Metagenome Family F054529

Basic Information
Family ID	F054529
Family Type	Metagenome
Number of Sequences	139
Average Sequence Length	40 residues
Representative Sequence	VTVLAPVYTDAELDDIEKEVAPLAQDLPAEIEDEIIPPRN
Number of Associated Samples	65
Number of Associated Scaffolds	139

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	2.19 %
% of genes near scaffold ends (potentially truncated)	14.39 %
% of genes from short scaffolds (< 2000 bps)	98.56 %
Associated GOLD sequencing projects	65
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Most Common Taxonomy
Group	Unclassified (100.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.842 % of family members)
Environment Ontology (ENVO)	Unclassified (97.842 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (97.842 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24%
Feature Viewer

Powered by Feature Viewer

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	100.00 %

Scaffold	Taxonomy	Length	IMG/M Link
3300009098\|Ga0105245_11801980	Not Available	665	Open in IMG/M
3300013297\|Ga0157378_11327251	Not Available	761	Open in IMG/M
3300014969\|Ga0157376_13059181	Not Available	506	Open in IMG/M
3300015267\|Ga0182122_1022079	Not Available	697	Open in IMG/M
3300015267\|Ga0182122_1041009	Not Available	590	Open in IMG/M
3300015268\|Ga0182154_1023677	Not Available	687	Open in IMG/M
3300015268\|Ga0182154_1037408	Not Available	610	Open in IMG/M
3300015269\|Ga0182113_1056906	Not Available	593	Open in IMG/M
3300015274\|Ga0182188_1009714	Not Available	808	Open in IMG/M
3300015274\|Ga0182188_1028981	Not Available	615	Open in IMG/M
3300015274\|Ga0182188_1055230	Not Available	520	Open in IMG/M
3300015276\|Ga0182170_1012018	Not Available	843	Open in IMG/M
3300015276\|Ga0182170_1075442	Not Available	506	Open in IMG/M
3300015277\|Ga0182128_1017968	Not Available	761	Open in IMG/M
3300015279\|Ga0182174_1029993	Not Available	683	Open in IMG/M
3300015279\|Ga0182174_1082693	Not Available	508	Open in IMG/M
3300015281\|Ga0182160_1034103	Not Available	650	Open in IMG/M
3300015281\|Ga0182160_1063189	Not Available	547	Open in IMG/M
3300015282\|Ga0182124_1048373	Not Available	588	Open in IMG/M
3300015282\|Ga0182124_1055181	Not Available	566	Open in IMG/M
3300015283\|Ga0182156_1016804	Not Available	807	Open in IMG/M
3300015283\|Ga0182156_1035966	Not Available	654	Open in IMG/M
3300015283\|Ga0182156_1047718	Not Available	604	Open in IMG/M
3300015285\|Ga0182186_1044766	Not Available	604	Open in IMG/M
3300015286\|Ga0182176_1016106	Not Available	852	Open in IMG/M
3300015286\|Ga0182176_1042247	Not Available	629	Open in IMG/M
3300015287\|Ga0182171_1017496	Not Available	794	Open in IMG/M
3300015287\|Ga0182171_1037365	Not Available	647	Open in IMG/M
3300015287\|Ga0182171_1050775	Not Available	594	Open in IMG/M
3300015287\|Ga0182171_1052952	Not Available	587	Open in IMG/M
3300015291\|Ga0182125_1038170	Not Available	657	Open in IMG/M
3300015291\|Ga0182125_1054168	Not Available	595	Open in IMG/M
3300015291\|Ga0182125_1063650	Not Available	567	Open in IMG/M
3300015291\|Ga0182125_1073167	Not Available	544	Open in IMG/M
3300015292\|Ga0182141_1019237	Not Available	792	Open in IMG/M
3300015294\|Ga0182126_1012459	Not Available	899	Open in IMG/M
3300015294\|Ga0182126_1037825	Not Available	662	Open in IMG/M
3300015296\|Ga0182157_1075568	Not Available	554	Open in IMG/M
3300015296\|Ga0182157_1091396	Not Available	522	Open in IMG/M
3300015298\|Ga0182106_1055472	Not Available	608	Open in IMG/M
3300015298\|Ga0182106_1098960	Not Available	508	Open in IMG/M
3300015300\|Ga0182108_1036447	Not Available	695	Open in IMG/M
3300015302\|Ga0182143_1020160	Not Available	812	Open in IMG/M
3300015302\|Ga0182143_1042807	Not Available	658	Open in IMG/M
3300015304\|Ga0182112_1042695	Not Available	660	Open in IMG/M
3300015304\|Ga0182112_1070424	Not Available	570	Open in IMG/M
3300015304\|Ga0182112_1089237	Not Available	530	Open in IMG/M
3300015305\|Ga0182158_1025980	Not Available	755	Open in IMG/M
3300015307\|Ga0182144_1036612	Not Available	696	Open in IMG/M
3300015308\|Ga0182142_1057039	Not Available	625	Open in IMG/M
3300015308\|Ga0182142_1106164	Not Available	516	Open in IMG/M
3300015314\|Ga0182140_1021645	Not Available	826	Open in IMG/M
3300015321\|Ga0182127_1100484	Not Available	539	Open in IMG/M
3300015322\|Ga0182110_1063184	Not Available	622	Open in IMG/M
3300015322\|Ga0182110_1122121	Not Available	505	Open in IMG/M
3300015323\|Ga0182129_1077209	Not Available	570	Open in IMG/M
3300015341\|Ga0182187_1048804	Not Available	824	Open in IMG/M
3300015341\|Ga0182187_1085985	Not Available	680	Open in IMG/M
3300015341\|Ga0182187_1105419	Not Available	634	Open in IMG/M
3300015341\|Ga0182187_1133063	Not Available	584	Open in IMG/M
3300015342\|Ga0182109_1066641	Not Available	786	Open in IMG/M
3300015342\|Ga0182109_1107935	Not Available	661	Open in IMG/M
3300015342\|Ga0182109_1116750	Not Available	642	Open in IMG/M
3300015342\|Ga0182109_1160108	Not Available	571	Open in IMG/M
3300015342\|Ga0182109_1195675	Not Available	529	Open in IMG/M
3300015342\|Ga0182109_1217633	Not Available	507	Open in IMG/M
3300015342\|Ga0182109_1218768	Not Available	506	Open in IMG/M
3300015343\|Ga0182155_1111256	Not Available	651	Open in IMG/M
3300015343\|Ga0182155_1202207	Not Available	523	Open in IMG/M
3300015344\|Ga0182189_1077063	Not Available	752	Open in IMG/M
3300015345\|Ga0182111_1085676	Not Available	749	Open in IMG/M
3300015346\|Ga0182139_1119586	Not Available	663	Open in IMG/M
3300015346\|Ga0182139_1138961	Not Available	627	Open in IMG/M
3300015346\|Ga0182139_1182487	Not Available	565	Open in IMG/M
3300015346\|Ga0182139_1217030	Not Available	527	Open in IMG/M
3300015347\|Ga0182177_1201980	Not Available	545	Open in IMG/M
3300015351\|Ga0182161_1146553	Not Available	640	Open in IMG/M
3300015351\|Ga0182161_1149124	Not Available	635	Open in IMG/M
3300015355\|Ga0182159_1067247	Not Available	1004	Open in IMG/M
3300015355\|Ga0182159_1178754	Not Available	674	Open in IMG/M
3300015355\|Ga0182159_1281810	Not Available	554	Open in IMG/M
3300015355\|Ga0182159_1284872	Not Available	551	Open in IMG/M
3300015355\|Ga0182159_1306953	Not Available	533	Open in IMG/M
3300015355\|Ga0182159_1317967	Not Available	525	Open in IMG/M
3300015361\|Ga0182145_1104666	Not Available	619	Open in IMG/M
3300015361\|Ga0182145_1123928	Not Available	585	Open in IMG/M
3300015361\|Ga0182145_1137785	Not Available	565	Open in IMG/M
3300015361\|Ga0182145_1168468	Not Available	528	Open in IMG/M
3300015361\|Ga0182145_1179078	Not Available	517	Open in IMG/M
3300017404\|Ga0182203_1113678	Not Available	568	Open in IMG/M
3300017404\|Ga0182203_1117531	Not Available	562	Open in IMG/M
3300017407\|Ga0182220_1036043	Not Available	683	Open in IMG/M
3300017407\|Ga0182220_1072282	Not Available	565	Open in IMG/M
3300017407\|Ga0182220_1089422	Not Available	531	Open in IMG/M
3300017407\|Ga0182220_1098360	Not Available	517	Open in IMG/M
3300017409\|Ga0182204_1045819	Not Available	672	Open in IMG/M
3300017409\|Ga0182204_1067184	Not Available	601	Open in IMG/M
3300017409\|Ga0182204_1117534	Not Available	505	Open in IMG/M
3300017410\|Ga0182207_1072732	Not Available	677	Open in IMG/M
3300017410\|Ga0182207_1114338	Not Available	584	Open in IMG/M
3300017410\|Ga0182207_1163043	Not Available	516	Open in IMG/M
3300017411\|Ga0182208_1079925	Not Available	586	Open in IMG/M
3300017413\|Ga0182222_1054103	Not Available	603	Open in IMG/M
3300017415\|Ga0182202_1028869	Not Available	820	Open in IMG/M
3300017415\|Ga0182202_1049129	Not Available	700	Open in IMG/M
3300017415\|Ga0182202_1138213	Not Available	503	Open in IMG/M
3300017417\|Ga0182230_1103970	Not Available	527	Open in IMG/M
3300017420\|Ga0182228_1093627	Not Available	565	Open in IMG/M
3300017424\|Ga0182219_1068225	Not Available	629	Open in IMG/M
3300017424\|Ga0182219_1097968	Not Available	563	Open in IMG/M
3300017425\|Ga0182224_1109226	Not Available	576	Open in IMG/M
3300017425\|Ga0182224_1141209	Not Available	530	Open in IMG/M
3300017427\|Ga0182190_1126202	Not Available	552	Open in IMG/M
3300017430\|Ga0182192_1022335	Not Available	1005	Open in IMG/M
3300017430\|Ga0182192_1148058	Not Available	531	Open in IMG/M
3300017433\|Ga0182206_1097414	Not Available	589	Open in IMG/M
3300017433\|Ga0182206_1126735	Not Available	541	Open in IMG/M
3300017436\|Ga0182209_1101528	Not Available	599	Open in IMG/M
3300017438\|Ga0182191_1052966	Not Available	759	Open in IMG/M
3300017438\|Ga0182191_1071087	Not Available	690	Open in IMG/M
3300017438\|Ga0182191_1111241	Not Available	595	Open in IMG/M
3300017438\|Ga0182191_1138731	Not Available	553	Open in IMG/M
3300017438\|Ga0182191_1158189	Not Available	528	Open in IMG/M
3300017443\|Ga0182193_1079103	Not Available	687	Open in IMG/M
3300017680\|Ga0182233_1099572	Not Available	537	Open in IMG/M
3300017682\|Ga0182229_1054656	Not Available	678	Open in IMG/M
3300017682\|Ga0182229_1104242	Not Available	506	Open in IMG/M
3300017683\|Ga0182218_1064311	Not Available	658	Open in IMG/M
3300017683\|Ga0182218_1075660	Not Available	626	Open in IMG/M
3300017683\|Ga0182218_1122785	Not Available	539	Open in IMG/M
3300017683\|Ga0182218_1141190	Not Available	516	Open in IMG/M
3300017684\|Ga0182225_1035217	Not Available	779	Open in IMG/M
3300017684\|Ga0182225_1074422	Not Available	618	Open in IMG/M
3300017684\|Ga0182225_1085049	Not Available	593	Open in IMG/M
3300017684\|Ga0182225_1141589	Not Available	506	Open in IMG/M
3300017689\|Ga0182231_1062491	Not Available	702	Open in IMG/M
3300017690\|Ga0182223_1103019	Not Available	530	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	97.84%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.16%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	97.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.16%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	97.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.16%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	97.84%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.44%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.72%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0105245_118019801	3300009098	Miscanthus Rhizosphere	MVLAPIYTYAELDDTEKEVAPLAQDLPAEIEDEIIPPRN*
Ga0157378_113272511	3300013297	Miscanthus Rhizosphere	MMVLTPVYTDAELDDIEKEVAPLAHDLPAEIVDEIIPQEIC*
Ga0157376_130591811	3300014969	Miscanthus Rhizosphere	MMVLVPIYTDTELDDIGKEVAPLALDLPTEIKDGIIPPKKLVR*
Ga0182122_10220792	3300015267	Miscanthus Phyllosphere	VTVLTPVYIDAELDDIEKEVAPLAQDLPTEIEDEIIPPRN*
Ga0182122_10410091	3300015267	Miscanthus Phyllosphere	MTVLMSVYTDAELDNIEKEVAPLAHDLPAEIEYEITPQEIS*
Ga0182154_10236771	3300015268	Miscanthus Phyllosphere	VTVLVPIYTDAELDDIEKEVAPLAQDLPAEIEDEIISPRN*
Ga0182154_10374081	3300015268	Miscanthus Phyllosphere	MMVLTLVYTDAELDDIEKEVASLTQDLPTEIEDEITPKKLVR*
Ga0182113_10569061	3300015269	Miscanthus Phyllosphere	MMVLAPVYTDTELDDIDKEVAPLAQDLPAEIEDEIIPPRN*
Ga0182188_10097141	3300015274	Miscanthus Phyllosphere	MTVLAPVYADTELDDIKKEVAPLTLDLPAEIEDEILLPRN*
Ga0182188_10289811	3300015274	Miscanthus Phyllosphere	MVLAPIYTDTELDDIEKEVAPLAQDLPAEIEDEIISPRN*
Ga0182188_10552301	3300015274	Miscanthus Phyllosphere	MTVLTPVYTDTELDDIKKEVAPLAQDLPTEIEDEIIPQEIS*
Ga0182170_10120181	3300015276	Miscanthus Phyllosphere	MMVLVPIYTDAELDNIEKEVAPLAKDLPTEIEDEIIPLRN*
Ga0182170_10754421	3300015276	Miscanthus Phyllosphere	MPVYIDAKLDDIEMEVASLAYDLPAEIEDAIIPPRN*
Ga0182128_10179681	3300015277	Miscanthus Phyllosphere	MVLMPIYTDTELDDIEKEVAPLGYDLHAEIEDEIIPKKLVR*
Ga0182174_10299931	3300015279	Miscanthus Phyllosphere	MMGLAPIYTNAKLDDIEKEVAPLAYDLHAEIEDEIIPQEIS*
Ga0182174_10826931	3300015279	Miscanthus Phyllosphere	VTVLAPIYTDAELDDIKKEVAPLALDLPAEIEDEILLP*
Ga0182160_10341032	3300015281	Miscanthus Phyllosphere	VTVLVPVYTDANLDNIKKEVAPLAQDLPTEIEDEIIPPRN*
Ga0182160_10631891	3300015281	Miscanthus Phyllosphere	MVLAPVYTDAELDDIEKEMAPLAHDLPAKIEDEIIPPRN*
Ga0182124_10483732	3300015282	Miscanthus Phyllosphere	VTVLEPVYTDAELDDIEKEVASLAQDLPAEIEDEIIPPRN*
Ga0182124_10551811	3300015282	Miscanthus Phyllosphere	VTVLALVYTDAELDDIEKEVAPLAHGLPAEIEDEIIPPRN*
Ga0182156_10168042	3300015283	Miscanthus Phyllosphere	MVLAPVYTDAELDDIEKEVDPLAQNLPTEIEDKIIPPRNLLGR*
Ga0182156_10359661	3300015283	Miscanthus Phyllosphere	MILMHVYTDAELNDIKKEVAPLAQDLPTEIEDEIIPLEIS*
Ga0182156_10477182	3300015283	Miscanthus Phyllosphere	MIVRVPVYTDTKLDDIEKEVAPLAQDLPTEIEDEIIP*
Ga0182186_10447661	3300015285	Miscanthus Phyllosphere	VTVLAPVYTDTELDDIEKEVAPLAQDLPIEIEDEIMPPRN*
Ga0182176_10161061	3300015286	Miscanthus Phyllosphere	MVLAPIYTDAELDDIEKEVAPLAQDLPAKIEDEIIASRN*
Ga0182176_10422471	3300015286	Miscanthus Phyllosphere	MMVRTPVYTDAKLDNIEKGVAPLAQDLPISIEDEIIPQEIS*
Ga0182171_10174961	3300015287	Miscanthus Phyllosphere	MMFLVPIYTDAELDDIEKEVGPLAQDLPAEIEDEIIPQEIS*
Ga0182171_10373651	3300015287	Miscanthus Phyllosphere	MTVLVPIYTDAELDDIKKEVAPLAHDLPTEIEDEIIPSRN*
Ga0182171_10507751	3300015287	Miscanthus Phyllosphere	MMVLAPVYTDAQLDNIKKEVAPLAQDLPTEIEDEIIPQEIVR*
Ga0182171_10529521	3300015287	Miscanthus Phyllosphere	MVLTPVYIDADLDDIKKEVALLAQDLPAEIEDEIIPPRN*
Ga0182125_10381701	3300015291	Miscanthus Phyllosphere	VTVLAHIYTNTELDDIEKEVAPLAQGLPTEIEDEIIPPKN*
Ga0182125_10541682	3300015291	Miscanthus Phyllosphere	MPVYTNAELDDIEKEVAPLAQDLPAEIEDEITPKKLVR*
Ga0182125_10636501	3300015291	Miscanthus Phyllosphere	MTVLMHVYTDAELDDIKKEVAPLAHDLPAEIEDENIPQ*
Ga0182125_10731671	3300015291	Miscanthus Phyllosphere	MTVLTPVYTDAELDDIEKEVAPLGQDIPAEIEDEIIPPRN*
Ga0182141_10192372	3300015292	Miscanthus Phyllosphere	MMVLVPVYTDAELNDIKKVVAPLTQDLPVEIEDEIIPPRN*
Ga0182126_10124592	3300015294	Miscanthus Phyllosphere	VTVLVPIYTDAELDDIEKEVAPLAQDLPAEIEDEIILQRN*
Ga0182126_10378251	3300015294	Miscanthus Phyllosphere	MVLMPVYTNAELDDIKKEVAPLAQDLAMEIDDEIILPRN*
Ga0182157_10755681	3300015296	Miscanthus Phyllosphere	MPVCTDAELDDIEKEVAPLAQDLPTEIEDEIIPPRN*
Ga0182157_10913961	3300015296	Miscanthus Phyllosphere	MTVLMPVYTDTELDDIEKEVAPLAQELPTEIEDEIIPPRN*
Ga0182106_10554722	3300015298	Miscanthus Phyllosphere	MMVIASVYTDAELGNIEREVASLAQDLPAEIEDEVTPKKLVR*
Ga0182106_10989602	3300015298	Miscanthus Phyllosphere	LVYTNAELDYIEKEVAPLAHDLSTQIEDEIIPPRG*
Ga0182108_10364471	3300015300	Miscanthus Phyllosphere	MTVVTPVYTNAELDDNEKEVVPLAYDLPTEIEDEIIPPRN*
Ga0182143_10201601	3300015302	Miscanthus Phyllosphere	MMVLTPIYIDTELDDIEKEVAPLAQDLPAEIEDEIIPQEIS*
Ga0182143_10428071	3300015302	Miscanthus Phyllosphere	VTVLAPIYTDAEPDDIEKEVAPLAQDLLVEIDDEIFPPRN*
Ga0182112_10426951	3300015304	Miscanthus Phyllosphere	LTVLVPVYTDTELDDIDKEVAPLAQDLPAEIEDEIIPPRN*
Ga0182112_10704241	3300015304	Miscanthus Phyllosphere	MMVLAPIYTDAELDDIEKEVAPLAQDLLAKIEDEITPKKLVR*
Ga0182112_10892371	3300015304	Miscanthus Phyllosphere	MVLTLVYTNTELDDIEKDVAPLAQDLPTKIEDEIIPLRN*
Ga0182158_10259801	3300015305	Miscanthus Phyllosphere	MPIYTDVELDDIEKEVAPLASDLPIEIEEEIIPQEIS*
Ga0182144_10366122	3300015307	Miscanthus Phyllosphere	VTVLALVYTDAELDDIEKEVAPLAQDLPVEIEDEIIPPRNLFSR*
Ga0182142_10570391	3300015308	Miscanthus Phyllosphere	MVLVPIYTDAELDDIEKEVAPLAQDLPTKIEDEIIPPRN*
Ga0182142_11061642	3300015308	Miscanthus Phyllosphere	MPVYTDAELDNIEKEVAPLAQDLPADIEDEIIPSRN*
Ga0182140_10216451	3300015314	Miscanthus Phyllosphere	MMFLVPIYTDAELDDIEKEVGPLAQDLPAEIEDEIIPPRN*
Ga0182127_11004841	3300015321	Miscanthus Phyllosphere	VTVLAPVYTDAELDDIEKEVAPLAQDLPVEIEDEIIPREIS*
Ga0182110_10631841	3300015322	Miscanthus Phyllosphere	MIVLTAFYIDVELDGMEKEVAPLAQDLPTEIEDEITPPRN*
Ga0182110_11221211	3300015322	Miscanthus Phyllosphere	MILVPVYTDAELNDIKKVVAPLTQDLPVEIEDEIIPPRN*
Ga0182129_10772091	3300015323	Miscanthus Phyllosphere	VTVLAIVYTDAELDDIEKEMAPLPEDLPTKIEYEIMPPRNLLGR*
Ga0182187_10488042	3300015341	Miscanthus Phyllosphere	MTVLALVHTDVELDDIKKEVALLAQDLPAEIEDEIIPPRN*
Ga0182187_10859851	3300015341	Miscanthus Phyllosphere	VTVLAPVYTDAELDDIEKEVAPLAQDLPAEIEDEIIPPRN*
Ga0182187_11054191	3300015341	Miscanthus Phyllosphere	MIVLTAFYIYVELDDNEKEVVPLAYDLPTEIEDEIIPPRN*
Ga0182187_11330631	3300015341	Miscanthus Phyllosphere	MVLVTVYIATELDDIEKEVAPLAQDLPAKIEDVVIPQEI
Ga0182109_10666411	3300015342	Miscanthus Phyllosphere	MVLTLVYTNTELDDIEKEVAPLAQDLPVKIEDEIIPSRNLLGR*
Ga0182109_11079352	3300015342	Miscanthus Phyllosphere	MVLTPVYIDVELDDIEKEVAPLAQDLPAKIEDEIIPPKKLVR*
Ga0182109_11167501	3300015342	Miscanthus Phyllosphere	MTVLTPVYIDVELDNIKKEVAPLALDLPAKIEDEIIPQEIS*
Ga0182109_11601082	3300015342	Miscanthus Phyllosphere	VTVLAPVYTDAKLDDIEKEVTPLAQDLPIEIEDEITPRNLLGR*
Ga0182109_11956751	3300015342	Miscanthus Phyllosphere	MVLAPIYTNAELDNIEKEVAPLAQDQSAKIEDEIIPSKN*
Ga0182109_12176332	3300015342	Miscanthus Phyllosphere	MVLAPIYANTELDDIEKEVAPLAHDLPAEIEDEIIP
Ga0182109_12187681	3300015342	Miscanthus Phyllosphere	PSLPMTVLVPIYTDTELDDIKKEVAPLAQDLPTKIEDEITPKKLVR*
Ga0182155_11112561	3300015343	Miscanthus Phyllosphere	MMVFMPVYTDAKLDDIEKEVAPLAQDLPTDIEDEITPKKLVR*
Ga0182155_11945501	3300015343	Miscanthus Phyllosphere	FTPVYTDIELEDITKEVVPLAHDLSAKIEDEIIPSWG*
Ga0182155_12022071	3300015343	Miscanthus Phyllosphere	MVLAPVYTDAKLDDIEKEVAPLAQNLPTEIEDEITPKNLVR*
Ga0182189_10770631	3300015344	Miscanthus Phyllosphere	VTVLVPVYTDTELDDIKKEVAPLAQDLPAEIEDEIIPLRN*
Ga0182111_10856761	3300015345	Miscanthus Phyllosphere	MMVLTPVYTKVELDDIEKEMAPLPEDLPTKIEYEIMPPRNLLGR*
Ga0182139_11195861	3300015346	Miscanthus Phyllosphere	PIYTDAELDNIEKEVAPLVHDLSTEIEDEIIPLWC*
Ga0182139_11389611	3300015346	Miscanthus Phyllosphere	VIVLAPVYTDAELDDIEKEVAPLAQDLPAEIEDEITPKKLVR*
Ga0182139_11824871	3300015346	Miscanthus Phyllosphere	VTVLAPVYTDAELDDIEKEAVPLAQDLPIEIEDEIIPQEIS*
Ga0182139_12170302	3300015346	Miscanthus Phyllosphere	MVLAPIYANTELDDIEKEVAPLAHDLPAEIEDEIIPQEIS*
Ga0182177_12019801	3300015347	Miscanthus Phyllosphere	MVLAPVYTDAELDDIEREVAPLAQDLPTEIEDEITPKKIC*
Ga0182161_11465532	3300015351	Miscanthus Phyllosphere	MTVLVPVYTDAKLDDIEKEVAPLAHDLPVEIEDDIIPPR
Ga0182161_11491241	3300015351	Miscanthus Phyllosphere	MMVLAPIYTDAELDNIEKEVVPLAQDLPAEIEDEIIPQEIS*
Ga0182159_10672471	3300015355	Miscanthus Phyllosphere	MVLMPVYTDAELDDIKKEVAPLVRDLPMEIEDEIIP*
Ga0182159_11787541	3300015355	Miscanthus Phyllosphere	MVLALVYTDAELDDIEKEVAPLAQDLPTKIEDEIIPQ*
Ga0182159_12818101	3300015355	Miscanthus Phyllosphere	MVLAPVYTDIKLDNIEKEVAPLAQDLPTKIEDEIIP
Ga0182159_12848721	3300015355	Miscanthus Phyllosphere	MVLTPVYTDAERDNNKTEVAPQAQDLPIEIEDEIIPQEIS*
Ga0182159_13069531	3300015355	Miscanthus Phyllosphere	MIVFAPIYTDTELDDIEKEVAPLAQDLPTEIEDEIIPPKKLVR*
Ga0182159_13179671	3300015355	Miscanthus Phyllosphere	MMVLALIYTDAKLDDIDKEVAPLAQDLPAEIEDEIIPK
Ga0182145_11046661	3300015361	Miscanthus Phyllosphere	MMVLMPIYIDTELDNIEKEWPPLAQDLLAEIEDEIIPPRN*
Ga0182145_11239282	3300015361	Miscanthus Phyllosphere	VTVLALVYTDTELDDIKKKVAPLAQDLPAEIEDEIIPPKKLVS*
Ga0182145_11377851	3300015361	Miscanthus Phyllosphere	MVLTLVYTNTELDDIEKEVAPLAHDLPAEIEDEITP*
Ga0182145_11684681	3300015361	Miscanthus Phyllosphere	VTVLAPVCTDAELDDIEKEMTHLAQDLPAEIEDEIIP
Ga0182145_11790781	3300015361	Miscanthus Phyllosphere	MMVLMSIYTDTELDDIEKEVAPLAQDLPTKIEDEIIPPRN*
Ga0182203_11136781	3300017404	Miscanthus Phyllosphere	MVLTPVYIDVELDDIEKEVAPLAQDLLVEIEDEIIPLRN
Ga0182203_11175312	3300017404	Miscanthus Phyllosphere	MVLAPIYTDAELDDIEKEVAPLAQDLPAEIEDEIIPQEIS
Ga0182220_10360431	3300017407	Miscanthus Phyllosphere	VFQLRIPPYLMTVLMPVYTDTELDDVEKEVAPLAQDLPMEIEDKIIPPKN
Ga0182220_10722821	3300017407	Miscanthus Phyllosphere	VTVLAPVYTDAKLDDIEKEVTPLAQDLPIEIEDEITPKKLVR
Ga0182220_10894221	3300017407	Miscanthus Phyllosphere	VTVLTPVYTDTELDDIEKEVAPLAQDLPTKIEDEITPQKLVR
Ga0182220_10983601	3300017407	Miscanthus Phyllosphere	MMVLTPVYTNAKLDNIKKEEAPLAHDLPIEIEDEIIL
Ga0182204_10458191	3300017409	Miscanthus Phyllosphere	VIVLAPVYTDAQLDNIEKEVVPLEQDLPAEIEDEITPKKLVRQIS
Ga0182204_10671841	3300017409	Miscanthus Phyllosphere	MMVLVSVHSNGELDNIKKEVAPLAQDLSAEIEDVIITTRN
Ga0182204_11175342	3300017409	Miscanthus Phyllosphere	MTVFMPVYIDAEPDDIKKEVAPLAQDLPTEIEDGIIPPRN
Ga0182207_10727321	3300017410	Miscanthus Phyllosphere	MMVLTLVYTDAELDDIEKEVASLTQDLPTEIEDEITPK
Ga0182207_11143381	3300017410	Miscanthus Phyllosphere	QGFAPIYTDAELDNIEKKVAPLVHDCSAKIEDEIIPPKN
Ga0182207_11630431	3300017410	Miscanthus Phyllosphere	MMVLTPVYTNAKLDNIKKEEAPLAHDLPIEIEDEIILAKN
Ga0182208_10799251	3300017411	Miscanthus Phyllosphere	PNIPMTVVAPVYTDVELDNIEKDVVPLSQDLPAEIEDEITPRKLVR
Ga0182222_10541031	3300017413	Miscanthus Phyllosphere	MVLAPIYTDAELDDIEKEVAPLAQDLPTKIEDEITPKKFVR
Ga0182202_10288691	3300017415	Miscanthus Phyllosphere	MTVLVPVYTDAELDDIEKEVAHDLPTEIEDKIILEEIC
Ga0182202_10491291	3300017415	Miscanthus Phyllosphere	VTVLMHVYIDAELDDIEKEVAPLAQDLPMEIEDEITPKKLVR
Ga0182202_11382131	3300017415	Miscanthus Phyllosphere	MYPSLHVMVLAPVYTDAELDDIEKEVAPLAWDLPAEIEDEIIPQEIS
Ga0182230_11039701	3300017417	Miscanthus Phyllosphere	MTVLVSIYTDAELDDIEKEVAPLAHDLSAKIEDEITPPEKLVS
Ga0182228_10936271	3300017420	Miscanthus Phyllosphere	FAHVYTDAELDNIEKEVGPLMHDLYANIEDGIIPPRG
Ga0182219_10682252	3300017424	Miscanthus Phyllosphere	VTVLAPIHTDTELDDIEKEVVPLEQDLPAEIEDEITPKKLVRQIS
Ga0182219_10979681	3300017424	Miscanthus Phyllosphere	MMVLAPVYTDAELDDIEKEVASLAQDLPAEIEDEIIPPRN
Ga0182224_11092262	3300017425	Miscanthus Phyllosphere	VTVLALVYTDAELDNIKKEVAPLAQDLPIEIEDEIMP
Ga0182224_11412091	3300017425	Miscanthus Phyllosphere	VTVLAPIYIDTELDDIEKEVAPLAQDLPMDIEDEIIP
Ga0182190_11262021	3300017427	Miscanthus Phyllosphere	MVLVPVYTDAKLDDIEKEVAPLAQDLPAKIEDEITP
Ga0182192_10223351	3300017430	Miscanthus Phyllosphere	MIVLASIYTDAELDNIEKEVTPLAQDLPAKIEDEIIPQEIS
Ga0182192_11480581	3300017430	Miscanthus Phyllosphere	MTVFMPVYIDAELDDIEKEVAPLAQDLPTEIEDEIIPQEIS
Ga0182206_10974141	3300017433	Miscanthus Phyllosphere	VTVLVPVYTDAKLDDIEKEVAPLAQDLPVEIEDEITPQEIS
Ga0182206_11267351	3300017433	Miscanthus Phyllosphere	VTVLAPVYTDAKLDDIEKEVAPLAWDLPAEIEDEIIPKEIS
Ga0182209_11015282	3300017436	Miscanthus Phyllosphere	MMVLAPVYTKAELDNIKKDVAPLAHDLPTEIEDEIVHPRI
Ga0182191_10529661	3300017438	Miscanthus Phyllosphere	MVLTPVYTNTEMDDIEKEVAPLAQDLPAEIEDEMIPQEIN
Ga0182191_10710872	3300017438	Miscanthus Phyllosphere	MVLTPVYTDAERDNNKTEVAPQAQDLPIEIEDEIIPQEIS
Ga0182191_11112411	3300017438	Miscanthus Phyllosphere	MVLAPVYTDAKLDDIEKEVAPLAQDLPAEIEDEITPKKLVR
Ga0182191_11387312	3300017438	Miscanthus Phyllosphere	MTVLTHIYTDAELDDIKKEVAPLAQDLPVEIEDEIVPPRT
Ga0182191_11581892	3300017438	Miscanthus Phyllosphere	MMVLAPIYTDAELDDIEKEVAPLAQDLPAEIEDEINPPQEIS
Ga0182221_10524131	3300017442	Miscanthus Phyllosphere	VTVLAPVYTGAELDDIEKEVAPLAQDLPAKIEDQIIPKKLVRSISQATNL
Ga0182193_10791031	3300017443	Miscanthus Phyllosphere	VTVLAPIYTDAELDDIEKEVAPLAQDLPMKIEDEIIPQEIS
Ga0182233_10995721	3300017680	Miscanthus Phyllosphere	VPVYTDTELDNIEKEVAPLAQDLPAEIEDEIIPQEIS
Ga0182229_10546561	3300017682	Miscanthus Phyllosphere	MMVLAPIYTNTKLDDIKKEVAHLAQDLPMEIEVEIIPLRN
Ga0182229_11042421	3300017682	Miscanthus Phyllosphere	QDLSAMILVLVYTDAELDDIEREVAPLAQDLPAKIEDEIIASRN
Ga0182218_10643111	3300017683	Miscanthus Phyllosphere	MTVLAPVYTDAELDDIEKETAPWAQDLPIEIEEEIVLPRN
Ga0182218_10756601	3300017683	Miscanthus Phyllosphere	VTVLAPVYTDAELDDIEKEVAPLAQDLPAEIEDEIIPPKKLVR
Ga0182218_11227851	3300017683	Miscanthus Phyllosphere	VIVLAPIYTDAELDDMEKEVAPLAQDLPIEIEDEIIPPTN
Ga0182218_11411902	3300017683	Miscanthus Phyllosphere	VTVLVPVYTDAELDDIEKEVASLAQDLPAEIEDEIIPPRN
Ga0182225_10352171	3300017684	Miscanthus Phyllosphere	MTVLVPVYTNAELDDIEKEVAPLAQDLPTEIEDGIIPPRILLGR
Ga0182225_10744221	3300017684	Miscanthus Phyllosphere	MTVLAPIYTNAELDDIKKEVAPLVQDLPMEIEDEIIPQEIS
Ga0182225_10850492	3300017684	Miscanthus Phyllosphere	VTVLTPVYTDAELDDIKKQVAPVAHDLPIEIEDEIILPRN
Ga0182225_11415892	3300017684	Miscanthus Phyllosphere	MMVLAPIYTDTKLDDIEKEMAPLTQDLPTEIEDEIIPQEIS
Ga0182231_10624911	3300017689	Miscanthus Phyllosphere	MMVLTPIYTDAELDNIEKEVAPVAHDLPAEIEYVIIPLRN
Ga0182223_11030191	3300017690	Miscanthus Phyllosphere	MVLASVYTDAELDDIEKEVSPLSQDLPTEMEDEITPKKLVR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F054529

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign