Metagenome Family F054126

Basic Information
Family ID	F054126
Family Type	Metagenome
Number of Sequences	140
Average Sequence Length	41 residues
Representative Sequence	MLSNNTLERTVNHRGRIVLAMDCVLADAQWRWWPAAQLGR
Number of Associated Samples	94
Number of Associated Scaffolds	136

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	62.86 %
% of genes near scaffold ends (potentially truncated)	49.29 %
% of genes from short scaffolds (< 2000 bps)	87.14 %
Associated GOLD sequencing projects	91
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Most Common Taxonomy
Group	Bacteria (66.429 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.143 % of family members)
Environment Ontology (ENVO)	Unclassified (33.571 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (52.143 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 136 Family Scaffolds
PF04365	BrnT_toxin	3.68
PF00583	Acetyltransf_1	2.21
PF03681	Obsolete Pfam Family	2.21
PF14384	BrnA_antitoxin	2.21
PF01381	HTH_3	2.21
PF04828	GFA	2.21
PF05973	Gp49	2.21
PF07927	HicA_toxin	2.21
PF11746	DUF3303	1.47
PF09720	Unstab_antitox	1.47
PF06689	zf-C4_ClpX	1.47
PF00106	adh_short	0.74
PF02604	PhdYeFM_antitox	0.74
PF06080	DUF938	0.74
PF00795	CN_hydrolase	0.74
PF05016	ParE_toxin	0.74
PF01042	Ribonuc_L-PSP	0.74
PF04926	PAP_RNA-bind	0.74
PF12796	Ank_2	0.74
PF02371	Transposase_20	0.74
PF00211	Guanylate_cyc	0.74
PF03992	ABM	0.74
PF14137	DUF4304	0.74
PF00144	Beta-lactamase	0.74
PF00186	DHFR_1	0.74
PF14317	YcxB	0.74
PF08984	DUF1858	0.74
PF13787	HXXEE	0.74
PF04909	Amidohydro_2	0.74
PF13673	Acetyltransf_10	0.74
PF14081	DUF4262	0.74
PF14534	DUF4440	0.74
PF13508	Acetyltransf_7	0.74
PF07475	Hpr_kinase_C	0.74
PF00753	Lactamase_B	0.74
PF03972	MmgE_PrpD	0.74
PF07883	Cupin_2	0.74
PF07214	DUF1418	0.74
PF10604	Polyketide_cyc2	0.74
PF01527	HTH_Tnp_1	0.74
PF04612	T2SSM	0.74
PF03073	TspO_MBR	0.74

COG ID	Name	Functional Category	% Frequency in 136 Family Scaffolds
COG2929	Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system	Defense mechanisms [V]	3.68
COG1724	Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family	General function prediction only [R]	2.21
COG3657	Putative component of the toxin-antitoxin plasmid stabilization module	Defense mechanisms [V]	2.21
COG3791	Uncharacterized conserved protein	Function unknown [S]	2.21
COG4679	Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system	Defense mechanisms [V]	2.21
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.74
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.74
COG1493	Serine kinase of the HPr protein, regulates carbohydrate metabolism	Signal transduction mechanisms [T]	0.74
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.74
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.74
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	0.74
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.74
COG2161	Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family	Defense mechanisms [V]	0.74
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.74
COG3149	Type II secretory pathway, component PulM	Intracellular trafficking, secretion, and vesicular transport [U]	0.74
COG3476	Tryptophan-rich sensory protein TspO/CrtK (mitochondrial benzodiazepine receptor homolog)	Signal transduction mechanisms [T]	0.74
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.74
COG4118	Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor	Defense mechanisms [V]	0.74
COG5186	Poly(A) polymerase Pap1	RNA processing and modification [A]	0.74

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	66.43 %
Unclassified	root	N/A	33.57 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	66.43 %
Unclassified	root	N/A	33.57 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	66.43 %
Unclassified	root	N/A	33.57 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	39.29 %
Unclassified	root	N/A	33.57 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.57 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	18.57 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	7.14 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.43 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.71 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.57 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	7.86 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3.57 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	2.86 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	2.14 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.43 %
Arenicellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales	0.71 %
Thiotrichales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales	0.71 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	0.71 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	0.71 %
Betaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis	0.71 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.57 %
Betaproteobacteria bacterium GR16-43	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	5.00 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2.86 %
Burkholderiales genera incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis	2.14 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	2.14 %
Usitatibacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae	1.43 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	1.43 %
unclassified Anaerolineae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae	0.71 %
Azonexaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae	0.71 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.71 %
Arenicellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae	0.71 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.71 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.71 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	0.71 %
Crenotrichaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Crenotrichaceae	0.71 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	0.71 %
Thiotrichaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae	0.71 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.57 %
Betaproteobacteria bacterium GR16-43	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	5.00 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2.86 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	2.14 %
Usitatibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter	1.43 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	1.43 %
Candidatus Accumulibacter vicinus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter vicinus	0.71 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.71 %
Arenicella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella	0.71 %
Paucibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Paucibacter	0.71 %
Rubrivivax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax	0.71 %
Ferribacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium	0.71 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	0.71 %
Crenothrix	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Crenotrichaceae → Crenothrix	0.71 %
Thiothrix	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thiothrix	0.71 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.71 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.71 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	0.71 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	0.71 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.57 %
Betaproteobacteria bacterium GR16-43	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	5.00 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2.86 %
Azospira restricta	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira restricta	1.43 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	1.43 %
Arenicella xantha	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha	0.71 %
Thiothrix lacustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thiothrix → Thiothrix lacustris	0.71 %
Crenothrix polyspora	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Crenotrichaceae → Crenothrix → Crenothrix polyspora	0.71 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.71 %
Usitatibacter palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris	0.71 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.71 %
Ferribacterium limneticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum	0.71 %
Methylibium petroleiphilum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → Methylibium petroleiphilum	0.71 %
Paucibacter toxinivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Paucibacter → Paucibacter toxinivorans	0.71 %
Azospira oryzae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira oryzae	0.71 %
Candidatus Accumulibacter vicinus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter vicinus	0.71 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.71 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.71 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.71 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	0.71 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	0.71 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.57 %
Betaproteobacteria bacterium GR16-43	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	5.00 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2.86 %
Azospira restricta	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira restricta	1.43 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	1.43 %
Methylibium petroleiphilum PM1	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → Methylibium petroleiphilum → Methylibium petroleiphilum PM1	0.71 %
Rubrivivax benzoatilyticus JA2 = ATCC BAA-35	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus → Rubrivivax benzoatilyticus JA2 = ATCC BAA-35	0.71 %
Arenicella xantha	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha	0.71 %
Thiothrix lacustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thiothrix → Thiothrix lacustris	0.71 %
Crenothrix polyspora	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Crenotrichaceae → Crenothrix → Crenothrix polyspora	0.71 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.71 %
Usitatibacter palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris	0.71 %
Ferribacterium limneticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum	0.71 %
Paucibacter toxinivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Paucibacter → Paucibacter toxinivorans	0.71 %
Azospira oryzae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira oryzae	0.71 %
Candidatus Accumulibacter vicinus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter vicinus	0.71 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.71 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.71 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.71 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	0.71 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	0.71 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.71 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2228664022\|INPgaii200_c1132111	Not Available	1306	Open in IMG/M
2228664022\|INPgaii200_c1133229	Not Available	900	Open in IMG/M
3300000953\|JGI11615J12901_11642710	All Organisms → cellular organisms → Bacteria	852	Open in IMG/M
3300000955\|JGI1027J12803_104563625	All Organisms → cellular organisms → Bacteria → Proteobacteria	704	Open in IMG/M
3300000955\|JGI1027J12803_107346799	Not Available	721	Open in IMG/M
3300000956\|JGI10216J12902_100363071	All Organisms → cellular organisms → Bacteria → Proteobacteria	933	Open in IMG/M
3300000956\|JGI10216J12902_102886982	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300000956\|JGI10216J12902_108110063	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1935	Open in IMG/M
3300000956\|JGI10216J12902_119051864	Not Available	1085	Open in IMG/M
3300002907\|JGI25613J43889_10177394	Not Available	564	Open in IMG/M
3300003321\|soilH1_10157289	All Organisms → cellular organisms → Bacteria → Proteobacteria	1733	Open in IMG/M
3300004114\|Ga0062593_101343593	Not Available	760	Open in IMG/M
3300004114\|Ga0062593_102025319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus → Rubrivivax benzoatilyticus JA2 = ATCC BAA-35	640	Open in IMG/M
3300004114\|Ga0062593_102234598	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter vicinus	614	Open in IMG/M
3300004463\|Ga0063356_100235908	All Organisms → cellular organisms → Bacteria → Proteobacteria	2200	Open in IMG/M
3300004463\|Ga0063356_103879322	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300004463\|Ga0063356_104309622	Not Available	612	Open in IMG/M
3300004480\|Ga0062592_100952844	Not Available	779	Open in IMG/M
3300004480\|Ga0062592_101636006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	624	Open in IMG/M
3300004480\|Ga0062592_102296506	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300005178\|Ga0066688_10307643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1023	Open in IMG/M
3300005184\|Ga0066671_10715509	Not Available	646	Open in IMG/M
3300005294\|Ga0065705_10857321	Not Available	590	Open in IMG/M
3300005295\|Ga0065707_11081661	Not Available	520	Open in IMG/M
3300005330\|Ga0070690_100334183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1095	Open in IMG/M
3300005340\|Ga0070689_100964451	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300005343\|Ga0070687_100377903	Not Available	922	Open in IMG/M
3300005343\|Ga0070687_101404097	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300005353\|Ga0070669_101949361	Not Available	513	Open in IMG/M
3300005367\|Ga0070667_101002284	All Organisms → cellular organisms → Bacteria	779	Open in IMG/M
3300005444\|Ga0070694_100386619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1092	Open in IMG/M
3300005444\|Ga0070694_101033716	Not Available	683	Open in IMG/M
3300005447\|Ga0066689_10614119	Not Available	685	Open in IMG/M
3300005456\|Ga0070678_101236592	Not Available	693	Open in IMG/M
3300005471\|Ga0070698_101604988	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Paucibacter → Paucibacter toxinivorans	602	Open in IMG/M
3300005471\|Ga0070698_101883730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	551	Open in IMG/M
3300005518\|Ga0070699_102027687	Not Available	526	Open in IMG/M
3300005536\|Ga0070697_100916642	All Organisms → cellular organisms → Bacteria	778	Open in IMG/M
3300005544\|Ga0070686_100109583	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1879	Open in IMG/M
3300005547\|Ga0070693_101540198	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300005549\|Ga0070704_100298708	Not Available	1341	Open in IMG/M
3300005549\|Ga0070704_100537456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira restricta	1020	Open in IMG/M
3300005549\|Ga0070704_100537456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira restricta	1020	Open in IMG/M
3300005549\|Ga0070704_100854758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thiothrix → Thiothrix lacustris	816	Open in IMG/M
3300005549\|Ga0070704_101614120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Arenicellales → Arenicellaceae → Arenicella → Arenicella xantha	598	Open in IMG/M
3300005549\|Ga0070704_101832895	All Organisms → cellular organisms → Bacteria → Proteobacteria	562	Open in IMG/M
3300005556\|Ga0066707_10639537	All Organisms → cellular organisms → Bacteria	674	Open in IMG/M
3300005561\|Ga0066699_11221732	All Organisms → cellular organisms → Bacteria	516	Open in IMG/M
3300005569\|Ga0066705_10551979	Not Available	714	Open in IMG/M
3300005577\|Ga0068857_101659280	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum	624	Open in IMG/M
3300005598\|Ga0066706_10657569	All Organisms → cellular organisms → Bacteria → Proteobacteria	832	Open in IMG/M
3300005617\|Ga0068859_102435866	Not Available	576	Open in IMG/M
3300005719\|Ga0068861_101338187	Not Available	698	Open in IMG/M
3300005719\|Ga0068861_102134855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → Methylibium petroleiphilum → Methylibium petroleiphilum PM1	560	Open in IMG/M
3300005833\|Ga0074472_11362333	Not Available	555	Open in IMG/M
3300005840\|Ga0068870_10457585	All Organisms → cellular organisms → Bacteria	842	Open in IMG/M
3300005985\|Ga0081539_10411741	Not Available	561	Open in IMG/M
3300005985\|Ga0081539_10411741	Not Available	561	Open in IMG/M
3300006057\|Ga0075026_100217150	Not Available	1013	Open in IMG/M
3300006102\|Ga0075015_100659345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	618	Open in IMG/M
3300006237\|Ga0097621_100063081	All Organisms → cellular organisms → Bacteria → Proteobacteria	3044	Open in IMG/M
3300006755\|Ga0079222_12283293	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	540	Open in IMG/M
3300006797\|Ga0066659_11002563	Not Available	698	Open in IMG/M
3300006854\|Ga0075425_100180746	All Organisms → cellular organisms → Bacteria → Proteobacteria	2422	Open in IMG/M
3300006854\|Ga0075425_100859949	Not Available	1038	Open in IMG/M
3300006854\|Ga0075425_101420924	All Organisms → cellular organisms → Bacteria	785	Open in IMG/M
3300006854\|Ga0075425_101924901	Not Available	662	Open in IMG/M
3300006854\|Ga0075425_102086984	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	633	Open in IMG/M
3300006854\|Ga0075425_102380251	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300006854\|Ga0075425_102581218	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	562	Open in IMG/M
3300006903\|Ga0075426_10133678	All Organisms → cellular organisms → Bacteria	1786	Open in IMG/M
3300006903\|Ga0075426_11557062	Not Available	503	Open in IMG/M
3300006904\|Ga0075424_100072160	All Organisms → cellular organisms → Bacteria → Proteobacteria	3616	Open in IMG/M
3300006904\|Ga0075424_100155264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2425	Open in IMG/M
3300006904\|Ga0075424_100165775	Not Available	2343	Open in IMG/M
3300006904\|Ga0075424_102706924	Not Available	518	Open in IMG/M
3300006904\|Ga0075424_102736513	Not Available	515	Open in IMG/M
3300006914\|Ga0075436_100612795	All Organisms → cellular organisms → Bacteria	802	Open in IMG/M
3300007004\|Ga0079218_10257306	All Organisms → cellular organisms → Bacteria	1383	Open in IMG/M
3300007004\|Ga0079218_11973641	Not Available	665	Open in IMG/M
3300007004\|Ga0079218_12342215	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300007255\|Ga0099791_10222677	All Organisms → cellular organisms → Bacteria	892	Open in IMG/M
3300009089\|Ga0099828_11595639	Not Available	575	Open in IMG/M
3300009090\|Ga0099827_11489695	All Organisms → cellular organisms → Bacteria → Proteobacteria	589	Open in IMG/M
3300009091\|Ga0102851_11934702	Not Available	667	Open in IMG/M
3300009551\|Ga0105238_12589632	All Organisms → cellular organisms → Bacteria → Proteobacteria	543	Open in IMG/M
3300009789\|Ga0126307_11596579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	530	Open in IMG/M
3300009823\|Ga0105078_1063093	Not Available	512	Open in IMG/M
3300009870\|Ga0131092_10882415	All Organisms → cellular organisms → Bacteria → Proteobacteria	736	Open in IMG/M
3300009873\|Ga0131077_10150485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3064	Open in IMG/M
3300010042\|Ga0126314_11255396	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Crenotrichaceae → Crenothrix → Crenothrix polyspora	554	Open in IMG/M
3300010044\|Ga0126310_11818116	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300010166\|Ga0126306_11617351	All Organisms → cellular organisms → Bacteria	540	Open in IMG/M
3300010397\|Ga0134124_10315597	All Organisms → cellular organisms → Bacteria → Proteobacteria	1461	Open in IMG/M
3300011270\|Ga0137391_11272554	Not Available	583	Open in IMG/M
3300011407\|Ga0137450_1105819	Not Available	550	Open in IMG/M
3300012189\|Ga0137388_11041610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	754	Open in IMG/M
3300012189\|Ga0137388_11239398	All Organisms → cellular organisms → Bacteria → Proteobacteria	684	Open in IMG/M
3300012189\|Ga0137388_11663558	Not Available	573	Open in IMG/M
3300012206\|Ga0137380_10636891	All Organisms → cellular organisms → Bacteria	930	Open in IMG/M
3300012931\|Ga0153915_11821574	All Organisms → cellular organisms → Bacteria	712	Open in IMG/M
3300012956\|Ga0154020_11088810	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira oryzae	610	Open in IMG/M
3300012977\|Ga0134087_10364589	All Organisms → cellular organisms → Bacteria	694	Open in IMG/M
3300013297\|Ga0157378_10058717	All Organisms → cellular organisms → Bacteria → Proteobacteria	3431	Open in IMG/M
3300013297\|Ga0157378_10883463	All Organisms → cellular organisms → Bacteria	924	Open in IMG/M
3300014166\|Ga0134079_10447449	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	612	Open in IMG/M
3300014745\|Ga0157377_10782876	All Organisms → cellular organisms → Bacteria	701	Open in IMG/M
3300015245\|Ga0137409_10480998	All Organisms → cellular organisms → Bacteria	1064	Open in IMG/M
3300015371\|Ga0132258_10127994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	6050	Open in IMG/M
3300015372\|Ga0132256_100107308	All Organisms → cellular organisms → Bacteria → Proteobacteria	2731	Open in IMG/M
3300015372\|Ga0132256_103555121	Not Available	524	Open in IMG/M
3300015373\|Ga0132257_100325056	All Organisms → cellular organisms → Bacteria	1853	Open in IMG/M
3300018476\|Ga0190274_10215184	All Organisms → cellular organisms → Bacteria → Proteobacteria	1706	Open in IMG/M
3300025925\|Ga0207650_11705808	Not Available	534	Open in IMG/M
3300025926\|Ga0207659_10349756	All Organisms → cellular organisms → Bacteria	1226	Open in IMG/M
3300025927\|Ga0207687_11886646	Not Available	511	Open in IMG/M
3300025960\|Ga0207651_11651452	Not Available	577	Open in IMG/M
3300025961\|Ga0207712_10036373	All Organisms → cellular organisms → Bacteria	3353	Open in IMG/M
3300026041\|Ga0207639_10880708	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	836	Open in IMG/M
3300026320\|Ga0209131_1018394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	4225	Open in IMG/M
3300026320\|Ga0209131_1018394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	4225	Open in IMG/M
3300026320\|Ga0209131_1018394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	4225	Open in IMG/M
3300026320\|Ga0209131_1019489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	4092	Open in IMG/M
3300026320\|Ga0209131_1381685	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300026320\|Ga0209131_1421248	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	501	Open in IMG/M
3300026350\|Ga0256823_1005991	Not Available	943	Open in IMG/M
3300027886\|Ga0209486_10137480	All Organisms → cellular organisms → Bacteria	1334	Open in IMG/M
3300027886\|Ga0209486_10382974	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	849	Open in IMG/M
3300031548\|Ga0307408_101330175	All Organisms → cellular organisms → Bacteria	674	Open in IMG/M
3300031716\|Ga0310813_10796898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	850	Open in IMG/M
3300031731\|Ga0307405_10584712	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	909	Open in IMG/M
3300032074\|Ga0308173_11631919	Not Available	607	Open in IMG/M
3300032157\|Ga0315912_10543628	All Organisms → cellular organisms → Bacteria	924	Open in IMG/M
3300032397\|Ga0315287_10048823	All Organisms → cellular organisms → Bacteria → Proteobacteria	4648	Open in IMG/M
3300032782\|Ga0335082_10948254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	724	Open in IMG/M
3300032955\|Ga0335076_10157694	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris	2183	Open in IMG/M
3300033419\|Ga0316601_100724085	Not Available	978	Open in IMG/M
3300033486\|Ga0316624_10055523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43	2559	Open in IMG/M
3300033486\|Ga0316624_10501790	All Organisms → cellular organisms → Bacteria	1038	Open in IMG/M
3300033486\|Ga0316624_11566481	Not Available	607	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	65.71%
Host-Associated	Host-Associated	32.14%
Engineered	Engineered	2.14%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	60.00%
Plants	Host-Associated → Plants	32.14%
Aquatic	Environmental → Aquatic	5.71%
Wastewater	Engineered → Wastewater	2.14%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	60.00%
Rhizosphere	Host-Associated → Plants → Rhizosphere	21.43%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.00%
Freshwater	Environmental → Aquatic → Freshwater	2.86%
Sediment	Environmental → Aquatic → Sediment	2.86%
Activated Sludge	Engineered → Wastewater → Activated Sludge	2.14%
Roots	Host-Associated → Plants → Roots	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	42.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	16.43%
Loam	Environmental → Terrestrial → Soil → Loam	12.86%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.86%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.00%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.29%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.86%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.14%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	2.14%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.43%
Lake	Environmental → Aquatic → Freshwater → Lake	0.71%
Sand	Environmental → Terrestrial → Soil → Sand	0.71%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.71%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.71%

Habitat	Taxonomy	Distribution
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	17.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	16.43%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	15.00%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	12.86%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	9.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.86%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.00%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.29%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.86%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	2.14%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.43%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.43%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.71%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.71%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.71%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.71%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.71%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.71%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	12.14%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	10.71%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	9.29%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	6.43%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	5.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	4.29%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	4.29%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.29%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.57%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.14%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.14%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	2.14%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.14%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.43%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.43%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	1.43%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.43%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.43%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.43%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.43%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.43%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.71%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.71%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.71%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.71%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.71%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.71%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.71%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.71%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.71%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.71%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	0.71%
Active Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge	0.71%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.71%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2228664022	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300002907	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm	Environmental	Open in IMG/M
3300003321	Sugarcane bulk soil Sample H1	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005447	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006102	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009823	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50	Environmental	Open in IMG/M
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered	Open in IMG/M
3300009873	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant	Engineered	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300011407	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT454_2	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012956	Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG	Engineered	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300026350	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU6	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032955	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F054126

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPgaii200_11321114	2228664022	Soil	MRSNNTLERTGGHRGRFVLAMDCVLAEAEWRQWLAAQLGR
INPgaii200_11332291	2228664022	Soil	MVMPNNALEQTVNYRGRIVLAMDCVLADAQWRWWPAA
JGI11615J12901_116427103	3300000953	Soil	MPNNTLERTDGHRGRFALAIDCVLAEAETRRWLAAQLGR*
JGI1027J12803_1045636252	3300000955	Soil	MPNNSLERTGVQSGRIVLAKDCVLADAQWRSWSAAQLGR*
JGI1027J12803_1073467991	3300000955	Soil	MRPNNTLERTVIHHGRLVLAMDCVLGKAQWRLWSAAQLGR*
JGI10216J12902_1003630713	3300000956	Soil	VRPNNALEQTMSLRGRIVLALDCVLAEAQWRWWPAAQ
JGI10216J12902_1028869822	3300000956	Soil	MPSNNALELTVTYRGRLVLAMDCGLGKAQQRRCSAAQLGR*
JGI10216J12902_1081100633	3300000956	Soil	MRPNNALERTVIHRGRIVLAMDCGLADAQWRSWSAAQLIR*
JGI10216J12902_1190518642	3300000956	Soil	MTANNALDRTVVHRGRAVLATDCVLASAELASWPAGHQDR*
JGI25613J43889_101773941	3300002907	Grasslands Soil	MGNETSNNXLERTVNYXGRIVLAMDRVLADAQWRRWPAAQLGR*
soilH1_101572891	3300003321	Sugarcane Root And Bulk Soil	MKKLPNNKLERAVNHRGRFDLAMDYVLGESQWRHWPAAQLGR*
Ga0062593_1013435932	3300004114	Soil	MKPNNTLERAVIHSGRFVLAMDCALAEAEPRQWPAAQLGR*
Ga0062593_1020253191	3300004114	Soil	MVRISARGEAMTANNTLERTGGHRGRFVLAIDCVLAEAQGRWWWAAQLGR*
Ga0062593_1022345982	3300004114	Soil	VVKVTPNNTLERTHGHRGRFVLAINGVLAEAETRRWSAAQLGR
Ga0063356_1002359082	3300004463	Arabidopsis Thaliana Rhizosphere	MQPNNTLERTVSYRQRIVLAMDCVLADAQMRRWPVAQLGR*
Ga0063356_1038793221	3300004463	Arabidopsis Thaliana Rhizosphere	HMRKLPNNTLERTVNRRGRIVLATDCVLAEAQWRRWRAAQLGR*
Ga0063356_1043096222	3300004463	Arabidopsis Thaliana Rhizosphere	MPNNTLERTGGHRGRFVLAIDCVLAEAQGRWWWAAQLGR*
Ga0062592_1009528441	3300004480	Soil	IMQANNTLERSVMHRGRFVLAMNCVLAEAEACRWWAAQLGR*
Ga0062592_1016360061	3300004480	Soil	VNDEMPNNTLELTAADHGRPVLAMDCVLGRAQWRLGPAAQLGR
Ga0062592_1022965062	3300004480	Soil	MRANNTLERTVVHRGRLVLAMDCVLADAQGRLWPAAQLGR*
Ga0066688_103076432	3300005178	Soil	MTSNNTFERTVNRRGRIVLAMDCVLADAQLRWWPAAQLSR*
Ga0066671_107155091	3300005184	Soil	MLANNALERTVMHRGRTVLAMDCALAGAEAASWSAAQLGR*
Ga0065705_108573212	3300005294	Switchgrass Rhizosphere	MTPNNTLERTVRHGGRFVLAIDCVLAEAEWQRWRAAQLGR*
Ga0065707_110816612	3300005295	Switchgrass Rhizosphere	MPSNNTLERTVDDRGRIVLAMDCVLADAQLRLWPTAQLGR*
Ga0070690_1003341833	3300005330	Switchgrass Rhizosphere	LSNNALERTVNQCGRIVLAMDGALADTQWRWLRAAQLGR*
Ga0070689_1009644512	3300005340	Switchgrass Rhizosphere	MGLPSNNTLERTGIHRGRFVLAMDCVLAEAESRRRLAAQLGR*
Ga0070687_1003779032	3300005343	Switchgrass Rhizosphere	MPPNNALERTVNYRGRIVLAMDCVLADPQWRWRSAAQLGR*
Ga0070687_1014040972	3300005343	Switchgrass Rhizosphere	MTSNNTLERTVDHSGRIVLAVDCVLADAQCRSWPAPQLGR*
Ga0070669_1019493612	3300005353	Switchgrass Rhizosphere	MRPNNTLERTVGNHGRFVLAMNCVLAEAEWQRWRAAQLGR*
Ga0070667_1010022842	3300005367	Switchgrass Rhizosphere	MTSNNTLERTVDHSGRIVLAVDCVLADAQCRSWPAAQLGR*
Ga0070694_1003866193	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MVSADDVASMMANNAFERTVVHGGRAVLAMDCVLGGAQWRHVAAAQLSR*
Ga0070694_1010337162	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	YRRSWLALKVTMRSNNTFERTVVHRGRLVLAMDCALGKAQQRRWPAAQLGR*
Ga0066689_106141192	3300005447	Soil	AGRGMARLANNTLEQTVESRGRIVLAIDCVLADAQWRSWPAAQLGR*
Ga0070678_1012365922	3300005456	Miscanthus Rhizosphere	FRGGRMRKLPNNKLEQSVNQGGRIVLAMDCAGDAQWGPWLAAQQDR*
Ga0070698_1016049881	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MLRMWKQTHNNTLERTMIDRGRLVLAIDRALGKAQQRLWPAAQLGR*
Ga0070698_1018837303	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MPNNTLERTVNHHGRIVLAMDCVLADTQFERWPAAQLGR*
Ga0070699_1020276871	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MLPSNNALERIVSHRGRIVLAMDSVLADAQWQHWPAAQLGR*
Ga0070697_1009166421	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MSNNTLEQIEDRRGRIVLAMDCVLAGAQRRSRPAAQLDR*
Ga0070686_1001095836	3300005544	Switchgrass Rhizosphere	MALSDNTFERTVMHGGRAVLAMDCVLGGAQWRSWPAAQLSR*
Ga0070693_1015401983	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MSESSANNTLERAVIHRGRAVLAMDCVLGGAQWRSWPAAQL
Ga0070704_1002987084	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	YMSGMRSNNTLERTAKHRGRLVLAINCVLADAQMRRWSAAQLDR*
Ga0070704_1005374562	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MTSNNTLERTVNQRGRFVLAMDCVLADAQWRSWPAAQLGR*
Ga0070704_1005374564	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	VTPNNTLERTVNYRGRIVLAMDCVLADAQWRRWPAAQLGR*
Ga0070704_1008547583	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MPRSNNTLEQTVNHRGRIVLAMDCVLADAQMRSWSAAQLGCWMSFAVGD*
Ga0070704_1016141202	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	LLTWLLSNNTLERTVKYRGRFVLAMDCVLAEAESQRWRAAQLGR*
Ga0070704_1018328952	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MLSNNALERTVNQCGRIVLAMDGALADTQWRWLRAAQLGR*
Ga0066707_106395371	3300005556	Soil	MPNNALERTVEKWGRTVLAMDCVLAGAQWRRWPAAQLGR*
Ga0066699_112217323	3300005561	Soil	NNAFERTVIHRGRAVLAMDCVLGGAQWRSWPAAQLSR*
Ga0066705_105519792	3300005569	Soil	MTANNTFERTVVHPGRAVLAIDCVLGGAQQERWSAAQLGR*
Ga0068857_1016592801	3300005577	Corn Rhizosphere	MKRAAQKELRSNNTLERTGHRSGRFVLALNCVLAEAEWLWSAAQLGR*
Ga0066706_106575693	3300005598	Soil	MRKLPNNALERTVINRGRTVLAMDCVLAGAQWRSWPAAQ
Ga0068859_1024358662	3300005617	Switchgrass Rhizosphere	MLPNNTLERTVNHRGRPVLAMNCVLARAQWCLWRAVQRNR*
Ga0068861_1013381874	3300005719	Switchgrass Rhizosphere	RSNNALERTVIHRGRTVLAMNCVLGGTQQQSWPAAQLSR*
Ga0068861_1021348552	3300005719	Switchgrass Rhizosphere	VKHTPSNNTLERTVNYRGRIVLAMDFVLADAQQRSWPAAQLGR*
Ga0074472_113623332	3300005833	Sediment (Intertidal)	MMPNNAFERTVKHRGRIVLAMDCVLADAQRQRWPAAQLGR*
Ga0068870_104575853	3300005840	Miscanthus Rhizosphere	TANNTLERTANEGERILIAMDRVLVDAQWRRWSAAKLGR*
Ga0081539_104117411	3300005985	Tabebuia Heterophylla Rhizosphere	MRSNNTFERTEVHRERPVLAMDCVLARAQQRQWSAAQLSR*
Ga0081539_104117413	3300005985	Tabebuia Heterophylla Rhizosphere	TLEAVTANNAFERTVVYRGRAVLAMDGVLGGAHWRSWSAAQLSR*
Ga0075026_1002171502	3300006057	Watersheds	VRSNNTLERTVKHRGRIVLAMDCVLADAQWQWWPAAQLGR*
Ga0075015_1006593452	3300006102	Watersheds	SNNAFELTVTQRGCTVLAMDCVLAGAERLRWPAAQLGR*
Ga0097621_1000630814	3300006237	Miscanthus Rhizosphere	MTESLANKSLESTVNCRGRIVLAINCVLADAQWRAWPAAQRNR*
Ga0079222_122832931	3300006755	Agricultural Soil	VNDEMPNNTLEQTVNPRGRFVLAMDCVLAEAQSQRWSAAQLGR*
Ga0066659_110025633	3300006797	Soil	EVKTMTPNNTLERTVRHRGRAVLAMNCVLGGAQWRSWPAAQLGR*
Ga0075425_1001807462	3300006854	Populus Rhizosphere	MLSNNAFERTVIHCGRAVLAMDCVLRGVQWRSWSAAQLGR*
Ga0075425_1008599491	3300006854	Populus Rhizosphere	MQSNNALERTVMHRGRAVLAMDCVLGGAQWRRWPAAQL
Ga0075425_1014209242	3300006854	Populus Rhizosphere	MRSNNTLERTVVDRGRAVLATDCVLGGAQWQRWPAAQLGR*
Ga0075425_1019249011	3300006854	Populus Rhizosphere	TMTPNNTLERTVSHRGRIMLAMDCVLAGAQWRSAAQLDR*
Ga0075425_1020869843	3300006854	Populus Rhizosphere	MRKLPNNTFERTVIHGGRAVLAMDCVLGGAQWRQWSAAQLGR*
Ga0075425_1023802512	3300006854	Populus Rhizosphere	MPNNTFERTVNHRGRAVLAMDFVLGGAQWRSWSAAQLGR*
Ga0075425_1025812181	3300006854	Populus Rhizosphere	MRSNNTLERTVNDRGRAVLAMDCVLGGAQWRRWPAAQL
Ga0075426_101336784	3300006903	Populus Rhizosphere	FERTVIHRGRAVLALNCVLGGAQWRSTPAAQLGR*
Ga0075426_115570622	3300006903	Populus Rhizosphere	VLSNNTLERTVVHPGRAVLAMDCMLGGAQWRRWSAAQLGR
Ga0075424_1000721605	3300006904	Populus Rhizosphere	MPNNTFERTVIHRGRAVLAMNCVLGGAQWRSWPAAQLSR*
Ga0075424_1001552644	3300006904	Populus Rhizosphere	MNALRSNNAFERTEVQRGRAVLAMDCVLGGAQWRSWSAAQLGR*
Ga0075424_1001657751	3300006904	Populus Rhizosphere	VQANNAFERKVIHRAVLAMDCVLGGAQSRSWPAAQ
Ga0075424_1027069241	3300006904	Populus Rhizosphere	MAVGLVRAWVMSNNTLERTGVHGGRAVLAMNCVLGGAQWRSWPAAQL
Ga0075424_1027365131	3300006904	Populus Rhizosphere	VKSNNAFERTVIHRWRAVLAMDCVLGGAQWRRRSAAQL
Ga0075436_1006127952	3300006914	Populus Rhizosphere	MLSNNAFERTVIHCGRAVLAMDCVLRGVQWRSWSAAQLGL*
Ga0079218_102573061	3300007004	Agricultural Soil	VRSNHTLERTVIHRGRIVLAMDCVLADAQWRQQPAAEL
Ga0079218_119736413	3300007004	Agricultural Soil	GLPSNNALDHTVSHRGRTVLAMDRALAGAQRPSWPAGQLDR*
Ga0079218_123422152	3300007004	Agricultural Soil	MLSNNTLERTVNHRGRIVLAMDCVLADAQWRWWPAAQLGR*
Ga0099791_102226771	3300007255	Vadose Zone Soil	RNGSEANNRLERTVNGCGRNALATDCVLADAQWRSWPAAQLGR*
Ga0099828_115956391	3300009089	Vadose Zone Soil	MTSWTSNNTFERTVIHRGRVVLAMDCVLGGAQWRWWSAAQL
Ga0099827_114896952	3300009090	Vadose Zone Soil	VTPNNAFERTVGYGGRTVLAMDCVLAGAELILLPAAQLDR*
Ga0102851_119347021	3300009091	Freshwater Wetlands	IRDGQAMTSNNALERTLRRRGRIVLAMDCEFADAQWRRWPAAQLGR*
Ga0105238_125896322	3300009551	Corn Rhizosphere	MIECMANYALERTVNYRGRIVLAMDCVLADAQGRRWPAAQLVR*
Ga0126307_115965791	3300009789	Serpentine Soil	MSNKSLERTVRQRGRIVLAMDCVLADAQWRSWPAAQLG
Ga0105078_10630931	3300009823	Groundwater Sand	MSNKSLERTVNHRGRAVLAMNCVLAGLQMRSWPAV
Ga0131092_108824152	3300009870	Activated Sludge	LLSNNTFERTVIHRGRAVLTMDCVLGGEQWRHRAAAQLGR*
Ga0131077_101504855	3300009873	Wastewater	MGRLSNNTLERTVIHRGRFVLAKDCVLGEAQWRRWPAAQLGR*
Ga0126314_112553962	3300010042	Serpentine Soil	MPNITLELTVNVRGRIVLAMDCVLADAQWRPWPAAQLGR*
Ga0126310_118181162	3300010044	Serpentine Soil	ALAGGLKYRGRIVLAMECVLADAQLRRWPAPQLGR*
Ga0126306_116173512	3300010166	Serpentine Soil	MPANNTLERIVKHWGRFVLAMDCVLADAQWRLWPAAQLGR*
Ga0134124_103155971	3300010397	Terrestrial Soil	MPNNTFERTVIHRGRAVLAMNCVLGGAQWRSWPAAQL
Ga0137391_112725541	3300011270	Vadose Zone Soil	VGMMPNNTLERTVNHGGRIVLAMDCALADAQWRLWPAAQLGR*
Ga0137450_11058191	3300011407	Soil	NALERTVNHRGRTVLAMDCALAGAQRRSWPAAQFNR*
Ga0137388_110416102	3300012189	Vadose Zone Soil	MTANNTLERTEDHRGRTVLAIDCVLAGAEAASWPAAQLGR*
Ga0137388_112393982	3300012189	Vadose Zone Soil	MMPNNTLEQIVKCGARIVLAMDFVLADAQWRQWPAAQLGR*
Ga0137388_116635582	3300012189	Vadose Zone Soil	MTSNNTFERTVANGGRTVLAMDCVLAGAQWRRSPAA
Ga0137380_106368911	3300012206	Vadose Zone Soil	MMANNTLERTVEHRGRIVLAMNCVLADAKGRAWPAAQLGR*
Ga0153915_118215742	3300012931	Freshwater Wetlands	MSLLSNNTFERTVGHRGRIVLAMDCVLADAQWRQWPAAQLGR*
Ga0154020_110888101	3300012956	Active Sludge	NTMERTESHRGRIVLAMDCVLADAHSRWWPAAQLGRWGSP*
Ga0134087_103645892	3300012977	Grasslands Soil	MIYSNEMPNNTFEWTVANGGRAALAMDWVLAGVQWRWPAAQ
Ga0157378_100587174	3300013297	Miscanthus Rhizosphere	MTANNALEGTVNHRGRVVLAMACVLADAQWRLWPAAQLGR*
Ga0157378_108834632	3300013297	Miscanthus Rhizosphere	MIKPSNNTLERTVNHRERIVLAMDCVLADVQWRWWPAAQLGR*
Ga0134079_104474491	3300014166	Grasslands Soil	MPSNNALERTVNHRGRIVLAIDCVLADAQARCWPAAQLG
Ga0157377_107828761	3300014745	Miscanthus Rhizosphere	PSNNTLELTVTYRGRIVLAMNCVLADAQWRSWSAAQLGR*
Ga0137409_104809983	3300015245	Vadose Zone Soil	MTANNTLERTVENCGRIVLAMDCVLADAQWRWWPAAQLGR*
Ga0132258_101279942	3300015371	Arabidopsis Rhizosphere	MRSNNALKRPCDHRGCAVLAMDCVLGGAEWRRGTPLN*
Ga0132256_1001073082	3300015372	Arabidopsis Rhizosphere	VWYRRSNKNALERTGKHHGRFVLAMDCVLAEAEWWPWPAAQLSR*
Ga0132256_1035551212	3300015372	Arabidopsis Rhizosphere	MTSNNTFERTVMHRGRAVLAMECVLGGAQWRSWPAAQL
Ga0132257_1003250561	3300015373	Arabidopsis Rhizosphere	VCGVLFFAWEMALSDNTFERTVMHGGRAVLAMDCVLGGAQWRSWPAAQLSR*
Ga0190274_102151842	3300018476	Soil	MSHSASWDRELSNNTLERTMKPRARIVLAMDCVLADAQWQLWPTVQLGR
Ga0207650_117058082	3300025925	Switchgrass Rhizosphere	MRVQMTANNTLERTANEGERILIAMDRVLVDAQWRWWSAAKLGR
Ga0207659_103497563	3300025926	Miscanthus Rhizosphere	NNTLERTANEGERILIAMDRVLVDAQWRWWSAAKLGR
Ga0207687_118866462	3300025927	Miscanthus Rhizosphere	MQSNNALERTVMHRGRAVLAMDCVLGGAQWRRWPAAQ
Ga0207651_116514521	3300025960	Switchgrass Rhizosphere	ANNTLERTVVHRGRLVLAMDCVLADAQGRLWPAAQLGR
Ga0207712_100363734	3300025961	Switchgrass Rhizosphere	MLSNNALERTVNQCGRIVLAMDGALADTQWRWLRAAQLGR
Ga0207639_108807081	3300026041	Corn Rhizosphere	WTEQNMLSNNALERTVNQCGRIVLAMDGALADTQWRWLRAAQLGR
Ga0209131_101839411	3300026320	Grasslands Soil	VPSNNALERTVSHRGRIVLAMNCVLADTQWRWWPAAQLGR
Ga0209131_10183945	3300026320	Grasslands Soil	MRSNNTLERTVNHRGRIVLAMDCVLADAQWRWWPAAQLGR
Ga0209131_10183949	3300026320	Grasslands Soil	MSLERTVKYRGRPVLAMDCMLADAQWRSWPAAQLGR
Ga0209131_10194892	3300026320	Grasslands Soil	MTSNNALERTVNHCGRIVLAMECVLADAQWRLWPAAQRGR
Ga0209131_13816851	3300026320	Grasslands Soil	MRSNNTLERTVKYPGRIVLAMDCVLADARWRSRPAAQLGR
Ga0209131_14212481	3300026320	Grasslands Soil	MPNKTLEQTVNHRGCIVLAMDCVLADAQWQLWPAAQL
Ga0256823_10059913	3300026350	Sediment	VASMMANNTFERTVMHRGRAVLAMNCVLGGAQWRRWSAAQLG
Ga0209486_101374804	3300027886	Agricultural Soil	VRSNHTLERTVIHRGRIVLAMDCVLADAQWRQQPAAE
Ga0209486_103829741	3300027886	Agricultural Soil	MPNNTLERTVNHRRRIVLAMDCVLADAQWRWRPAAQLGRWAHGQ
Ga0307408_1013301752	3300031548	Rhizosphere	MTANNTLELTVNHRGRIVLAMDCVLADTQWRRRSAAQ
Ga0310813_107968983	3300031716	Soil	VRSNNTLERTVSHRGRIVLAMDCVLAGAQWRLWPAAQLGR
Ga0307405_105847123	3300031731	Rhizosphere	TLELTVNYRGRIVLVMDCVLADAQRQQWPAAQLAR
Ga0308173_116319192	3300032074	Soil	MTPNNTLELTVNHRGRIALAMDCVLADAQWRSWPAAQLGR
Ga0315912_105436284	3300032157	Soil	SQVAIRMPNNTLERSVTQCGRLVLAMDCVLGQAQWRLWPAAQLGR
Ga0315287_100488235	3300032397	Sediment	MWCEVRPNNALELTVDQGGRIVLAMDCVLADAQQRWWPAAQLGR
Ga0335082_109482541	3300032782	Soil	NNAFELTVMQRGRTVLAMDCVLAGAEWASWSAAQLGR
Ga0335076_101576946	3300032955	Soil	VTSNNALERPSNHRGHAVLAMNCVLGGADWALWPAAQLGR
Ga0316601_1007240851	3300033419	Soil	LVPNNTLERTVKLRGRIVLAIDCVLADSQAKWWPAAQLNR
Ga0316624_100555232	3300033486	Soil	MPNNMLERTVAHCGRTVLALDCVLAGAQSRSWAAE
Ga0316624_105017903	3300033486	Soil	SEEQVVTSNNALERTVNHRGRTVLAMDCVLAGAETAPCPAAQLGR
Ga0316624_115664811	3300033486	Soil	MAANNTFERTVIHRGRAVLALNRVLDGVHWRSCPAAQLGRYAS

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign