Metagenome / Metatranscriptome Family F054255

Basic Information
Family ID	F054255
Family Type	Metagenome / Metatranscriptome
Number of Sequences	140
Average Sequence Length	39 residues
Representative Sequence	VKNVLLVNALLTILFLSDTYGGRVHDLRIAEATPYPLPA
Number of Associated Samples	120
Number of Associated Scaffolds	140

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	10.79 %
% of genes near scaffold ends (potentially truncated)	94.29 %
% of genes from short scaffolds (< 2000 bps)	95.71 %
Associated GOLD sequencing projects	116
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Most Common Taxonomy
Group	Bacteria (96.429 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.571 % of family members)
Environment Ontology (ENVO)	Unclassified (26.429 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (41.429 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 140 Family Scaffolds
PF13613	HTH_Tnp_4	55.71
PF01609	DDE_Tnp_1	4.29
PF13359	DDE_Tnp_4	4.29
PF14104	DUF4277	2.14
PF00239	Resolvase	1.43
PF12759	HTH_Tnp_IS1	1.43
PF07592	DDE_Tnp_ISAZ013	1.43
PF13586	DDE_Tnp_1_2	0.71
PF13267	DUF4058	0.71
PF03050	DDE_Tnp_IS66	0.71
PF00496	SBP_bac_5	0.71
PF05168	HEPN	0.71
PF00296	Bac_luciferase	0.71
PF00534	Glycos_transf_1	0.71

COG ID	Name	Functional Category	% Frequency in 140 Family Scaffolds
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	4.29
COG3293	Transposase	Mobilome: prophages, transposons [X]	4.29
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	4.29
COG5421	Transposase	Mobilome: prophages, transposons [X]	4.29
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	4.29
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	4.29
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	1.43
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	1.43
COG1895	HEPN domain protein, predicted toxin of MNT-HEPN system	Defense mechanisms [V]	0.71
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.71
COG2250	HEPN domain protein, predicted toxin of MNT-HEPN system	Defense mechanisms [V]	0.71
COG3436	Transposase	Mobilome: prophages, transposons [X]	0.71

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	96.43 %
Unclassified	root	N/A	3.57 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	96.43 %
Unclassified	root	N/A	3.57 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	96.43 %
Unclassified	root	N/A	3.57 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	60.00 %
Unclassified	root	N/A	3.57 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	2.86 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.43 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.43 %

Name	Rank	Taxonomy	Distribution
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	57.14 %
Unclassified	root	N/A	3.57 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2.86 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	2.14 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.43 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.71 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.71 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	57.14 %
Unclassified	root	N/A	3.57 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	2.14 %
Candidatus Acidoferrales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales	2.14 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.43 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.71 %
Ktedonobacteria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
unclassified Cyanobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria	55.00 %
Unclassified	root	N/A	3.57 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2.14 %
Candidatus Acidoferrum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum	2.14 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	2.14 %
Bacteroidia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	0.71 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	0.71 %
Ktedonobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	55.00 %
Unclassified	root	N/A	3.57 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.14 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2.14 %
Scytonemataceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Scytonemataceae	1.43 %
Ktedonobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae	0.71 %
Bacteroidales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	0.71 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	55.00 %
Unclassified	root	N/A	3.57 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.14 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2.14 %
Scytonema	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Scytonemataceae → Scytonema	1.43 %
Desulfobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter	0.71 %
Ktedonobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter	0.71 %
Bacteroidales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	55.00 %
Unclassified	root	N/A	3.57 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.14 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2.14 %
Scytonema tolypothrichoides	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Scytonemataceae → Scytonema → Scytonema tolypothrichoides	1.43 %
Desulfobacter postgatei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter → Desulfobacter postgatei	0.71 %
Ktedonobacter racemifer	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer	0.71 %
Bacteroidales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.71 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001686\|C688J18823_10626890	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	686	Open in IMG/M
3300005332\|Ga0066388_100480962	All Organisms → cellular organisms → Bacteria	1880	Open in IMG/M
3300005445\|Ga0070708_101962768	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300005467\|Ga0070706_100180029	All Organisms → cellular organisms → Bacteria	1973	Open in IMG/M
3300005471\|Ga0070698_100401734	All Organisms → cellular organisms → Bacteria	1303	Open in IMG/M
3300005518\|Ga0070699_101836017	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300005552\|Ga0066701_10914865	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300005555\|Ga0066692_10071334	All Organisms → cellular organisms → Bacteria	1993	Open in IMG/M
3300005568\|Ga0066703_10442089	All Organisms → cellular organisms → Bacteria	780	Open in IMG/M
3300005598\|Ga0066706_11189350	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300005617\|Ga0068859_101253248	All Organisms → cellular organisms → Bacteria	817	Open in IMG/M
3300005719\|Ga0068861_101330363	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300005764\|Ga0066903_105950335	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300005764\|Ga0066903_108689959	All Organisms → cellular organisms → Bacteria	516	Open in IMG/M
3300005981\|Ga0081538_10197292	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	833	Open in IMG/M
3300006049\|Ga0075417_10753261	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300006173\|Ga0070716_101621938	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300006794\|Ga0066658_10190424	All Organisms → cellular organisms → Bacteria	1078	Open in IMG/M
3300006806\|Ga0079220_10633780	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	768	Open in IMG/M
3300006846\|Ga0075430_100781910	All Organisms → cellular organisms → Bacteria	787	Open in IMG/M
3300006880\|Ga0075429_100263957	All Organisms → cellular organisms → Bacteria	1508	Open in IMG/M
3300006969\|Ga0075419_11524933	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300007076\|Ga0075435_101469706	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300007258\|Ga0099793_10130111	All Organisms → cellular organisms → Bacteria	1183	Open in IMG/M
3300007258\|Ga0099793_10324301	All Organisms → cellular organisms → Bacteria	750	Open in IMG/M
3300007265\|Ga0099794_10484524	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	650	Open in IMG/M
3300009038\|Ga0099829_11594845	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	538	Open in IMG/M
3300009081\|Ga0105098_10404499	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	678	Open in IMG/M
3300009089\|Ga0099828_11746941	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	547	Open in IMG/M
3300009090\|Ga0099827_10346245	All Organisms → cellular organisms → Bacteria	1264	Open in IMG/M
3300009090\|Ga0099827_11102689	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	689	Open in IMG/M
3300009094\|Ga0111539_11808096	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	708	Open in IMG/M
3300009098\|Ga0105245_11150306	All Organisms → cellular organisms → Bacteria	823	Open in IMG/M
3300009100\|Ga0075418_10298980	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	1716	Open in IMG/M
3300009137\|Ga0066709_101505069	All Organisms → cellular organisms → Bacteria	971	Open in IMG/M
3300009137\|Ga0066709_102570158	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	683	Open in IMG/M
3300009147\|Ga0114129_10080892	All Organisms → cellular organisms → Bacteria	4516	Open in IMG/M
3300009147\|Ga0114129_10239082	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2442	Open in IMG/M
3300009553\|Ga0105249_10172455	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	2099	Open in IMG/M
3300009792\|Ga0126374_10946785	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	671	Open in IMG/M
3300009792\|Ga0126374_11592690	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300009793\|Ga0105077_124409	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	531	Open in IMG/M
3300009802\|Ga0105073_1058442	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300009815\|Ga0105070_1009198	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer	1612	Open in IMG/M
3300009815\|Ga0105070_1068552	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	673	Open in IMG/M
3300009818\|Ga0105072_1059384	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	735	Open in IMG/M
3300010041\|Ga0126312_10743623	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	709	Open in IMG/M
3300010043\|Ga0126380_12111754	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	518	Open in IMG/M
3300010047\|Ga0126382_11046032	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	719	Open in IMG/M
3300010047\|Ga0126382_11336127	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	650	Open in IMG/M
3300010047\|Ga0126382_12236128	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	527	Open in IMG/M
3300010322\|Ga0134084_10233037	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	658	Open in IMG/M
3300010359\|Ga0126376_11727338	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	662	Open in IMG/M
3300010362\|Ga0126377_11135337	All Organisms → cellular organisms → Bacteria	851	Open in IMG/M
3300010366\|Ga0126379_11300567	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	833	Open in IMG/M
3300010366\|Ga0126379_13128498	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	554	Open in IMG/M
3300010398\|Ga0126383_11229208	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	839	Open in IMG/M
3300010398\|Ga0126383_13492602	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	513	Open in IMG/M
3300010400\|Ga0134122_10943416	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	839	Open in IMG/M
3300010863\|Ga0124850_1109055	All Organisms → cellular organisms → Bacteria	751	Open in IMG/M
3300011415\|Ga0137325_1146435	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300012096\|Ga0137389_10718212	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	859	Open in IMG/M
3300012189\|Ga0137388_10982604	Not Available	779	Open in IMG/M
3300012199\|Ga0137383_11087114	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	579	Open in IMG/M
3300012202\|Ga0137363_11266351	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	625	Open in IMG/M
3300012203\|Ga0137399_10278433	All Organisms → cellular organisms → Bacteria	1378	Open in IMG/M
3300012205\|Ga0137362_11167213	Not Available	654	Open in IMG/M
3300012206\|Ga0137380_10664873	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	906	Open in IMG/M
3300012206\|Ga0137380_10744943	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	848	Open in IMG/M
3300012206\|Ga0137380_11255557	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	626	Open in IMG/M
3300012210\|Ga0137378_10212099	All Organisms → cellular organisms → Bacteria	1803	Open in IMG/M
3300012211\|Ga0137377_11642080	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	566	Open in IMG/M
3300012355\|Ga0137369_11038327	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	540	Open in IMG/M
3300012359\|Ga0137385_10272759	All Organisms → cellular organisms → Bacteria	1460	Open in IMG/M
3300012360\|Ga0137375_11147124	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	599	Open in IMG/M
3300012363\|Ga0137390_12007688	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	504	Open in IMG/M
3300012401\|Ga0134055_1107844	All Organisms → cellular organisms → Bacteria	550	Open in IMG/M
3300012532\|Ga0137373_11046645	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	588	Open in IMG/M
3300012912\|Ga0157306_10078166	All Organisms → cellular organisms → Bacteria	907	Open in IMG/M
3300012925\|Ga0137419_10187698	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Scytonemataceae → Scytonema → Scytonema tolypothrichoides	1522	Open in IMG/M
3300012925\|Ga0137419_11481643	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	574	Open in IMG/M
3300012948\|Ga0126375_11541914	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	570	Open in IMG/M
3300015245\|Ga0137409_10371668	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter → Desulfobacter postgatei	1242	Open in IMG/M
3300015359\|Ga0134085_10593703	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	514	Open in IMG/M
3300015374\|Ga0132255_106270910	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	503	Open in IMG/M
3300016270\|Ga0182036_11461503	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	573	Open in IMG/M
3300016404\|Ga0182037_10050257	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Scytonemataceae → Scytonema → Scytonema tolypothrichoides	2781	Open in IMG/M
3300016422\|Ga0182039_11650471	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	586	Open in IMG/M
3300017965\|Ga0190266_11050563	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	550	Open in IMG/M
3300018027\|Ga0184605_10085298	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1381	Open in IMG/M
3300018029\|Ga0187787_10375506	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	554	Open in IMG/M
3300018074\|Ga0184640_10202519	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	896	Open in IMG/M
3300018077\|Ga0184633_10140176	All Organisms → cellular organisms → Bacteria	1254	Open in IMG/M
3300018079\|Ga0184627_10351122	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300018466\|Ga0190268_10649942	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	761	Open in IMG/M
3300018469\|Ga0190270_13143057	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300025938\|Ga0207704_11540909	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	571	Open in IMG/M
3300025961\|Ga0207712_10921707	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	773	Open in IMG/M
3300026035\|Ga0207703_11119904	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	756	Open in IMG/M
3300026075\|Ga0207708_10516910	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	1003	Open in IMG/M
3300026088\|Ga0207641_12045789	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	574	Open in IMG/M
3300026297\|Ga0209237_1196174	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	656	Open in IMG/M
3300026540\|Ga0209376_1253750	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	749	Open in IMG/M
3300027061\|Ga0209729_1033062	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	645	Open in IMG/M
3300027748\|Ga0209689_1251974	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	721	Open in IMG/M
3300027750\|Ga0209461_10110669	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	633	Open in IMG/M
3300027829\|Ga0209773_10333828	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	632	Open in IMG/M
3300027873\|Ga0209814_10037424	All Organisms → cellular organisms → Bacteria	2013	Open in IMG/M
3300027874\|Ga0209465_10122567	All Organisms → cellular organisms → Bacteria	1282	Open in IMG/M
3300027874\|Ga0209465_10286290	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	825	Open in IMG/M
3300027909\|Ga0209382_11067928	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	836	Open in IMG/M
3300027909\|Ga0209382_11244119	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	758	Open in IMG/M
3300027948\|Ga0209858_1007690	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	816	Open in IMG/M
3300027954\|Ga0209859_1039766	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	776	Open in IMG/M
3300028381\|Ga0268264_11359018	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	721	Open in IMG/M
3300028589\|Ga0247818_10743391	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	682	Open in IMG/M
3300028792\|Ga0307504_10123971	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	850	Open in IMG/M
3300029999\|Ga0311339_11274100	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	668	Open in IMG/M
3300030006\|Ga0299907_10653501	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	811	Open in IMG/M
3300030904\|Ga0308198_1031533	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	759	Open in IMG/M
3300031092\|Ga0308204_10108899	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	774	Open in IMG/M
3300031093\|Ga0308197_10090426	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	886	Open in IMG/M
3300031114\|Ga0308187_10399129	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	543	Open in IMG/M
3300031228\|Ga0299914_10798900	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	787	Open in IMG/M
3300031731\|Ga0307405_10775655	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	801	Open in IMG/M
3300031833\|Ga0310917_10792595	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	640	Open in IMG/M
3300031890\|Ga0306925_10236205	Not Available	1971	Open in IMG/M
3300031890\|Ga0306925_10683165	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	1076	Open in IMG/M
3300031890\|Ga0306925_10959045	All Organisms → cellular organisms → Bacteria	875	Open in IMG/M
3300031910\|Ga0306923_12080400	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300031942\|Ga0310916_11194704	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	629	Open in IMG/M
3300031954\|Ga0306926_12497078	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	567	Open in IMG/M
3300032035\|Ga0310911_10644542	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	614	Open in IMG/M
3300032035\|Ga0310911_10833234	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	533	Open in IMG/M
3300032080\|Ga0326721_11063786	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	520	Open in IMG/M
3300032126\|Ga0307415_100807672	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	857	Open in IMG/M
3300032205\|Ga0307472_100883814	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	826	Open in IMG/M
3300032261\|Ga0306920_102697754	Not Available	679	Open in IMG/M
3300034178\|Ga0364934_0213176	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	732	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	81.43%
Host-Associated	Host-Associated	18.57%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	76.43%
Plants	Host-Associated → Plants	18.57%
Aquatic	Environmental → Aquatic	5.00%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	75.00%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.14%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.00%
Sediment	Environmental → Aquatic → Sediment	3.57%
Freshwater	Environmental → Aquatic → Freshwater	1.43%
Peat	Environmental → Terrestrial → Peat	0.71%
Floodplain	Environmental → Terrestrial → Floodplain	0.71%
Roots	Host-Associated → Plants → Roots	0.71%
Phyllosphere	Host-Associated → Plants → Phyllosphere	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	58.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	12.14%
Loam	Environmental → Terrestrial → Soil → Loam	10.71%
Sand	Environmental → Terrestrial → Soil → Sand	5.00%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.29%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.57%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.71%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.71%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.71%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.71%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.71%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.71%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.71%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	39.29%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	12.14%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.00%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.14%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.71%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	5.00%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.29%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.57%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.71%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.71%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.71%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.71%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.71%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.71%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.71%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.71%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.71%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.71%
Unclassified	Host-Associated → Plants → Roots → Rhizosphere → Unclassified	0.71%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	0.71%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	18.57%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	9.29%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	8.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.43%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.00%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.00%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	5.00%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.29%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.57%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.86%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.14%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.14%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.43%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.43%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.71%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.71%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.71%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.71%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.71%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.71%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.71%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.71%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.71%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.71%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.71%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.71%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.71%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.71%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	0.71%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009793	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40	Environmental	Open in IMG/M
3300009802	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60	Environmental	Open in IMG/M
3300009815	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10	Environmental	Open in IMG/M
3300009818	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010863	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)	Environmental	Open in IMG/M
3300011415	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012401	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015359	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018077	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1	Environmental	Open in IMG/M
3300018079	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026297	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)	Environmental	Open in IMG/M
3300027061	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)	Environmental	Open in IMG/M
3300027748	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)	Environmental	Open in IMG/M
3300027750	Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)	Host-Associated	Open in IMG/M
3300027829	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027948	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes)	Environmental	Open in IMG/M
3300027954	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028589	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300029999	I_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300030904	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031092	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031093	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031114	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031228	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental	Open in IMG/M
3300032080	Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016	Environmental	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300034178	Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F054255

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
C688J18823_106268901	3300001686	Soil	LVNAPLIILFLSDTVGGRLHDKRLAEPYPLPAGSRLLQDLG
Ga0066388_1004809623	3300005332	Tropical Forest Soil	VLLVNALLLILFLSDTYGGRVHDKRIADATPYPLPAKSR*
Ga0066388_1022473161	3300005332	Tropical Forest Soil	VLRVKALLAILFLSDTYGGRTHDKRIAEATTYPLPAGSRLLQDPRVIAPS*
Ga0070708_1019627682	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MAFPTAIKNILLVNALLIILFLNETAGGRLHDKRLAEATPYP
Ga0070706_1001800294	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	VLLVNALLMILFLSDTHGGRVHDLRIAETTPYPLPAGSGL
Ga0070698_1004017341	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	VKNVLLVNALLIILFLSATHGGRVHDLRIAEATPYPLPAG
Ga0070699_1018360171	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	VKHVLLANALLTILFLSETFGGRIHEKRMADATPYPLPAG
Ga0066701_109148652	3300005552	Soil	VNALLTILFLSATYGGRVHDKPIAATTPYPLPAGSRLLQDLGF
Ga0066692_100713341	3300005555	Soil	LLVNALLLILFLSDTHGGRVHDLRIAEATPYPLPAGSQREVS*
Ga0066703_104420891	3300005568	Soil	KNVLLVNALLTILFLSGTYGGRVHDKRIADATPYPLPARSRL*
Ga0066706_111893501	3300005598	Soil	VNALLIILFLSDTYGGRIHDKPIADATPYPLPVGS
Ga0068859_1012532481	3300005617	Switchgrass Rhizosphere	LLLILFLSDTHGGRVHDLRIAETTPYPLPAGSGLLQPTFKG*
Ga0068861_1013303632	3300005719	Switchgrass Rhizosphere	LINALLRILLLSDTYGGRTHDLRIAEATPYPLPAGSGLLQ
Ga0066903_1059503351	3300005764	Tropical Forest Soil	VKNVLLVNALLVILLLSDTHGGRTHDLRIAEATPYPLP
Ga0066903_1086899592	3300005764	Tropical Forest Soil	VKNVLLVNALLVILFLSDTHGGRTHDLRIAEATPY
Ga0081538_101972921	3300005981	Tabebuia Heterophylla Rhizosphere	VLLINAALTILFLSETYAGSTHDKRIAEATPYPLPPGSR
Ga0075417_107532611	3300006049	Populus Rhizosphere	VNALLTILFLSDTYGGRVHDLRIAEATPYPLPAGSGLLQ
Ga0070716_1016219382	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	VKNVLLVNALLLILFLSDTYGGRTHDLRIAEATPYP
Ga0066658_101904242	3300006794	Soil	VKNVLLVNALLLILFLSDTYGGRTHDKRIADATP*
Ga0079220_106337801	3300006806	Agricultural Soil	VLIILFLSDTVGGRIHDKRLAEPYPLPAGSRLLQD
Ga0075430_1007819102	3300006846	Populus Rhizosphere	VIKSTLLTILFRSDTYGGRVHEKPIADATPYPLPA
Ga0075429_1002639572	3300006880	Populus Rhizosphere	VNALLLLLFLSATHGGRVHDRRIAEAPLPHMHEAITY*
Ga0075419_115249331	3300006969	Populus Rhizosphere	VNALLTILFLSDTYGGRTHDLRIAEATPYPLPAGSGLLQD
Ga0075435_1014697063	3300007076	Populus Rhizosphere	LLVNALLTILFLSATYGGRVHDLRIAEATPYPLPAGSG*
Ga0099793_101301113	3300007258	Vadose Zone Soil	VNALLLILFLSDTYGGRTHDKPIADATPYPLPAGSG
Ga0099793_103243012	3300007258	Vadose Zone Soil	LVKPEKNVLLVNTPLTILLLSDTYGGRVHDLRIAEATPYPLPAGSGLLQD
Ga0099794_104845241	3300007265	Vadose Zone Soil	VHALLIILFLSDTYGGRIHEKPMADATPYPLPAGSW
Ga0099829_115948452	3300009038	Vadose Zone Soil	VNALLIILFLSDTYGGRVHDKPIADATPYPLPAGS
Ga0105098_104044991	3300009081	Freshwater Sediment	VKPVFRIHAALTLLFRSDTYAGSTHDKRMAEATPYPWPTGSR
Ga0099828_117469412	3300009089	Vadose Zone Soil	VNALLLILFLSDTYGGRIHEKPMADATPSPLPAGSRLLQ
Ga0099827_103462451	3300009090	Vadose Zone Soil	VNALLIILFLSDTYGGRVHDKPIADATPYPLPAGSR
Ga0099827_111026891	3300009090	Vadose Zone Soil	VNALLTILFLSATHGGRVHDKRIAEATPYPLPAGS
Ga0111539_118080962	3300009094	Populus Rhizosphere	VKNVLLVNALLLILFLSDTYGGRTHDKLIADATPY
Ga0105245_111503061	3300009098	Miscanthus Rhizosphere	ALLLLLFLSATHGGRVHDRRIAEAPLPHMHEAITY*
Ga0075418_102989801	3300009100	Populus Rhizosphere	KDNTVKNVLLVNALLTILFLSATYGGRVHDLRIAEATPYPPYAPG*
Ga0066709_1015050691	3300009137	Grasslands Soil	VKNVLLINAPLTILFLSATEPGRMHDKRLADATPYP
Ga0066709_1025701581	3300009137	Grasslands Soil	VNALLIILCLSDTYGGRVHDKPIADATPYPLPAGSRLLQDLGFLA
Ga0114129_100808921	3300009147	Populus Rhizosphere	VNALLTILFLSDTYGGRVHDKRIADATPYPLPARSRLL
Ga0114129_102390823	3300009147	Populus Rhizosphere	VKNVRLVNASLTILFLSDTYGGRVHDKRIAEATPYPFSGCA*
Ga0105249_101724552	3300009553	Switchgrass Rhizosphere	VKNVLLVNALLLILFLRDTYGGRVHDKRIADATPYPLPAQSRL*
Ga0126374_109467852	3300009792	Tropical Forest Soil	VKNVLLVNALLLILFLSDTYGGRVHDLRIAEATPYPLP
Ga0126374_115926901	3300009792	Tropical Forest Soil	KKDHTVKKVLLVKALLLILFLSDTYGGRTHEKSIADVTPSPLPAGS*
Ga0105077_1244092	3300009793	Groundwater Sand	VNALLLIFFLSDTYGGRTHDKPIADATPYPLPAGSRLLQDLG
Ga0105073_10584422	3300009802	Groundwater Sand	VKNVLLINAPLTILFLSETHGGRVHDKRIAEATHYPLPA
Ga0105070_10091981	3300009815	Groundwater Sand	KCHTVKNVLLINAALTILFLRDPYAGSVHDKRSAATTP*
Ga0105070_10685522	3300009815	Groundwater Sand	VKNVLLVNAPLTILFLSETAGGRVHDKRLAEATPYPLPAGS
Ga0105072_10593842	3300009818	Groundwater Sand	VNALLIVLFLSDTYGGRIHEKPIAAATPYPLPAGSR
Ga0126312_107436231	3300010041	Serpentine Soil	VKHVPLINAALLILLLSDPSPASPHDKRMAEATPYPLT
Ga0126380_121117541	3300010043	Tropical Forest Soil	VKNVLLVNALLVILFLSDTHGGRTHDLRIAEATPYP
Ga0126382_110460322	3300010047	Tropical Forest Soil	VKNVLLVNALLLILFLSDTHGGRTHDLRIAEATPYPPFAPG*
Ga0126382_113361272	3300010047	Tropical Forest Soil	VKNVLLVNTLLVILFLSDTHGGRVHDLRIAEATPY
Ga0126382_122361281	3300010047	Tropical Forest Soil	VKNVLLVNAPLTILFLSETHGGRVHEKRIAEATPYPLPAGS
Ga0134084_102330371	3300010322	Grasslands Soil	VNALLIILFLSDTSGGRVHDKPIADTTPYPLPPGSRL
Ga0126376_117273381	3300010359	Tropical Forest Soil	VKNVLLVNALLTILFLSATHGGRTHDLRIAEATPYPLP
Ga0126377_111353373	3300010362	Tropical Forest Soil	HTVKNGLLVNPLLLILLLSDPYGGRTHAKRIAEATPSP*
Ga0126379_113005672	3300010366	Tropical Forest Soil	VNALLTILFLSDTYGGRVHDLRIAEATPYPLPARSRLL
Ga0126379_131284981	3300010366	Tropical Forest Soil	LLVNALLVILFLSDTHGGRTHDLRIAEATPYPLPAGSGLLQ
Ga0126383_112292081	3300010398	Tropical Forest Soil	VLLINAGLTILFLSGTYAGSTHDKRIADATPYPLPA
Ga0126383_134926021	3300010398	Tropical Forest Soil	VKNVLLVNALLVILFLSDTHGGRVHDLRIAEATPYPL
Ga0134122_109434162	3300010400	Terrestrial Soil	VKNVLLVNAPLTILLLSETHGGRGHDKRIAEATPYP
Ga0124850_11090551	3300010863	Tropical Forest Soil	LLINALLTILFLSDTYAGRVHEKRIAEATPYPLPAGSRLL*
Ga0137325_11464351	3300011415	Soil	VLLGLFLSETYGGRIHDKRIAEATPYPLPAGSRLLQDLGFL
Ga0137389_107182121	3300012096	Vadose Zone Soil	VNNVLLVHALLTILFLSATHGGRVHDTRIAEATPYP
Ga0137388_109826041	3300012189	Vadose Zone Soil	KKKDHTVKNLLLVNAPLTVLFLSATHGDRVHDLRIAAATPYL*
Ga0137383_110871141	3300012199	Vadose Zone Soil	VKNVLLVHTLLTLLFLSATYGGRVHDKRIAEATPYPLPAGSRLL*
Ga0137363_112663512	3300012202	Vadose Zone Soil	VRLINAALTILLLRETSAGSTHDKRIADANPYPLP
Ga0137399_102784331	3300012203	Vadose Zone Soil	LRDNSNATLRIVFLSETAPGSVHDKRLADTTPYPLP
Ga0137362_111672131	3300012205	Vadose Zone Soil	VKNVLLVNALLTILFLSATHGGRVHDKRIVEATPYPLPAGSRLLQDL
Ga0137380_106648731	3300012206	Vadose Zone Soil	VLLVNALLLILLLSDTYGGRVHDKRMAAATPYPLPAGRGLL
Ga0137380_107449431	3300012206	Vadose Zone Soil	VKNVLLVHTLLTLLFLSATYGGRVHDKRIAEATPYPLPAG
Ga0137380_112555572	3300012206	Vadose Zone Soil	MVKTVRLINTVLTILLLSETYAGSTQDTRMADATPYPWPAGSRLL
Ga0137378_102120991	3300012210	Vadose Zone Soil	NVLLVNALLIILFLSDTSGGRIHDKRMAEATPYPHKRQDKL*
Ga0137377_116420801	3300012211	Vadose Zone Soil	VNALLTILFLSDTYGGRVHDLRLAEVTPYPLPAGSGL
Ga0137369_110383272	3300012355	Vadose Zone Soil	VKNVLLVNALLIILFLSDTYGGRSHDKRIAEATPY
Ga0137385_102727591	3300012359	Vadose Zone Soil	VKNVLLVNTLLTILFLSATYGGRVHDKRIAEATPYPLPAGSRLLQ
Ga0137375_111471241	3300012360	Vadose Zone Soil	VKNVLLVNALLTILFLSDTCGGRVHDKRIADMTPSPLPA
Ga0137390_120076881	3300012363	Vadose Zone Soil	VNALLVILFLSDTHGGRVHDLRIAETTPYPLPAGRG
Ga0134055_11078442	3300012401	Grasslands Soil	VKNVLLVNALLIILFLSDTYGGRSHDKRIAEATP*
Ga0137373_110466451	3300012532	Vadose Zone Soil	VNALLLILFLSDTYGGRVHDKPIADATPSPLPAGSR
Ga0157306_100781663	3300012912	Soil	VKNILLVNAPLMILFLSETAGGRVHDKRLAEATPYPLPA
Ga0137419_101876983	3300012925	Vadose Zone Soil	LVNALLTVLFLSDTYGGRVHDLRIAEATPYPLPLTGVGFL*
Ga0137419_114816431	3300012925	Vadose Zone Soil	KDHTVKNVLLVNTLLVILFLSDTYGGRVHDLRIAEATGK*
Ga0126375_115419141	3300012948	Tropical Forest Soil	VKNVLLINAVLTILFLSETYAGSTHDKRIADATPYP
Ga0137409_103716681	3300015245	Vadose Zone Soil	VHARLLILFLSDTYGGRLHEKPLADETPSPWPAGSRLLQD
Ga0134085_105937032	3300015359	Grasslands Soil	VNALLIILFLSDTYGGRIHDKPIADATPSPLPAGS
Ga0132255_1062709102	3300015374	Arabidopsis Rhizosphere	VKNVLLVNAWLLILFLSNTYGGRTHDKRIADATPYPLPAGS
Ga0182036_114615031	3300016270	Soil	VKNVLLVNALLTILFLSDTHSGRTHELRIAEATPYPLPV
Ga0182037_100502571	3300016404	Soil	LLVILFLSDTHGGRTHDLRIAEATPHPLPASEKEVFS
Ga0182039_116504712	3300016422	Soil	VNALLLILFLSDTYGGRVHDKRIADATPYPLPAGS
Ga0190266_110505631	3300017965	Soil	VNALLTILFLSDTYGGRVHDLRIAEATPYPLPAGS
Ga0184605_100852981	3300018027	Groundwater Sediment	NVLLVNALLIILFLSDTHGGRTHDLRIAETTPYPP
Ga0187787_103755061	3300018029	Tropical Peatland	VKNVLLVNALLTILFLSETYGGRTHDLRIAEATPYPLPAGS
Ga0184640_102025192	3300018074	Groundwater Sediment	VLLINAVLTILFLSETYAGSTHDKRIADATPYPLPA
Ga0184633_101401762	3300018077	Groundwater Sediment	VKTVWLINAALTVLLLSDTYAGSTHDTRMADATPYP
Ga0184627_103511222	3300018079	Groundwater Sediment	VLLINAALTILFLSETYAGSTHDKRIADATPYPLPA
Ga0190268_106499421	3300018466	Soil	VKHVLLINAALTILFLRATYAGSTHDKRIADATPYPL
Ga0190270_131430571	3300018469	Soil	VKNVLLINAALAILCLRETSAGRTHDPRMADATPDPLPAGSR
Ga0207704_115409091	3300025938	Miscanthus Rhizosphere	VKNVLLVNALLIILFLSETHGGRTHDLRIAEATPYPLPAGRGLL
Ga0207712_109217072	3300025961	Switchgrass Rhizosphere	VKNVLLVNALLLILFLRDTYGGRVHDKRIADATPYPLPAQSR
Ga0207703_111199041	3300026035	Switchgrass Rhizosphere	VKNVLLVNALLIILFLSDTYGGRVHDLRIAEATPYP
Ga0207708_105169103	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	NTLLLILFLSDTHGGRVHDLRIAETTPYPLPAGSGLLQPTFKG
Ga0207641_120457892	3300026088	Switchgrass Rhizosphere	VKNVLLVNALLTILFLSDTYGGRVHDKRIADATPY
Ga0209237_11961742	3300026297	Grasslands Soil	VKNVLLVNTLLTILFLSATYGGRVHDKRIAEATPYPLPAG
Ga0209376_12537502	3300026540	Soil	VNALLIILFLSDTYGGRVHDKPMADATPYPLPAGS
Ga0209729_10330621	3300027061	Forest Soil	VKHVLLSNAALTSLLLSDTYAGSTHDQRMADTTPYPL
Ga0209689_12519742	3300027748	Soil	VLLVNTLLLILFLSDTYGGRVHDKQIADATPYPLPAQ
Ga0209461_101106691	3300027750	Agave	VNALLLILFLSDTYGGRMHDLRIAEATPYPLPAGSGLLQDL
Ga0209773_103338281	3300027829	Bog Forest Soil	VLLVNAPLIILFLSETTGGRVHDKTIAASTPYPLPAGS
Ga0209814_100374244	3300027873	Populus Rhizosphere	VNALLTILFLSDTYGGHTHDLRIAEATPYPLPAGSGL
Ga0209465_101225671	3300027874	Tropical Forest Soil	LLAILFLSDTYGGRTHDKRIAEATTYPLPAGSRLLQDPRVIAPS
Ga0209465_102862903	3300027874	Tropical Forest Soil	VKNVLLVNALLTILFLSDTYGGRVHDLRIAEATPYPLPA
Ga0209382_110679282	3300027909	Populus Rhizosphere	VKNVLLVNALLLILFLSATHGGRVHDLRIAEATPYPLPAGSQ
Ga0209382_112441191	3300027909	Populus Rhizosphere	VLLINALLTLLFLSATSVGSTHDQRMADATPYPLPAGSLLLQD
Ga0209858_10076901	3300027948	Groundwater Sand	MILFLSATYGGRIHEKRIAEATPSPLPAGSRLLQD
Ga0209859_10397661	3300027954	Groundwater Sand	VNALLLILFLSDTYGGRVHDKPIADATPYPLPAGS
Ga0268264_113590181	3300028381	Switchgrass Rhizosphere	LVNTLLLILFLSDTHGGRVHDLRIAETTPYPLPAGSGLLQPTFKG
Ga0247818_107433911	3300028589	Soil	VKNVLLVNAPLTILFLSETHGGRVHDLRIAEATPY
Ga0307504_101239712	3300028792	Soil	VNTPLTILFLSETYGGRVHDLRIAEATPYPLPAGSGLLQ
Ga0311339_112741002	3300029999	Palsa	VKDVLLVNAPLNFLFLSATVGGHVHDKRIADATPYPLPTGSRLL
Ga0299907_106535012	3300030006	Soil	VKNVLLVDAPLTILFLSATHGGRVHDKRIAEATPYPLPAGSRLLQD
Ga0308198_10315331	3300030904	Soil	VNALLIILCLSDTYAGRVHDKRIAEATPYPLPSGSRLLQDL
Ga0308204_101088991	3300031092	Soil	VKNVLLVNAPLTILFLSDTRGGRVHDKRIAEATPYP
Ga0308197_100904263	3300031093	Soil	VNALLIILCLSDTYAGRVHDKRIAAATPYPLPSGSRLLQDLGF
Ga0308187_103991292	3300031114	Soil	VTNVLLINAALMILLLSETYAGSTHDQRIADTTPYPL
Ga0299914_107989001	3300031228	Soil	VKNVLLVDAPLTILFLSNTYGGRTHDKRIADATPY
Ga0307405_107756552	3300031731	Rhizosphere	VKNLLLVNAALTIIFLSETYHGSTHDKRIADGAPYPLPA
Ga0310917_107925951	3300031833	Soil	VNAQLIILFLSDTYDGRVHDLRIAEATPYPLPAGSG
Ga0306925_102362051	3300031890	Soil	MTNGDTVKNVLRVHALLTILFLSATYCGRVHDKRIADATPYPL
Ga0306925_106831653	3300031890	Soil	VKNVLLVNALLLILFLSDTYGGRTHDKPIADATPY
Ga0306925_109590451	3300031890	Soil	VNALLIILFLSDTYGGHIHDKPIADATPYPLPAGS
Ga0306923_120804002	3300031910	Soil	MTNGDTVKNVLRVHALLTILFLSATYCGRVHDKRIADATPYPLPA
Ga0310916_111947041	3300031942	Soil	VKNVLLVNALLVILFLSDTHGGRVHDLRIAEATPSPLPAGSGLL
Ga0306926_124970782	3300031954	Soil	VNALLLILFLSDTYGGRAHDKRIADTTPYPLPARS
Ga0310911_106445422	3300032035	Soil	VKNVLLVNALLVILFLSDTHGGRVHDLRIAEATPSPL
Ga0310911_108332341	3300032035	Soil	VKNVLLVNAPLISLFLSATHGGRVHDLRIAEATPSPLPAGSHL
Ga0326721_110637861	3300032080	Soil	VLIILFLSDTVGGRIHDKRLAEATPYPLPAGSRLL
Ga0307415_1008076722	3300032126	Rhizosphere	VKNVLLINAALTILFLSDTSAGSVHDTRLADSTPS
Ga0307472_1008838142	3300032205	Hardwood Forest Soil	VLLINAALTILFLSETYVGRTHDQRMADATPDPLP
Ga0306920_1026977542	3300032261	Soil	VKNALLVKALLTILFLSDTYGGRVHDKRIAAAPPYP
Ga0364934_0213176_2_118	3300034178	Sediment	VLLINAALTILFLSETYAGSTHDTRMADANPYPLPPGSR

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign