NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054346

Metagenome / Metatranscriptome Family F054346

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054346
Family Type Metagenome / Metatranscriptome
Number of Sequences 140
Average Sequence Length 80 residues
Representative Sequence MEGVEHNWAARYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYHRESNFQYEHRDM
Number of Associated Samples 110
Number of Associated Scaffolds 140

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.86 %
% of genes near scaffold ends (potentially truncated) 42.14 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.429 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(67.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(57.143 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.37%    β-sheet: 0.00%    Coil/Unstructured: 59.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004794|Ga0007751_11221846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida617Open in IMG/M
3300005043|Ga0071100_1129240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida567Open in IMG/M
3300005987|Ga0075158_10768932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida517Open in IMG/M
3300005989|Ga0075154_10524944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida646Open in IMG/M
3300006165|Ga0075443_10075086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1148Open in IMG/M
3300006355|Ga0075501_1107487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida522Open in IMG/M
3300006397|Ga0075488_1401483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida538Open in IMG/M
3300006415|Ga0099654_10096002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1193Open in IMG/M
3300006415|Ga0099654_10346493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida732Open in IMG/M
3300006803|Ga0075467_10144702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1370Open in IMG/M
3300006803|Ga0075467_10183312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1176Open in IMG/M
3300007516|Ga0105050_10575693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida658Open in IMG/M
3300007725|Ga0102951_1045508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1306Open in IMG/M
3300008835|Ga0103883_1034573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida629Open in IMG/M
3300008938|Ga0103741_1051871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida789Open in IMG/M
3300008993|Ga0104258_1099993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida542Open in IMG/M
3300009002|Ga0102810_1050896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1331Open in IMG/M
3300009002|Ga0102810_1058307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1230Open in IMG/M
3300009002|Ga0102810_1272170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida523Open in IMG/M
3300009079|Ga0102814_10154670All Organisms → Viruses → Predicted Viral1253Open in IMG/M
3300009172|Ga0114995_10174499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1197Open in IMG/M
3300009263|Ga0103872_1007033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1036Open in IMG/M
3300009269|Ga0103876_1068075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida533Open in IMG/M
3300009432|Ga0115005_10324826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1213Open in IMG/M
3300009433|Ga0115545_1073306All Organisms → Viruses → Predicted Viral1272Open in IMG/M
3300009434|Ga0115562_1108096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1090Open in IMG/M
3300009436|Ga0115008_10247852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1268Open in IMG/M
3300009495|Ga0115571_1087413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1369Open in IMG/M
3300009495|Ga0115571_1388944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida545Open in IMG/M
3300009599|Ga0115103_1820021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1209Open in IMG/M
3300009606|Ga0115102_10572730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida758Open in IMG/M
3300009606|Ga0115102_10788862All Organisms → Viruses → Predicted Viral1103Open in IMG/M
3300010388|Ga0136551_1099179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida507Open in IMG/M
3300010883|Ga0133547_11297669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1382Open in IMG/M
3300012408|Ga0138265_1383012All Organisms → Viruses → Predicted Viral1200Open in IMG/M
3300012414|Ga0138264_1297825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida931Open in IMG/M
3300012954|Ga0163111_12083543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida572Open in IMG/M
3300012962|Ga0129335_1064566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1169Open in IMG/M
3300012962|Ga0129335_1181581All Organisms → Viruses → Predicted Viral1177Open in IMG/M
3300012970|Ga0129338_1048974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida782Open in IMG/M
3300017783|Ga0181379_1199331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida701Open in IMG/M
3300017957|Ga0181571_10196023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1310Open in IMG/M
3300018420|Ga0181563_10192685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1249Open in IMG/M
3300018426|Ga0181566_10245478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1310Open in IMG/M
3300018628|Ga0193355_1028120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida537Open in IMG/M
3300018684|Ga0192983_1006766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1283Open in IMG/M
3300018684|Ga0192983_1010282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1125Open in IMG/M
3300018739|Ga0192974_1019361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1155Open in IMG/M
3300018766|Ga0193181_1044823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida646Open in IMG/M
3300018871|Ga0192978_1079177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida603Open in IMG/M
3300018980|Ga0192961_10046513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1234Open in IMG/M
3300018980|Ga0192961_10049290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1206Open in IMG/M
3300018980|Ga0192961_10195782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida608Open in IMG/M
3300018982|Ga0192947_10068158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1145Open in IMG/M
3300018982|Ga0192947_10095154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida983Open in IMG/M
3300019021|Ga0192982_10129829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida867Open in IMG/M
3300019032|Ga0192869_10311853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida687Open in IMG/M
3300019036|Ga0192945_10268219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida538Open in IMG/M
3300019048|Ga0192981_10180443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida830Open in IMG/M
3300019050|Ga0192966_10105569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida972Open in IMG/M
3300019050|Ga0192966_10260881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida615Open in IMG/M
3300019050|Ga0192966_10330871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida532Open in IMG/M
3300019103|Ga0192946_1011815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1232Open in IMG/M
3300019117|Ga0193054_1076129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida501Open in IMG/M
3300019123|Ga0192980_1019889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1245Open in IMG/M
3300019123|Ga0192980_1055064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida755Open in IMG/M
3300019123|Ga0192980_1066613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida674Open in IMG/M
3300019123|Ga0192980_1077901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida609Open in IMG/M
3300019131|Ga0193249_1040027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1156Open in IMG/M
3300020193|Ga0194131_10444822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida580Open in IMG/M
3300021169|Ga0206687_1364607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida816Open in IMG/M
3300021345|Ga0206688_10591361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida501Open in IMG/M
3300021365|Ga0206123_10104380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1349Open in IMG/M
3300021887|Ga0063105_1060291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida815Open in IMG/M
3300021913|Ga0063104_1029455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1145Open in IMG/M
3300021913|Ga0063104_1071531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida737Open in IMG/M
3300021922|Ga0063869_1034865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1021Open in IMG/M
3300021927|Ga0063103_1055773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida957Open in IMG/M
3300021927|Ga0063103_1096543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida519Open in IMG/M
3300021941|Ga0063102_1141541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida511Open in IMG/M
3300021962|Ga0222713_10649989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida608Open in IMG/M
3300025816|Ga0209193_1088224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida789Open in IMG/M
3300025887|Ga0208544_10091532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1386Open in IMG/M
3300027159|Ga0208020_1094125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida523Open in IMG/M
3300027687|Ga0209710_1244632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida584Open in IMG/M
3300027786|Ga0209812_10348074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida646Open in IMG/M
3300027833|Ga0209092_10160174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1292Open in IMG/M
3300027849|Ga0209712_10159453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1290Open in IMG/M
3300027883|Ga0209713_10446135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida849Open in IMG/M
3300027899|Ga0209668_10140614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1454Open in IMG/M
3300027976|Ga0209702_10296784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida658Open in IMG/M
3300028137|Ga0256412_1091537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1099Open in IMG/M
3300028864|Ga0302215_10231555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida699Open in IMG/M
3300030699|Ga0307398_10708045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida558Open in IMG/M
3300030709|Ga0307400_10219100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1194Open in IMG/M
3300030948|Ga0073977_1657910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1180Open in IMG/M
3300031005|Ga0073974_1729532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida584Open in IMG/M
3300031006|Ga0073973_1671619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida928Open in IMG/M
3300031231|Ga0170824_123038111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida644Open in IMG/M
3300031569|Ga0307489_10249823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1124Open in IMG/M
3300031569|Ga0307489_10367684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida949Open in IMG/M
3300031638|Ga0302125_10054738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1356Open in IMG/M
3300031710|Ga0307386_10109367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1226Open in IMG/M
3300031725|Ga0307381_10373062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida523Open in IMG/M
3300031729|Ga0307391_10162004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1147Open in IMG/M
3300031729|Ga0307391_10181358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1093Open in IMG/M
3300031729|Ga0307391_10721356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida569Open in IMG/M
3300031734|Ga0307397_10100937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1187Open in IMG/M
3300031734|Ga0307397_10101738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1183Open in IMG/M
3300031735|Ga0307394_10097213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1108Open in IMG/M
3300031737|Ga0307387_10183808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1181Open in IMG/M
3300031742|Ga0307395_10378927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida614Open in IMG/M
3300031743|Ga0307382_10256122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida783Open in IMG/M
3300031752|Ga0307404_10269229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida706Open in IMG/M
3300032491|Ga0314675_10132046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1170Open in IMG/M
3300032492|Ga0314679_10344625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida679Open in IMG/M
3300032517|Ga0314688_10131052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1198Open in IMG/M
3300032518|Ga0314689_10152233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1163Open in IMG/M
3300032518|Ga0314689_10160615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1137Open in IMG/M
3300032519|Ga0314676_10814265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida538Open in IMG/M
3300032540|Ga0314682_10151180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1193Open in IMG/M
3300032540|Ga0314682_10177420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1117Open in IMG/M
3300032616|Ga0314671_10146712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1218Open in IMG/M
3300032616|Ga0314671_10153473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1195Open in IMG/M
3300032616|Ga0314671_10534348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida637Open in IMG/M
3300032617|Ga0314683_10221142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1160Open in IMG/M
3300032617|Ga0314683_10920379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida520Open in IMG/M
3300032707|Ga0314687_10137096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1205Open in IMG/M
3300032708|Ga0314669_10300685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae → Moneuplotes → Moneuplotes crassus861Open in IMG/M
3300032708|Ga0314669_10749631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida534Open in IMG/M
3300032711|Ga0314681_10183470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1098Open in IMG/M
3300032714|Ga0314686_10598989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida536Open in IMG/M
3300032724|Ga0314695_1320877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida591Open in IMG/M
3300032726|Ga0314698_10114126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1161Open in IMG/M
3300032742|Ga0314710_10315806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida649Open in IMG/M
3300032747|Ga0314712_10207715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida925Open in IMG/M
3300032752|Ga0314700_10148281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1165Open in IMG/M
3300032752|Ga0314700_10156941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1137Open in IMG/M
3300033572|Ga0307390_10195703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1157Open in IMG/M
3300033572|Ga0307390_10198424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1151Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine20.71%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater17.14%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.71%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.57%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.57%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.14%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent2.14%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water2.14%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.43%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.43%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.43%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.43%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.43%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.71%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.71%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.71%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.71%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.71%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.71%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.71%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.71%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.71%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.71%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.71%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.71%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.71%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.71%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010388Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028864Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_1EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031005Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031006Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0007751_1122184623300004794Freshwater LakeVNQWHLEGIEHHWCSHYGQQPRSVEFDGPINPIGDMNLREGLFQRLYNYVHREIASSHTKGSPSTYADWII
Ga0071100_112924023300005043Marine Subseafloor AquiferMEGFEHSWAHRYGQMPRSVISPEGINPIGDMNLKAGLFERLYNALHREIASSNQKATPSTYADWIIGYHREANW*
Ga0075158_1076893213300005987Wastewater EffluentQWHLEGIEHHWAHRYGQLPRSVIFKDGINPIGDMNLREGLFQRLYNYVHREIASANSRATPSTYGDWIIGYHRESNWQYEHRDM*DK*IAKALVLKLYFTSI*
Ga0075154_1052494413300005989Wastewater EffluentVVNQWHLEGIEHHWAHRYGQLPRSVIFKDGINPIGDMNLREGLFQRLYNYVHREIASANSRATPSTYGDWIIGYHRESNWQYEHRDM*
Ga0075443_1007508613300006165MarineMEGIEHHWAHRYGQVPRSVNDFGEINPIGDMNLREGLFNRLYNNLGREIGSMNSKAGTPSTYADWIIG
Ga0075501_110748713300006355AqueousVLVNQWHMEGIEHQWCARYGQLPRSVEFPEGINPIGDMNLREGLFERYYNYLHRELASKNSKSSPSTYADWIIGYHREANWQYEHRDM*
Ga0075488_140148313300006397AqueousMEGIEHHWAHRYGQVPRSVQFAEGINPIGDMDLREGLFNRLYNNLHREIASANSKAGTPSTYADWIIGYHRESNFQYEHRDM*
Ga0099654_1009600213300006415LakeMEGIEHQWCARYGQIPRSVEFPEGINPIGDMNLRAGLFQRLYNNLHRELASKNTKATPSTYSDWIIGYHRESNF*
Ga0099654_1034649313300006415LakeMEGIEHHWAHRYGQIPRSVQFTEGVNPIGDMDLRDGLFQRLYNSLHREISSANAKATPSTYADWIIGYHRESNWQYEHRDM*
Ga0075467_1014470253300006803AqueousMEGVEHHWAHRYGQVPRSVEFPEGINPIGDMDLREGLFGRLYNNVQREIASANAKAGTPSTYADWIIGYHRESNFQYEHRDM*
Ga0075467_1018331213300006803AqueousLVNQWHMEGVEHNWAHRYGQLPRSIAFPEGIDVIGDMDLRNGLFQRLYNSLHREIGSANAKGTPVTYADWIIGYHREANWQYEHRDM*
Ga0105050_1057569313300007516FreshwaterMEGIEHNWAHRYGQIPRSVQFPEGINPIGDMDLRDGLFQRLYNALNREIVSANVKATPSTYSDWIIGYHRESNFQYEHRDM*
Ga0102951_104550813300007725WaterMEGIEHNWAHRYGQLPRSVHFPEGVNPIGDMDLREGLFSRLYNALHREIASSNSRSAPSTYADWIIGYHRESNWQYEHRDM*
Ga0103883_103457323300008835Surface Ocean WaterMEGIEHEWAHRYGQVPRSVQFPEGINPIGDFDLKDGLFQRMYNALHREIASANTGGTPSTYADWIIGYHRESNWQYEHRDM*
Ga0103741_105187113300008938Ice Edge, Mcmurdo Sound, AntarcticaMHMEGIEHHWAARFGQVPRSVEFPEGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWIIGYHRESNWQYEHRDM*
Ga0104258_109999323300008993Ocean WaterMEGIEHNWAHRYGQMPRSVAFPEGVNPIGDMDLKDGLFQRLYNALHREIASANTRGTPVTYADWIIGYHREANWQYEHRDM*
Ga0102810_105089633300009002EstuarineMEGIEHNWAHRYGQLPRSVHFAEGINPIGDMNLRNGLFQRLYNALHREIASSKIGGTPVTYSDWIIGYHRESNW*
Ga0102810_105830733300009002EstuarineVPRSVEFPEGIDPIGDMNLREGLFQRLYNNPHNELKSANQKSYPSTYADWIIGYHRESNFQYEHRDM*
Ga0102810_127217013300009002EstuarineMEGIEHNWAHRYGQLPRSVNFAEGINPIGDMDLKNGLFQRLYNALHREIASANIGATPVTYADWIIGYHREANWQYEHRDM*
Ga0102814_1015467033300009079EstuarineMEGIEHEWAHRYGQMPRSVNFPEGINPIGDMDLKNGLFQRLYNNLGREIASANMKATPVTYADWIIGYHRESNLQYEHRDM*
Ga0114995_1017449913300009172MarineMEGIEHEWAARYGQMPRSVHFPEGINPIGDFDMREGLFTSMYNALHREIASANSGGAPATYADWIIGYHRESNWQYEHRDM*
Ga0103872_100703313300009263Surface Ocean WaterMEGIEHNWAHRYGQLPRSVSFPEGIDVIGDMDLRDGLFQRLYNSLHREIASANAKGTPVTYADWIIGYHREANWQYEHRDM*
Ga0103876_106807523300009269Surface Ocean WaterMEGIEHHWAHRYGQVPRSVEIAEDINPIGDMNLREGLFQRLYNNLHREIASKNSKAYPSTYADWIIGYHRESNWQYEHRDM*
Ga0115005_1032482613300009432MarineMEGVEHNWAARYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLGREIASANVKSAPSTYADWIIGYHRESNFQYEHRDM*
Ga0115545_107330613300009433Pelagic MarineMHMEGIEHHWAARYGQVPRSVEFPEGINPIGDMNLREGLFNRLYNNLHRHIAGGHSGQKPSTYADWIIGYHRESNWQYEHRDM*
Ga0115562_110809633300009434Pelagic MarineMEGVEHNWATRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLGREIASANVKSAPSTYADWIIGYHRESNFQYEHRDM*
Ga0115008_1024785243300009436MarineMHMEGIEHHWAARFGQVPRSVEFPDGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWIIGYHRESNWQYEHRDM*
Ga0115571_108741313300009495Pelagic MarineMEGIEHEWAARYGQLPRSVHFPEGINPIGDFDMREGLFTSMYNALHREIASANSRAAPSTYADWIIGYHRESNWQYEHRDM*
Ga0115571_138894413300009495Pelagic MarineMEGIEHNWAHRYGQMPRSVAFPEGINPIGDMDLKDGLFQRLYNSLHREIASANTRGTPVTYADWIIGYHREANWQYEHRDM*
Ga0115103_182002143300009599MarineMEGVEHNWATRYGQLPRSIHFPEGINPIGDMDLRDGLFQRLYNNLGREIASANVKSAPSTYADWIIGYHRESNFQYEHRDM*
Ga0115102_1057273033300009606MarineMEGIEHNWAHRYGQMPRSVAFPEGINPIGDMDLKDGLFQRLYNSLHREIASANTRGTPVTYADWIIGYHREA
Ga0115102_1078886213300009606MarineMHMEGIEHHWAARYGQVPRSVEFTDINPIGDMNLREGLFNRLYNNLHRHIAGGHSGQKPSTYADWIIGYHRESNWQYE
Ga0136551_109917923300010388Pond Fresh WaterLEGIEHHWCNRYGQIPRSVNFPEGINPIGDMNLRDGLFQRLYNSLHREIASSYTKGAPSTYADWIIGYHRESNWQYEH
Ga0133547_1129766913300010883MarineMEGIEHEWAHSYGQLPRSIHFPEGINPIGDMNLRDGLFQRLYNNLHREISSANTRGAPATYADWIIGYHRESNW*
Ga0138265_138301233300012408Polar MarineMEGVEHNWAARYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYHRESNFQYEHRDM*
Ga0138264_129782513300012414Polar MarineMHMEGIEHHWAARFGQVPLSLEFPEGINPIGDMNLKEGLFNRLYNLHRHMAGGHSGQKPSTYADWIIGYHRESNWQYEHRDM*
Ga0163111_1208354313300012954Surface SeawaterMEGIEHNWAHRYGQMPRSVAFPEGINPIGDMDLKDGLFQRLYNALHREIASANTRGTPVTYADWIIGYHREANWQYEHRDM*
Ga0129335_106456633300012962AqueousMEGIEHNWAHHYGQLPRSVQFPDGINPIGDMDLKDGLFQRLYNALHREIASANSRSTPSTYADWIIGYHREANWQYEHRDM*
Ga0129335_118158123300012962AqueousMEGIEHLWCNRYGQLPRSVEFPEGINPIGDMNLREGLFSRYYNALHREIASKNSKTYPVTYADWIVGYHREANWQYEHRDM*
Ga0129338_104897413300012970AqueousMEGIEHEWAARYGQLPRSVNFPEGINPIGDMDLQNGLFQRLYNALHREIASSNIKGTPVTYADWIIGYHRESNWQYEHRDM*
Ga0181379_119933123300017783SeawaterMEGIEHEWAHRYGQMPRSINFPEGINPIGDMDLRNGLFQRMYNALHREIASANARAAPSTYADWVIGYHRESNWQYEHRDM
Ga0181571_1019602333300017957Salt MarshLVNQWHMEGIEHNWAHRYGQLPRSVAFPDGIDVIGDMDLRNGLFQRLYNALHREIGSANAKGTPVTYADWIIGYHREANWQYEHRDM
Ga0181563_1019268513300018420Salt MarshMEGIEHQWCARYGQVPRSCEEFSDGINPIGDMNLRVGLFERYYNILHREIASKNTKGTPATYADWIIGYHRESNWQYEHRDM
Ga0181566_1024547833300018426Salt MarshLVNQWHMEGIEHNWAHRYGQLPRSVAFPEGIDVIGDMDLRNGLFQRLYNALHREIGSANAKGTPVTYADWIIGYHREANWQYEHRDM
Ga0193355_102812013300018628MarineMEGIEHHWCHRYGQLPRSVEFAEGINPIGDMNLRDGLFQRLWNIHGREVASSKQSAPPSTYADWIIGYHRESNFQYEHRDMXSICIYKYSQLFK
Ga0192983_100676643300018684MarineMEGIEHHWAHRYGQVPRSVEFENINPIGDMNLREGLFQRLYNNLHRHMAAGHSGQKPSTYADWIIGYHRESNW
Ga0192983_101028213300018684MarineMHMEGIEHHWAARYGQVPRSVEFPEGINPIGDMNLKEGLFNRLYNDLHRHMAGGHSGQKPSTYADWIIGYHRESNWQYEHRDM
Ga0192974_101936143300018739MarineMEGIEHHWAHRYGQVPRSVNDFGEINPIGDMNLREGLFNRLYNNLGREIGSMNSKAGTPSTYADWIIGYHRESNFQYEHRDM
Ga0193181_104482313300018766MarineMEGIEHEWAHRYGQMPRSVHFPEGVDPIGDMDLRDGLFQRLYNNLHREIASANTKAAPATYADWIIGYHREANWQYEHRDM
Ga0192978_107917713300018871MarineMEGVEHNWAARYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYHRESNFQYEHRDMXLM
Ga0192961_1004651313300018980MarineMEGIEHNWAHRYGQLPRSVHFPDGVDPIGDMDLKNGLFQRMYNALHREINSSNSKGAPSTYADWIIGYHRESNWQYEHRDM
Ga0192961_1004929013300018980MarineMEGVEHNWAARYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYHRESNFQYEHRDMXLMG
Ga0192961_1019578213300018980MarineMEGIEHNWAHRYGQMPRSVAFPEGVNPIGDMDLKDGLFQRLYNALHREIASANTRGTPVTYADWIIGYHREANWQYEHRDM
Ga0192947_1006815823300018982MarineMEGIEHEWAHRYGQLPRSIHFPEGINPIGDMDLRNGLFQRLYNALHREIKSEKIGGTPVTYSDWIIGYHREANFQYEHRDM
Ga0192947_1009515413300018982MarineMEGIEHEWAHSYGQLPRSVHFNDINPIGDMNLRDGLFQRLYNSLHREINSANSKGEPSTYADWIIGYHRESNF
Ga0192982_1012982933300019021MarineMEGIEHEWSHRYGQLPRSVNFPEGVDPIGDMDLRDGLFQRLYNNLHREIASANTKAAPATYADWIIGYHREANWQYEHRDM
Ga0192869_1031185313300019032MarineMEGIEHNWAARYGQLPRSLITDQPINPIGDFDLRDGLFERLYNNLHREIASANTKGAPATYADWIIGYHRESNW
Ga0192945_1026821923300019036MarineMEGIEHNWAQRYGQVPRSIHFQDINPIGDMDMRDGLFQRMYNQLHRQINSANTKGAPSTYADWVIGYHRESNWQYEHRDM
Ga0192981_1018044323300019048MarineMEGVEHNWATRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYHRESNFQYEHRDM
Ga0192966_1010556913300019050MarineMHMEGIEHHWAARFGQVPRSVEFPEGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWIIGYHRESNWQYEHRDMX
Ga0192966_1026088113300019050MarineMEGIEHEWAFRYGQLPRSVHFEGINPIGDFDMRDGLFQRMYNALHREISSSNAGGTPSTYSDWIIGYHRESNWQYEHRDM
Ga0192966_1033087113300019050MarineMEGIEHEWCFRYGQLPRSIHFPEGINPIGDFDMRDGLFQRMYNALHREIASSNVGGAPATYSDWIIGYHRESNWQYEHRDM
Ga0192946_101181533300019103MarineMEGIEHEWAFRYGQLPRSVHFEGINPIGDFDMRDGLFQRMYNALHREISSSNAGGTPATYADWIIGYHRESNWQYEHRDM
Ga0193054_107612913300019117MarineMEGIEHHWCHRYGQIPRNVIFPEGINPIGDMNLREGLFERQYNILHRKIVCSKSKAEPTTLTDWITGYHREADWHYHHRNL
Ga0192980_101988913300019123MarineMEGVEHNWAARYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYHRESNFQYEHRDM
Ga0192980_105506413300019123MarineMEGIEHHWAARYGQVPRSVEFPEGINPIGDMNLKEGLFNRLYNDLHRHMAGGHSGQKPSTYADWIIGYHRESNWQYEHRDM
Ga0192980_106661333300019123MarineMEGIEHHWCHRYGQLPRSCEFPEGINPIGDMNLREGLFNRLWNAHGRQAASSKSVAQPSTYSDWIIGYHRESNFQYEHRDM
Ga0192980_107790113300019123MarineMEGVEHNWAARYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYHRESNFQYEHRDMXLMGEKQSYLNKLFISK
Ga0193249_104002713300019131MarineMEGIEHNWAHHYGQMPRSVDFPEGINPIGDMDLRDGLFQRLYNSLHREIASANSKGAPSTYADWIIGYHRESNWQYEHRDM
Ga0194131_1044482213300020193Freshwater LakeLPRSVEFPEGINPIGDMNLREGLFQRLYNNLRREIASANKKSYPSTYADWIIGYHRESNFQYEHRDM
Ga0206687_136460713300021169SeawaterMEGVEHNWAARYGQLPRSVHFPDGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYHRESNFQYEHRDM
Ga0206688_1059136113300021345SeawaterMEGIEHEWAHSYGQLPRSIHFPEGINPIGDMDLRNGLFQRFYNNLHREISSANTRGALATYADWIIGYHRESN
Ga0206123_1010438013300021365SeawaterMEGVEHEWAHRYGQLPRSVNFTEGINPIGDMDLRDGLFQRLYNSLHREISSANVKSAPSTYADWIIGYHRESNWQYEHRDM
Ga0063105_106029113300021887MarineMEGVEHNWAARYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGY
Ga0063104_102945543300021913MarineMHMEGIEHHWAARFGQVPRSVEFPEGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWIIGYHRESNWQYEHRD
Ga0063104_107153123300021913MarineMEGVEHNWATRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYH
Ga0063869_103486533300021922MarineMHMEGIEHHWAARFGQVPRSVEFPDGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWII
Ga0063103_105577323300021927MarineMEGLEHAWAARFGQVPRSVEFPEGINPIGDMNLRDGLFQRMYNNMHRHIAAAHSGQKPSTYADWIIGYHRESNWQYEH
Ga0063103_109654323300021927MarineMHMEGIEHHWAARFGQVPRSVEFPEGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWIIGYHRESNWQYEHR
Ga0063102_114154123300021941MarineMHMEGIEHHWAARFGQVPRSVEFPEGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWIIGYHRESNWQYEH
Ga0222713_1064998923300021962Estuarine WaterMEGIEHNWAHRYGQIPRSVAFPDGIDVIGDMDLRDGLFQRLYNALHREIASANVKATPVTYADWIIGYHREANWQYEHRDM
Ga0209193_108822413300025816Pelagic MarineMHMEGIEHHWAARYGQVPRSVEFPEGINPIGDMNLREGLFNRLYNNLHRHIAGGHSGQKPSTYADWIIGYHRESNWQYEHRDM
Ga0208544_1009153243300025887AqueousMEGVEHHWAHRYGQVPRSVEFPEGINPIGDMDLREGLFGRLYNNVQREIASANAKAGTPSTYADWIIGYHRESNFQYEHRDM
Ga0208020_109412513300027159EstuarineMEGIEHNWAHRYGQLPRSVNFAEGINPIGDMDLKNGLFQRLYNALHREIASANIGATPVTYADWIIGYHREANWQYEHRDM
Ga0209710_124463213300027687MarineMEGIEHEWAARYGQMPRSVHFPEGINPIGDFDMREGLFTSMYNALHREIASANSGGAPATYADWIIGYHRESNWQYEHRDM
Ga0209812_1034807413300027786Wastewater EffluentVVNQWHLEGIEHHWAHRYGQLPRSVIFKDGINPIGDMNLREGLFQRLYNYVHREIASANSRATPSTYGDWIIGYHRESNWQYEHRDM
Ga0209092_1016017443300027833MarineMHMEGIEHHWAARFGQVPRSVEFPDGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWIIGYHRESNWQYEHRDM
Ga0209712_1015945343300027849MarineMHMEGIEHHWAARFGQVPRSVEFPEGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWIIGYHRESNWQYEHRDM
Ga0209713_1044613513300027883MarineAHRYGQMPRSVAFPEGINPIGDMDLKDGLFQRLYNSLHREIASANTRGTPVTYADWIIGYHREANWQYEHRDM
Ga0209668_1014061413300027899Freshwater Lake SedimentMEGIEHHWAHRYGQIPRSVQFTEGVNPIGDMDLRDGLFQRLYNSLHREISSANAKATPSTYADWIIGYHRESNWQYEHRDM
Ga0209702_1029678413300027976FreshwaterMEGIEHNWAHRYGQIPRSVQFPEGINPIGDMDLRDGLFQRLYNALNREIVSANVKATPSTYSDWIIGYHRESNFQYEHRDM
Ga0256412_109153713300028137SeawaterMEGIEHEWAHRYGQVPRSVQFPDGINPIGDFDLKDGLFQRMYNALHREIASANTGGTPSTYADWIIGYHRESNWQYEHRDM
Ga0302215_1023155523300028864FenCHSYGQAPRSVVFPEGINPIGDLNLREGLFQRLYNYVNREIASANTRTTPSTYADWIIGYHRESNLQYEHRDM
Ga0307398_1070804513300030699MarineMEGIEHEWAFRYGQLPRSVHFEGINPIGDFDMRDGLFQRMYNALHREISSSNAGGTPATYSDWIIGYHRESNWQYEH
Ga0307400_1021910013300030709MarineMEGIEHEWCFRYGQLPRSIHFPEGINPIGDFDMRDGLFQRMYNALHREIASSNVGGAPATYSDWIIGYHRESNWQYEHRDMXSCFQKLLFKNL
Ga0073977_165791013300030948MarineVNQWHLEGIEHHWCHRYGQLPRSVEFPEGINPIGDMNLRDGLNERLWNMHKRQVSCSNQSAPPSTYADWIIGYHRESNFQYEHRDM
Ga0073974_172953213300031005MarineLEGIEHHWCHRYGQLPRSVEFSEGINPIGDMNLREGLFQRLWNAHKREVSSSRQQAPPSTYADWIIGYHRESNFQYEHRDM
Ga0073973_167161913300031006MarineVNQWHLEGIEHHWCHRYGQLPRSVEFPEGINPIGDMNLRDGLNERLWNMHKRQVSCSNQSAPPSTYADWIIGYHRE
Ga0170824_12303811133300031231Forest SoilMEGIEHYWCFRYGQLPRSMPFTEAINPIGDMNLRQGLFERLYNQLHRELASANSRSTPCTYADWIIGYHREANWQYEHRDM
Ga0307489_1024982323300031569Sackhole BrineMEGIEHMWAHRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNSLHREIAASNIGATPATHADWILGYHREANFQYEHRDMXLNDKYLNLINELFI
Ga0307489_1036768413300031569Sackhole BrineMEGIEHNWAHRYGQLPRSVAFPEGIDVIGDMDLRNGLFQRMYNALHREISSSNAKATPVTYADWIIGYHREANWQYEHRDM
Ga0302125_1005473813300031638MarineMEGIEHNWAHRYGQLPRSVHFPDGVDPIGDMDLKNGLFQRMYNALHREINSSNSKGAPSTYADWIIGYHREANWQYEHRDM
Ga0307386_1010936713300031710MarineMEGVEHNWAARYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYHRESNFQYEHRDMXLMGKTKSLFKQNKFISKKK
Ga0307381_1037306213300031725MarineMEGIEHHWCYRYGQLPRSVEFPDGINPIGDMNLRDGLFQRLYNNLHREMASAHSKSYPSTYADWIIGYHRESNWQYEHRDM
Ga0307391_1016200413300031729MarineMEGIEHEWCFRYGQLPRSIHFPEGINPIGDFDMRDGLFQRMYNALHREIASSNVGGAPATYSDWIIGYHRESNWQYE
Ga0307391_1018135813300031729MarineMHMEGIEHHWAARFGQVPRSVEFPEGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWIIGYHRE
Ga0307391_1072135613300031729MarineMEGIEHEWAFRYGQLPRSVHFEGINPIGDFDMRDGLFQRMYNALHREISSSNAGGTPSTYSDWIIGYHRESNWQYEHRDMXSCFKKLYLKIL
Ga0307397_1010093743300031734MarineMEGIEHNWANRYGQMPRSVAFPNGIDPIGDMNLKDGLFQRLYNSLHREIASANTRGTPVTYADWIIGYHREANWQYEHRDM
Ga0307397_1010173813300031734MarineMEGVEHNWAARYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYHRESNFQYEHRDMXLMGKK
Ga0307394_1009721323300031735MarineMEGVEHNWAARYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYH
Ga0307387_1018380813300031737MarineMEGIEHEWCFRYGQLPRSIHFPEGINPIGDFDMRDGLFQRMYNALHREIASSNVGGAPATYSDWIIGYHRESNWQYEHRDMXSCFQKLLFKNP
Ga0307395_1037892713300031742MarineMEGIEHHWAARYGQVPRSVEFPEGINPIGDMNLKEGLFNRLYNDLHRHMAGGHSGQKPSTYADWIIG
Ga0307382_1025612213300031743MarineMEGVEHNWAARYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYHRESNFQY
Ga0307404_1026922913300031752MarineMEGIEHHWAARYGQVPRSVEFPEGINPIGDMNLKEGLFNRLYNDLHIHMAGGHSGQKPSTYADWIIGYHRESNWQYEHRDM
Ga0314675_1013204643300032491SeawaterMEGIEHNWAHRYGQMPRSVAFPEGINPIGDMDLKDGLFQRLYNSLHREIASANTRGTPVTYADWIIGYHREANWQYEHRDM
Ga0314679_1034462513300032492SeawaterMEGVEHNWATRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLGREIASANVKSAPSTYADWIIGYHRESNFQ
Ga0314688_1013105223300032517SeawaterMEGVEHNWATRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLGREIASANVKSAPSTYADWIIGYHRESNFQYEHRDMXSQNKQSLFK
Ga0314689_1015223313300032518SeawaterMEGIEHEWAARYGQMPRSVHFPEGINPIGDFDMREGLFTSMYNALHREIASANSRAAPSTYADWIIGYHRESNWQYEHRDM
Ga0314689_1016061533300032518SeawaterMEGVEHNWATRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLGREIASANVKSAPSTYADWIIGYHRESN
Ga0314676_1081426513300032519SeawaterMHMEGIEHHWAARFGQVPRSVEFPDGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWIIGYH
Ga0314682_1015118033300032540SeawaterMEGVEHNWATRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLGREIASANVKSAPSTYADWIIGYHRESNFQYEHRDMXSQNKQ
Ga0314682_1017742013300032540SeawaterMEGIEHEWAARYGQLPRSVHFPEGINPIGDFDMREGLFTSMYNALHREIASANSRAAPSTYADWIIGYHRESNR
Ga0314671_1014671233300032616SeawaterMEGVEHNWATRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLGREIASANVKSAPSTYADWIIGYHRESNFQYEHRDMXSQNKQSLFKQKFISKK
Ga0314671_1015347313300032616SeawaterMEGIEHEWAARYGQLPRSVHFPEGINPIGDFDMREGLFTSMYNALHREIASANSRAAPSTYADWIIGYHRESNWQYEHRDM
Ga0314671_1053434823300032616SeawaterMEGIEHNWAHRYGQLPRSVHFPDGVDPIGDMDLKNGLFQRMYNALHREINSSNSKGAPSTYADWIIGYHRESNWQYE
Ga0314683_1022114213300032617SeawaterMEGIEHNWAHRYGQMPRSVAFPEGINPIGDMDLKDGLFQRLYNSLHREIASANTRGTPVTYADWIIGYHREANWQYEHR
Ga0314683_1092037923300032617SeawaterMHMEGIEHHWAARFGQVPRSVEFPDGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWIIGYHRESNWQYEHRDMX
Ga0314687_1013709633300032707SeawaterMEGIEHNWAHRYGQLPRSVHFPDGVDPIGDMDLKNGLFQRMYNALHREISSSNSKGAPSTYADWIIGYHRESNWQYEHRDM
Ga0314669_1030068543300032708SeawaterMEGVEHNWATRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLGREIASANVKSAPSTYADWIIGYHRESNFQYEHRDMXSQNK
Ga0314669_1074963123300032708SeawaterMEGIEHEWAARYGQLPRSVHFPEGINPIGDFDMREGLFTSMYNALHREIASANSRAAPSTYADWIIGYHRESN
Ga0314681_1018347043300032711SeawaterMEGVEHNWATRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLGREIASANVKSAPSTYADWIIGYHRESNFQYEHRDM
Ga0314686_1059898933300032714SeawaterMEGIEHNWAHRYGQMPRSVAFPEGINPIGDMDLKDGLFQRLYNSLHREIASANTRGTPVTYADWIIGY
Ga0314695_132087713300032724SeawaterMEGIEHEWAARYGQLPRSVHFPEGINPIGDFDMREGLFTSMYNALHREIASANSRAAPSTYADWIIGYHRESNWQYEHRD
Ga0314698_1011412643300032726SeawaterMEGIEHNWAHRYGQMPRSVAFPEGINPIGDMDLKDGLFQRLYNSLHREIASANTRGTPVTYADWIIGYHREANWQYE
Ga0314710_1031580633300032742SeawaterMHMEGIEHHWAARFGQVPRSVEFPDGINPIGDMNLKEGLFNRLYNDLHRHIAGGHSGQKPSTYSDWIIGYHRESNWQYE
Ga0314712_1020771523300032747SeawaterMEGVEHNWATRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLGREIASANVKSAPSTYADWIIGYHRESNFQYE
Ga0314700_1014828133300032752SeawaterMEGVEHNWATRYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLGREIASANVKSAPSTYADWIIGYHRESNFQYEHRDMXSKNK
Ga0314700_1015694143300032752SeawaterMEGIEHEWAARYGQMPRSVHFPEGINPIGDFDMREGLFTSMYNALHREIASANSRAAPSTYADWIIGYHRESNWQY
Ga0307390_1019570313300033572MarineMEGVEHNWAAIYGQLPRSVHFPEGINPIGDMDLRDGLFQRLYNNLHREIASANVKSAPSTYADWIIGYHRESNFQYE
Ga0307390_1019842413300033572MarineMEGIEHEWCFRYGQLPRSIHFPEGINPIGDFDMRDGLFQRMYNALHREIASSNVGGAPATYSDWIIGYHRESNW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.