48_EPIDRAFT_100258815 | 3300000439 | Freshwater | MSERIYVCVVCGHQLSEADWLSLPDEVNCPECGVSKNDYVLME* |
TBL_comb48_EPIDRAFT_10129265 | 3300000439 | Freshwater | MSYYRCVVCGHILSVEDYNSLPDDVCCPECGVSKSDYELVTE* |
Draft_101136774 | 3300001605 | Hydrocarbon Resource Environments | MKRYYRCVVCGHILSEDDYASLPDSVGCPECGVSKEDYELVVEE* |
RCM27_10069162 | 3300001836 | Marine Plankton | MKRYYRCVVCGHILSEEDYASLPDSVGCPECGVSKSDYELVKE* |
RCM27_10229892 | 3300001836 | Marine Plankton | MNNVVYICVVCGHTLSEEDWMSLPDEVNCPECGVNKNDYVRTEL* |
RCM39_10023122 | 3300001837 | Marine Plankton | MKRYYRCVVCGHILSEEDYASLPDSVSCPECGVSKEDYELVIEK* |
RCM26_10762042 | 3300001849 | Marine Plankton | MENRYYRCVVCGHILSVEDYESLPDTVGCPECGVSKEDYELVVE* |
RCM37_10029232 | 3300001850 | Marine Plankton | MSERVYVCIVCGHTLSEADWLSLPDSVNCPECGVSKDDYVLME* |
RCM37_10090602 | 3300001850 | Marine Plankton | MSEQNERIYVCVVCGHQLSEADWLSLPDEVNCPECGVSKNDYVLME* |
RCM37_11080321 | 3300001850 | Marine Plankton | MKRYYRCVVCGHILSEEDYASLPDSVGCPECGVSKEDYELVVE* |
RCM31_103445522 | 3300001851 | Marine Plankton | MTQVYRCVVCGHELSVEDYNSLPDECTCPECGVSKSDYELVTL* |
JGI24891J29808_10184172 | 3300002301 | Lentic | MSGRVYVCIVCGHTLSEEDYLSLPDSVNCPECGVSKEDYVLME* |
JGI24890J29729_1000008224 | 3300002307 | Lentic | MTERIYVCVVCGHTLSEEDWLSLPDEVNCPECGVSKNDYELMEL* |
B570J40625_10001549916 | 3300002835 | Freshwater | MRYYRCVVCGHILTEEDYAMLPDSVGCPECGVSKQDYELIVEE* |
B570J40625_1005923362 | 3300002835 | Freshwater | MSEQKERIYVCIVCGHTLSESDWLSLPDEVNCPECGVSKQDYVLME* |
JGI26470J50227_10651081 | 3300003375 | Freshwater | MKEYYRCVVCGHILSVEDWNSLPDEVPCPECGVSKWDYELVKE* |
JGI26470J50227_10695102 | 3300003375 | Freshwater | MRYYRCVVCGHILSEEDYASLPDSVGCPECGVSKEDYELVIED* |
Ga0007811_10022392 | 3300003787 | Freshwater | MSERVYVCIVCGHTLSEADYLSLPDSVTCPECGVSKEDYVLME* |
Ga0007865_10032922 | 3300003796 | Freshwater | MSERVYVCIVCGHTLSEADYLSLPDSVTCPECGVSKEDYVXME* |
Ga0007864_10088422 | 3300003806 | Freshwater | MRRYYRCVVCGHEIEEADYLVLPDEVTCPECGVSKEDYELVVE* |
Ga0007864_10107991 | 3300003806 | Freshwater | RCVVCGHILSEEDYASLPDSVGCPECGVSKEDYELVIED* |
Ga0007861_10209612 | 3300003812 | Freshwater | IRRFTMRYYRCVVCGHILSEEDYASLPDSVGCPECGVSKEDYELVIED* |
Ga0065166_100679004 | 3300004112 | Freshwater Lake | MNSYYRCIVCGHILSVEDYNSLPDDVPCPECGVSKSDYELVTE* |
Ga0065166_102305092 | 3300004112 | Freshwater Lake | MSEQNERVYVCVVCGHQLSEADWLSLPDTVNCPECGVSKDDYVLME* |
Ga0065168_10772072 | 3300004684 | Freshwater | MEYYRCVVCGHILSVEDWNSLPDEVPCPECGVSKWDYELVKE* |
Ga0065177_10067825 | 3300004685 | Freshwater | MSERVYVCIVCGHTLSEADYLSLPDTVNCPECGVSKEDYVLME* |
Ga0065177_10557142 | 3300004685 | Freshwater | MERVYVCIVCGHTLSEADYLSLPDSVTCPECGVSKEDYVLMEV* |
Ga0065173_10143713 | 3300004686 | Freshwater | MSERIYVCIVCGHQLSENDWLSLPDEVNCPECGVSKHDYVLME* |
Ga0065173_10797422 | 3300004686 | Freshwater | MSERVYVCVVCGHTLSEEDWLSLPDEVNCPECGVSKNDYELMEL* |
Ga0065173_10921242 | 3300004686 | Freshwater | MKRVYVCVVCGHAIDEADYLSLPDEVTCPECGVSKQDYELQEVPA* |
Ga0065171_10017404 | 3300004692 | Freshwater | MERVYVCVVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLME* |
Ga0007804_10932773 | 3300004770 | Freshwater | MSERVYVCIVCGHTLSEADYLSLPDSATCPECGVSKEDYVLME* |
Ga0007804_11450021 | 3300004770 | Freshwater | MEKVYVCVVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLMEV* |
Ga0007827_101602782 | 3300004777 | Freshwater | MGERVYVCIVCGHTLSEADYLSLPDSVTCPECGVSKEDYVLME* |
Ga0070374_100516164 | 3300005517 | Freshwater Lake | MSGKIYVCIVCGHQLSEEDWLSLPDEANCPDCGVSKSDYVPME* |
Ga0068876_101859353 | 3300005527 | Freshwater Lake | MSERVYVCIVCGHTLSEADWLSLPDEVNCPECGVSKQDYVLME* |
Ga0078894_109976561 | 3300005662 | Freshwater Lake | IRESIMSERVYVCVVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLME* |
Ga0078894_113987722 | 3300005662 | Freshwater Lake | MRYYRCVVCGHILTEEDYAMLPDSVGCPECGVSKQDYELVVEE* |
Ga0079957_100838813 | 3300005805 | Lake | MEERTYICIVCGHTLSEADWLSLPDSASCPECGVSKEDYVLME* |
Ga0079957_12522282 | 3300005805 | Lake | MSEKVYVCIVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLME* |
Ga0007876_10545943 | 3300006071 | Freshwater | MSERVYVCIVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLMEG* |
Ga0007881_10371291 | 3300006072 | Freshwater | MSERVYVCIVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLM |
Ga0007806_10478792 | 3300006100 | Freshwater | MSERVYVCVVCGHTLSEADYLSLPDSVTCPECGVSKEDYVLME* |
Ga0007836_10433123 | 3300006107 | Freshwater | MKQVYRCIVCGHELSVADWESLPDEVCCPECGVSK |
Ga0007862_100253215 | 3300006108 | Freshwater | MGERVYVCVVCGHTLSEADYLSLPDSVTCPECGVSKEDYVLME* |
Ga0007870_10444366 | 3300006109 | Freshwater | SIGEPIMRRYYRCVVCGHEIEEADYLVLPDEVTCPECGVSKEDYELVVE* |
Ga0007834_10296731 | 3300006129 | Freshwater | CGSISSSIRRFTMRYYRCVVCGHILSEEDYASLPDSVGCPECGVSKEDYELVIED* |
Ga0007834_11263931 | 3300006129 | Freshwater | VVCGHEIEEADYLVLPDEVTCPECGVSKEDYELVVE* |
Ga0108970_100619236 | 3300008055 | Estuary | MSERIYVCIVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLMD* |
Ga0114343_10146205 | 3300008110 | Freshwater, Plankton | MRYYRCVVCGHILTEEDYAMLPDSVGCPECGVSKQDYELVVED* |
Ga0114343_10970073 | 3300008110 | Freshwater, Plankton | SYYRCIVCGHILSVEDYNSLPDDVPCPECGVSKSDYELVTE* |
Ga0114346_10455442 | 3300008113 | Freshwater, Plankton | MSERVYVCIVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLME* |
Ga0114350_10625963 | 3300008116 | Freshwater, Plankton | MSEKVYVCIVCGHTLSEADYLSLPDSVNCPECGVSKQDYILME* |
Ga0114351_100620710 | 3300008117 | Freshwater, Plankton | MSEKVYVCIVCGHTLSEADYLSLPDSADCPECGVSKQDYILME* |
Ga0114355_10640714 | 3300008120 | Freshwater, Plankton | VVCGHILTEEDYAMLPDSVGCPECGVSKQDYELVVEE* |
Ga0114840_10247464 | 3300008258 | Freshwater, Plankton | TNETGDRIMRYYRCVVCGHILTEEDYAMLPDSVGCPECGVSKQDYELVVEE* |
Ga0114841_11340611 | 3300008259 | Freshwater, Plankton | MSEKVYVCIVCGHTLSEADYLSLPDSVNCPECGVSKHDYVLME* |
Ga0114336_11769094 | 3300008261 | Freshwater, Plankton | CVVCGHILTEEDYAMLPDSVGCPECGVSKQDYELVVEE* |
Ga0114363_10292574 | 3300008266 | Freshwater, Plankton | MRYYRCVVCGHILTEEDYAMLPDSVGCPECGVSKQDYELVIED* |
Ga0114364_10684822 | 3300008267 | Freshwater, Plankton | MRYYRCVVCGHILTEEDYVMLPDSVGCPECGVSKQDYELVIED* |
Ga0114975_107327051 | 3300009164 | Freshwater Lake | MSDRIYVCVVCGHQLSEADWLSLPDEVNCPECGVSKSDYVLME* |
Ga0105097_108882991 | 3300009169 | Freshwater Sediment | MKRYYRCVVCGHILSEDDYASLPDSVGCPECGVSKEDYELVVDE |
Ga0103858_100524632 | 3300009239 | River Water | MSERIYVCVVCGHTLSEADWLSLPDSVNCPECGVSKDDYVLMEGD* |
Ga0103861_100621291 | 3300009247 | River Water | MSERIYVCVVCGHQLSEEDWLSLPDEVNCPECGVSKNDYVLMD* |
Ga0136644_100987152 | 3300010334 | Freshwater Lake | MSYYRCVVCGHILSVEDYNSLPDSVTCPECGVSKEDYELVAE* |
Ga0129333_101693992 | 3300010354 | Freshwater To Marine Saline Gradient | MSQNNQERVYVCVVCGHTLSEADWLSLPDEVNCPECGVSKQDYVLME* |
Ga0129333_114334942 | 3300010354 | Freshwater To Marine Saline Gradient | MMSEQKERVYVCVVCGHTLSEADWLSLPEEVNCPECGVSKNDYILME* |
Ga0151620_100210216 | 3300011268 | Freshwater | MSERIYVCVVCGHQLSEADWLSLPDSVNCPECGVSKDDYVLME* |
Ga0151620_10189363 | 3300011268 | Freshwater | MPERIYVCVVCGHQLSEADWLSLPDEVDCPECGVNKNDYVLME* |
Ga0157142_100003945 | 3300012347 | Freshwater | MSERIYVCVVCGHQLSEADWLSLPDTVNCPECGVSKDDYVLME* |
Ga0157142_10365532 | 3300012347 | Freshwater | MSEQQERIYVCVVCGHQLNESDWLSLPDEVNCPECGVSKN |
Ga0157140_1000033812 | 3300012348 | Freshwater | MSERIYVCVVCGHQLSEADWLSLPDEVNCPECGVSKHDYVLME* |
Ga0157208_100052184 | 3300012667 | Freshwater | MSDQKEVIYVCVVCGHTLSEADWLSLPDTVNCPECGVHKDDYVRTEL* |
Ga0157208_100289182 | 3300012667 | Freshwater | MSERIYVCIVCGHQLSEADWLSLPDTVNCPECGVSKDDYVLMD* |
Ga0164296_10234417 | 3300013093 | Freshwater | MSERVYVCVVCGHTLSEADYLSLPDSVNCPECGVSKEDYILVEI* |
Ga0164297_102741771 | 3300013094 | Freshwater | RFTMRYYRCVVCGHILSEEDYASLPDSVGCPECGVSKEDYELVIED* |
(restricted) Ga0172367_100505083 | 3300013126 | Freshwater | MSEQTERIYVCVVCGHQLSEADWLSLPDEVNCPECGVSKNDYVLME* |
Ga0134315_10177444 | 3300014962 | Surface Water | MSERVYVCIVCGHTLSEADWLSLPDSVNCPECGVSKNDYVLME* |
Ga0181343_11305873 | 3300017766 | Freshwater Lake | CVVCGHILTEEDYAMLPDSVGCPECGVSKQDYELVVEE |
Ga0181359_11819382 | 3300019784 | Freshwater Lake | MSGKIYVCIVCGHQLSEEDWLSLPDEANCPDCGVSKSDYVPME |
Ga0208364_10167913 | 3300020533 | Freshwater | MRYYRCVVCGHILTEEDYAMLPDSVGCPECGVSKQDYELVVEE |
Ga0207939_10028458 | 3300020536 | Freshwater | MRYYRCVVCGHILTEEDYAMLPDSVGCPECGVSKQDYELIVEE |
Ga0214172_10209661 | 3300020733 | Freshwater | MEKVYVCVVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLMEV |
Ga0214193_10274111 | 3300021127 | Freshwater | MERVYVCVVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLMEV |
Ga0214206_10014615 | 3300021131 | Freshwater | MSERVYVCIVCGHTLSEADYLSLPDTVNCPECGVSKEDYVLME |
Ga0214165_10740312 | 3300021137 | Freshwater | MRYYRCVVCGHILSEEDYASLPDSVGCPECGVSKEDYELVIED |
Ga0214192_10141018 | 3300021142 | Freshwater | MEYYRCVVCGHILSVEDWNSLPDEVPCPECGVSKWDYELVKE |
Ga0222713_102410163 | 3300021962 | Estuarine Water | MSERIYVCVVCGHQLSEADWLSLPDSVNCPECGVSKDDYVLME |
Ga0222713_104788973 | 3300021962 | Estuarine Water | MSEEKNERVYVCVVCSHQLSEADWLSLPDEVNCPECGVSKNDYVLME |
Ga0222713_104912702 | 3300021962 | Estuarine Water | MSEKVYVCIVCGHTLSEADYLSLPDFVNCPECGVSKEDYVLVE |
Ga0222712_1001225115 | 3300021963 | Estuarine Water | MRYYRCVVCGHILTEEDYVMLPDSVGCPECGVSKQDYELVVEE |
Ga0222712_100783962 | 3300021963 | Estuarine Water | MSERIYVCVVCGHQLSEADWLSLPDSVNCPECGVSKDDYVLQE |
Ga0222712_103055583 | 3300021963 | Estuarine Water | MPERIYVCVVCGHELSEADWLSLPDEVNCPECGVSKHDYVLME |
Ga0222712_103443701 | 3300021963 | Estuarine Water | MSEKVYVCVVCGHTLSEADWLSLPDSVNCPECGVSKDDYVLME |
Ga0213934_10151892 | 3300022156 | Freshwater | MSERIYVCIVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLME |
Ga0212088_104725782 | 3300022555 | Freshwater Lake Hypolimnion | MGERVYVCIVCGHTLSEADYLSLPDSVTCPECGVSKEDYVLME |
Ga0248169_1073747 | 3300022602 | Freshwater | MRYYRCVVCGHILSEEDYASLPDSVGCPECGVSKEDYELVVEE |
Ga0248169_1077203 | 3300022602 | Freshwater | MSERVYVCVVCGHTLSEADYLSLPDSVNCPECGVSKEDYILVEI |
Ga0248169_1404804 | 3300022602 | Freshwater | MSERVYVCIVCGHTLSEADYLSLPDSVTCPECGVSKEDYVLME |
Ga0248169_1413419 | 3300022602 | Freshwater | MSYYRCVVCGHILSVEDWESLPDEVPCPECGVSKWDYELVTE |
Ga0228702_10292723 | 3300022748 | Freshwater | MSERVYVCIVCGHQLSEADWLSLPDSVNCPECGVSKDDYVLME |
Ga0228707_10483542 | 3300023700 | Freshwater | MSESKEVIYVCVVCGHQLSEADWLSLPDTVNCPECGVSKDDYVRME |
Ga0255265_10088542 | 3300024482 | Freshwater | MSEQEKLYVCVVCGHTLSESDWMSLPDEVNCPECGASKHDYIPKE |
Ga0255294_11006062 | 3300024544 | Freshwater | MSEKVYVCIVCGHTLSEADYLSLPDSADCPECGVSKQDYILME |
Ga0255242_10604251 | 3300024554 | Freshwater | MSERIYVCIVCGHTLSEADYLSLPDYVICPECGVSKEDYVLME |
Ga0255237_10787472 | 3300024564 | Freshwater | MSERIYVCVVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLMD |
Ga0256307_11611752 | 3300024567 | Freshwater | MSERIYVCIVCGHTLSEADYLSLPDYVICPECGVSKE |
Ga0255272_10970471 | 3300024866 | Freshwater | MSEEKNERVYVCVVCSHQLSEADWLSLPDEVNCPECGLSKNDYVLME |
Ga0208382_10116145 | 3300025369 | Freshwater | MSERVYVCIVCGHTLSEADYLSLPDSATCPECGVSKEDYVLME |
Ga0207957_10111092 | 3300025372 | Freshwater | MERVYVCVVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLME |
Ga0208738_10065603 | 3300025379 | Freshwater | MSERVYVCIVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLMEG |
Ga0208738_10066961 | 3300025379 | Freshwater | IMEYYRCVVCGHILSVEDWNSLPDEVPCPECGVSKWDYELVKE |
Ga0208738_10198394 | 3300025379 | Freshwater | MKQVYRCIVCGHELSVADWESLPDEVCCPECGVSKWD |
Ga0208738_10585771 | 3300025379 | Freshwater | VCIVCGHTLSEADYLSLPDSVTCPECGVSKEDYVLMEV |
Ga0208250_10628232 | 3300025383 | Freshwater | MERVYVCIVCGHTLSEADYLSLPDSVTCPECGVSKEDYVLMEV |
Ga0207959_100078110 | 3300025387 | Freshwater | MGERVYVCVVCGHTLSEADYLSLPDSVTCPECGVSKEDYVLME |
Ga0208380_10017218 | 3300025392 | Freshwater | CVVCGHILSVEDWNSLPDEVPCPECGVSKWDYELVKE |
Ga0208874_10341461 | 3300025396 | Freshwater | MKRVYVCVVCGHAIDEADYLSLPDEVTCPECGVSKQDYELQEVPA |
Ga0208614_10219321 | 3300025413 | Freshwater | VCIVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLMEG |
Ga0208253_100034628 | 3300025418 | Freshwater | RCVVCGHILSVEDWNSLPDEVPCPECGVSKWDYELVKE |
Ga0208253_10493942 | 3300025418 | Freshwater | MSERVYVCVVCGHTLSEEDWLSLPDEVNCPECGVSKNDYELMEL |
Ga0208617_10821624 | 3300025424 | Freshwater | RCVVCGHEIEEADYLVLPDEVTCPECGVSKEDYELVVE |
Ga0208739_10748801 | 3300025426 | Freshwater | VCVVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLME |
Ga0208618_10717701 | 3300025435 | Freshwater | IVCGHTLSEADYLSLPDSVTCPECGVSKEDYVLMEV |
Ga0208388_100046821 | 3300025778 | Freshwater | MKEYYRCVVCGHILSVEDWNSLPDEVPCPECGVSK |
Ga0208386_10400952 | 3300025781 | Freshwater | MSYYRCVVCGHILSVEDYESLPDSVGCPECGVSKEDYELIVEE |
Ga0247723_100059533 | 3300028025 | Deep Subsurface Sediment | MSERIYVCVVCGHQLSEADWLSLPDSVNCPECGVSKEDYVLME |
Ga0315907_100876786 | 3300031758 | Freshwater | MSEKVYVCIVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLME |
Ga0315907_104364601 | 3300031758 | Freshwater | MRYYRCVVCGHILTEEDYAMLPDSVGCPECGVSKQDYELVIED |
Ga0315899_102080291 | 3300031784 | Freshwater | ETGDCIMRYYRCVVCGHILTEEDYAMLPDSVGCPECGVSKQDYELVVEE |
Ga0315900_104111811 | 3300031787 | Freshwater | MSEKVYVCIVCGHTLSEADYLSLPDTVNCPECGVSKEDYVLVE |
Ga0315909_108829091 | 3300031857 | Freshwater | NETGDCVMRYYRCVVCGHILTEEDYVMLPDSVGCPECGVSKQDYELVIED |
Ga0316230_12121591 | 3300032668 | Freshwater | GDTIMEYYRCVVCGHILSVEDWNSLPDEVPCPECGVSKWDYELVKE |
Ga0316230_12791312 | 3300032668 | Freshwater | MEYYRCVVCGHILSVEDWNSLPDEVPCPECGVSKWDYELVK |
Ga0316227_10588896 | 3300032677 | Freshwater | MSERVYVCIVCGHTLSEADYLSLPDSVTCPECGVSKEDYVL |
Ga0316227_12863431 | 3300032677 | Freshwater | MGERVYVCVVCGHTLSEADYLSLPDSVTCPECGVS |
Ga0334995_0070003_1483_1614 | 3300034062 | Freshwater | MRYYRCVVCGHILTEEDYAMLPDSVGCPECGVSKQDYELVEEE |
Ga0335010_0350428_699_812 | 3300034092 | Freshwater | VVCGHILTEEDYAMLPDSVGCPECGVSKQDYELVVEE |
Ga0335029_0000683_7343_7474 | 3300034102 | Freshwater | MSERVYVCVVCGHTLSEADYLSLPDSVNCPECGVSKEDYVLME |
⦗Top⦘ |