Basic Information | |
---|---|
Family ID | F054613 |
Family Type | Metagenome |
Number of Sequences | 139 |
Average Sequence Length | 42 residues |
Representative Sequence | MNHTERPCAAHGWTSYRYAGRYGSIMIGATSTQDALNEADRSL |
Number of Associated Samples | 69 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 76.98 % |
% of genes near scaffold ends (potentially truncated) | 96.40 % |
% of genes from short scaffolds (< 2000 bps) | 96.40 % |
Associated GOLD sequencing projects | 64 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (47.482 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water (74.820 % of family members) |
Environment Ontology (ENVO) | Unclassified (74.820 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (68.345 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.93% β-sheet: 16.28% Coil/Unstructured: 62.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF00805 | Pentapeptide | 1.45 |
PF01381 | HTH_3 | 0.72 |
PF04851 | ResIII | 0.72 |
PF02599 | CsrA | 0.72 |
PF10686 | YAcAr | 0.72 |
PF04519 | Bactofilin | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 1.45 |
COG1551 | sRNA-binding carbon storage regulator CsrA | Signal transduction mechanisms [T] | 0.72 |
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 52.52 % |
Unclassified | root | N/A | 47.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001097|JGIcombinedJ13537_10086075 | Not Available | 710 | Open in IMG/M |
3300007074|Ga0075110_1065229 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 822 | Open in IMG/M |
3300007516|Ga0105050_10596706 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 644 | Open in IMG/M |
3300011185|Ga0136597_1049927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 833 | Open in IMG/M |
3300011187|Ga0136596_1103492 | Not Available | 554 | Open in IMG/M |
3300011189|Ga0136558_1073049 | Not Available | 888 | Open in IMG/M |
3300011189|Ga0136558_1154176 | Not Available | 536 | Open in IMG/M |
3300011189|Ga0136558_1155722 | Not Available | 533 | Open in IMG/M |
3300011189|Ga0136558_1170662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter → Sulfitobacter pseudonitzschiae | 503 | Open in IMG/M |
3300012029|Ga0136572_1006327 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2318 | Open in IMG/M |
3300012031|Ga0136561_1046400 | Not Available | 664 | Open in IMG/M |
3300012033|Ga0136589_1097391 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 707 | Open in IMG/M |
3300012036|Ga0136600_1119811 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300012036|Ga0136600_1119811 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300012128|Ga0136582_1050759 | Not Available | 500 | Open in IMG/M |
3300012178|Ga0136557_1111132 | Not Available | 624 | Open in IMG/M |
3300012182|Ga0136556_1154053 | Not Available | 557 | Open in IMG/M |
3300012182|Ga0136556_1177980 | Not Available | 507 | Open in IMG/M |
3300012263|Ga0136564_1012659 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
3300012267|Ga0136591_1059184 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 600 | Open in IMG/M |
3300012267|Ga0136591_1064855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae | 563 | Open in IMG/M |
3300012267|Ga0136591_1072673 | Not Available | 521 | Open in IMG/M |
3300012268|Ga0136590_1054495 | Not Available | 661 | Open in IMG/M |
3300012270|Ga0136604_1101553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae | 613 | Open in IMG/M |
3300022827|Ga0222647_1022097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 957 | Open in IMG/M |
3300022836|Ga0222654_1045904 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 720 | Open in IMG/M |
3300022839|Ga0222649_1007475 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
3300022860|Ga0222698_1066317 | Not Available | 613 | Open in IMG/M |
3300022867|Ga0222629_1006061 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1923 | Open in IMG/M |
3300023236|Ga0222659_1005357 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2695 | Open in IMG/M |
3300023242|Ga0222708_1040429 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 676 | Open in IMG/M |
3300023242|Ga0222708_1049370 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 592 | Open in IMG/M |
3300023296|Ga0222664_1021340 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1321 | Open in IMG/M |
3300025513|Ga0208413_1001602 | Not Available | 14209 | Open in IMG/M |
3300025697|Ga0208769_1153994 | Not Available | 645 | Open in IMG/M |
3300028367|Ga0306900_1036348 | Not Available | 563 | Open in IMG/M |
3300028371|Ga0306908_1034365 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 748 | Open in IMG/M |
3300028372|Ga0306901_1026272 | Not Available | 758 | Open in IMG/M |
3300028376|Ga0306912_1000862 | All Organisms → cellular organisms → Bacteria | 15897 | Open in IMG/M |
3300028376|Ga0306912_1069222 | Not Available | 510 | Open in IMG/M |
3300028410|Ga0306866_1052419 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 590 | Open in IMG/M |
3300028412|Ga0306910_1010889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Ruegeria phage Tedan | 1740 | Open in IMG/M |
3300028415|Ga0306867_1015454 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1778 | Open in IMG/M |
3300028415|Ga0306867_1092933 | Not Available | 524 | Open in IMG/M |
3300031208|Ga0307931_1011255 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3843 | Open in IMG/M |
3300031208|Ga0307931_1069167 | Not Available | 661 | Open in IMG/M |
3300031209|Ga0307955_1074263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae | 629 | Open in IMG/M |
3300031209|Ga0307955_1077043 | Not Available | 617 | Open in IMG/M |
3300031209|Ga0307955_1089865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae | 568 | Open in IMG/M |
3300031209|Ga0307955_1097072 | Not Available | 545 | Open in IMG/M |
3300031209|Ga0307955_1105443 | Not Available | 522 | Open in IMG/M |
3300031210|Ga0307964_1059585 | Not Available | 714 | Open in IMG/M |
3300031211|Ga0307974_1058930 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1714 | Open in IMG/M |
3300031211|Ga0307974_1099765 | Not Available | 1092 | Open in IMG/M |
3300031212|Ga0307959_1055924 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1125 | Open in IMG/M |
3300031212|Ga0307959_1087264 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 825 | Open in IMG/M |
3300031212|Ga0307959_1088796 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 815 | Open in IMG/M |
3300031212|Ga0307959_1113275 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 687 | Open in IMG/M |
3300031212|Ga0307959_1149370 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 568 | Open in IMG/M |
3300031212|Ga0307959_1178145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. HX-7-19 | 503 | Open in IMG/M |
3300031213|Ga0307937_1021378 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1510 | Open in IMG/M |
3300031213|Ga0307937_1124774 | Not Available | 522 | Open in IMG/M |
3300031215|Ga0307935_1021644 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1251 | Open in IMG/M |
3300031215|Ga0307935_1025913 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
3300031215|Ga0307935_1028334 | Not Available | 1046 | Open in IMG/M |
3300031215|Ga0307935_1054193 | Not Available | 669 | Open in IMG/M |
3300031215|Ga0307935_1061956 | Not Available | 608 | Open in IMG/M |
3300031215|Ga0307935_1066514 | Not Available | 578 | Open in IMG/M |
3300031216|Ga0307980_1036962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1106 | Open in IMG/M |
3300031216|Ga0307980_1045751 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 965 | Open in IMG/M |
3300031216|Ga0307980_1058358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 826 | Open in IMG/M |
3300031216|Ga0307980_1074845 | Not Available | 702 | Open in IMG/M |
3300031220|Ga0307939_1031759 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
3300031220|Ga0307939_1068411 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 782 | Open in IMG/M |
3300031220|Ga0307939_1116386 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 563 | Open in IMG/M |
3300031220|Ga0307939_1126722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300031220|Ga0307939_1132730 | Not Available | 519 | Open in IMG/M |
3300031220|Ga0307939_1133161 | Not Available | 518 | Open in IMG/M |
3300031220|Ga0307939_1140951 | Not Available | 500 | Open in IMG/M |
3300031221|Ga0307948_1094972 | Not Available | 1053 | Open in IMG/M |
3300031222|Ga0307972_1142318 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 831 | Open in IMG/M |
3300031222|Ga0307972_1164296 | Not Available | 709 | Open in IMG/M |
3300031222|Ga0307972_1185678 | Not Available | 620 | Open in IMG/M |
3300031222|Ga0307972_1202490 | Not Available | 563 | Open in IMG/M |
3300031222|Ga0307972_1205451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. HX-7-19 | 554 | Open in IMG/M |
3300031222|Ga0307972_1216281 | Not Available | 524 | Open in IMG/M |
3300031222|Ga0307972_1217461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. HX-7-19 | 521 | Open in IMG/M |
3300031222|Ga0307972_1223999 | Not Available | 505 | Open in IMG/M |
3300031223|Ga0307981_1149828 | Not Available | 616 | Open in IMG/M |
3300031223|Ga0307981_1155494 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 598 | Open in IMG/M |
3300031224|Ga0307982_1138993 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 623 | Open in IMG/M |
3300031224|Ga0307982_1161639 | Not Available | 537 | Open in IMG/M |
3300031225|Ga0307942_1198996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300031243|Ga0307970_1029509 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
3300031243|Ga0307970_1132942 | Not Available | 541 | Open in IMG/M |
3300031243|Ga0307970_1136963 | Not Available | 532 | Open in IMG/M |
3300031269|Ga0307983_1055172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 740 | Open in IMG/M |
3300031269|Ga0307983_1059902 | Not Available | 699 | Open in IMG/M |
3300031269|Ga0307983_1094867 | Not Available | 509 | Open in IMG/M |
3300031329|Ga0307934_1057703 | Not Available | 1067 | Open in IMG/M |
3300031329|Ga0307934_1089137 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 732 | Open in IMG/M |
3300031333|Ga0307936_1113725 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 757 | Open in IMG/M |
3300031333|Ga0307936_1129660 | Not Available | 693 | Open in IMG/M |
3300031333|Ga0307936_1157311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae | 604 | Open in IMG/M |
3300031333|Ga0307936_1159831 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 597 | Open in IMG/M |
3300031333|Ga0307936_1168686 | Not Available | 574 | Open in IMG/M |
3300031333|Ga0307936_1177731 | Not Available | 552 | Open in IMG/M |
3300031333|Ga0307936_1179466 | Not Available | 548 | Open in IMG/M |
3300031333|Ga0307936_1183838 | Not Available | 538 | Open in IMG/M |
3300031333|Ga0307936_1199811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae | 505 | Open in IMG/M |
3300031334|Ga0307969_1099796 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 679 | Open in IMG/M |
3300031335|Ga0307951_1064204 | Not Available | 1237 | Open in IMG/M |
3300031335|Ga0307951_1077922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1002 | Open in IMG/M |
3300031335|Ga0307951_1108099 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 693 | Open in IMG/M |
3300031339|Ga0307932_1099501 | Not Available | 763 | Open in IMG/M |
3300031343|Ga0307952_1157358 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 548 | Open in IMG/M |
3300031387|Ga0307947_1061797 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1268 | Open in IMG/M |
3300031392|Ga0307975_1129374 | Not Available | 885 | Open in IMG/M |
3300031392|Ga0307975_1178609 | Not Available | 676 | Open in IMG/M |
3300031394|Ga0307963_1064898 | Not Available | 1298 | Open in IMG/M |
3300031394|Ga0307963_1136625 | Not Available | 675 | Open in IMG/M |
3300031395|Ga0307957_1055151 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 836 | Open in IMG/M |
3300031395|Ga0307957_1111932 | Not Available | 559 | Open in IMG/M |
3300031396|Ga0307944_1141323 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 610 | Open in IMG/M |
3300031396|Ga0307944_1161936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae | 554 | Open in IMG/M |
3300031396|Ga0307944_1163565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae | 550 | Open in IMG/M |
3300031397|Ga0307960_1110201 | Not Available | 838 | Open in IMG/M |
3300031397|Ga0307960_1140001 | Not Available | 672 | Open in IMG/M |
3300031397|Ga0307960_1152169 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 623 | Open in IMG/M |
3300031398|Ga0307979_1069565 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 872 | Open in IMG/M |
3300031403|Ga0307933_1190489 | Not Available | 516 | Open in IMG/M |
3300031404|Ga0307945_1154511 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 628 | Open in IMG/M |
3300031404|Ga0307945_1182116 | Not Available | 533 | Open in IMG/M |
3300031600|Ga0307930_1222861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae | 530 | Open in IMG/M |
3300031607|Ga0307966_1313413 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia | 557 | Open in IMG/M |
3300031684|Ga0307946_1154413 | Not Available | 540 | Open in IMG/M |
3300031684|Ga0307946_1165680 | Not Available | 505 | Open in IMG/M |
3300031704|Ga0307943_1081395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1199 | Open in IMG/M |
3300031704|Ga0307943_1154976 | Not Available | 684 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 74.82% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 23.74% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.72% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001097 | Saline microbial communities from Lake Vida, Antarctica (Lake Vida Brine Hole Two - Combined Assembly 2 samples, Mar 2013 Assem) | Environmental | Open in IMG/M |
3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
3300011185 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #898 | Environmental | Open in IMG/M |
3300011187 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #897 | Environmental | Open in IMG/M |
3300011189 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E6 #833 | Environmental | Open in IMG/M |
3300012029 | Saline lake microbial communities from Deep lake, Antarctica - Metagenome #83 | Environmental | Open in IMG/M |
3300012031 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #498 | Environmental | Open in IMG/M |
3300012033 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 3 #764 | Environmental | Open in IMG/M |
3300012036 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 | Environmental | Open in IMG/M |
3300012128 | Saline lake microbial communities from Deep lake, Antarctica - Metagenome #293 | Environmental | Open in IMG/M |
3300012178 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E6 #832 | Environmental | Open in IMG/M |
3300012182 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E6 #831 | Environmental | Open in IMG/M |
3300012263 | Saline lake microbial communities from Club lake, Antarctica - Metagenome #318 | Environmental | Open in IMG/M |
3300012267 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 3 #767 | Environmental | Open in IMG/M |
3300012268 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 3 #765 | Environmental | Open in IMG/M |
3300012270 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla E10 #628 | Environmental | Open in IMG/M |
3300022827 | Saline water microbial communities from Ace Lake, Antarctica - #333 | Environmental | Open in IMG/M |
3300022836 | Saline water microbial communities from Ace Lake, Antarctica - #421 | Environmental | Open in IMG/M |
3300022839 | Saline water microbial communities from Ace Lake, Antarctica - #337 | Environmental | Open in IMG/M |
3300022860 | Saline water microbial communities from Ace Lake, Antarctica - #1450 | Environmental | Open in IMG/M |
3300022867 | Saline water microbial communities from Ace Lake, Antarctica - #1 | Environmental | Open in IMG/M |
3300023236 | Saline water microbial communities from Ace Lake, Antarctica - #547 | Environmental | Open in IMG/M |
3300023242 | Saline water microbial communities from Ace Lake, Antarctica - #1576 | Environmental | Open in IMG/M |
3300023296 | Saline water microbial communities from Ace Lake, Antarctica - #604 | Environmental | Open in IMG/M |
3300025513 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD (SPAdes) | Environmental | Open in IMG/M |
3300025697 | Saline lake microbial communities from Ace Lake, Antarctica- Antarctic Ace Lake Metagenome 02UKC (SPAdes) | Environmental | Open in IMG/M |
3300028367 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 3 #765 (v2) | Environmental | Open in IMG/M |
3300028371 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #899 (v2) | Environmental | Open in IMG/M |
3300028372 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 3 #767 (v2) | Environmental | Open in IMG/M |
3300028376 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla E10 #628 (v2) | Environmental | Open in IMG/M |
3300028410 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E5 #432 (v2) | Environmental | Open in IMG/M |
3300028412 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 (v2) | Environmental | Open in IMG/M |
3300028415 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E6 #831 (v2) | Environmental | Open in IMG/M |
3300031208 | Saline water microbial communities from Organic Lake, Antarctica - #47 | Environmental | Open in IMG/M |
3300031209 | Saline water microbial communities from Organic Lake, Antarctica - #439 | Environmental | Open in IMG/M |
3300031210 | Saline water microbial communities from Organic Lake, Antarctica - #596 | Environmental | Open in IMG/M |
3300031211 | Saline water microbial communities from Organic Lake, Antarctica - #784 | Environmental | Open in IMG/M |
3300031212 | Saline water microbial communities from Organic Lake, Antarctica - #494 | Environmental | Open in IMG/M |
3300031213 | Saline water microbial communities from Organic Lake, Antarctica - #3 | Environmental | Open in IMG/M |
3300031215 | Saline water microbial communities from Organic Lake, Antarctica - #92 | Environmental | Open in IMG/M |
3300031216 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1060 | Environmental | Open in IMG/M |
3300031220 | Saline water microbial communities from Organic Lake, Antarctica - #122 | Environmental | Open in IMG/M |
3300031221 | Saline water microbial communities from Organic Lake, Antarctica - #280 | Environmental | Open in IMG/M |
3300031222 | Saline water microbial communities from Organic Lake, Antarctica - #780 | Environmental | Open in IMG/M |
3300031223 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #987 | Environmental | Open in IMG/M |
3300031224 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #989 | Environmental | Open in IMG/M |
3300031225 | Saline water microbial communities from Organic Lake, Antarctica - #175 | Environmental | Open in IMG/M |
3300031243 | Saline water microbial communities from Organic Lake, Antarctica - #712 | Environmental | Open in IMG/M |
3300031269 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #991 | Environmental | Open in IMG/M |
3300031329 | Saline water microbial communities from Organic Lake, Antarctica - #90 | Environmental | Open in IMG/M |
3300031333 | Saline water microbial communities from Organic Lake, Antarctica - #1 | Environmental | Open in IMG/M |
3300031334 | Saline water microbial communities from Organic Lake, Antarctica - #710 | Environmental | Open in IMG/M |
3300031335 | Saline water microbial communities from Organic Lake, Antarctica - #374 | Environmental | Open in IMG/M |
3300031339 | Saline water microbial communities from Organic Lake, Antarctica - #48 | Environmental | Open in IMG/M |
3300031343 | Saline water microbial communities from Organic Lake, Antarctica - #376 | Environmental | Open in IMG/M |
3300031387 | Saline water microbial communities from Organic Lake, Antarctica - #232 | Environmental | Open in IMG/M |
3300031392 | Saline water microbial communities from Organic Lake, Antarctica - #917 | Environmental | Open in IMG/M |
3300031394 | Saline water microbial communities from Organic Lake, Antarctica - #594 | Environmental | Open in IMG/M |
3300031395 | Saline water microbial communities from Organic Lake, Antarctica - #490 | Environmental | Open in IMG/M |
3300031396 | Saline water microbial communities from Organic Lake, Antarctica - #179 | Environmental | Open in IMG/M |
3300031397 | Saline water microbial communities from Organic Lake, Antarctica - #542 | Environmental | Open in IMG/M |
3300031398 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1058 | Environmental | Open in IMG/M |
3300031403 | Saline water microbial communities from Organic Lake, Antarctica - #88 | Environmental | Open in IMG/M |
3300031404 | Saline water microbial communities from Organic Lake, Antarctica - #228 | Environmental | Open in IMG/M |
3300031600 | Saline water microbial communities from Organic Lake, Antarctica - #46 | Environmental | Open in IMG/M |
3300031607 | Saline water microbial communities from Organic Lake, Antarctica - #646 | Environmental | Open in IMG/M |
3300031684 | Saline water microbial communities from Organic Lake, Antarctica - #230 | Environmental | Open in IMG/M |
3300031704 | Saline water microbial communities from Organic Lake, Antarctica - #177 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ13537_100860753 | 3300001097 | Hypersaline | MNHTERPCAAPGLTSYRYGSIMIGATSTRDALNEAN |
Ga0075110_10652291 | 3300007074 | Saline Lake | MTHHTERPCAAPGLTSYRYGSIMIGATSTRDALVQA |
Ga0105050_105967061 | 3300007516 | Freshwater | MKHHTERPCAAPGLTSYRYGRIMIGATSTRDALNEADRS |
Ga0136597_10499273 | 3300011185 | Saline Lake | MTHHTERPCAAAGLTSYRYGSIMIGATSTRDALNE |
Ga0136596_11034922 | 3300011187 | Saline Lake | MNHTERPCAAVGLTSYRYASRYGRIMIGATSTRDALNE |
Ga0136558_10730492 | 3300011189 | Saline Lake | MNSPCAAHGWTSYRYAGRYGYIMIGATSTRDALNEAD |
Ga0136558_11541763 | 3300011189 | Saline Lake | MNHTERPCAAHGWTSYRYAGRYGNIMIGATSTRDALNE |
Ga0136558_11557222 | 3300011189 | Saline Lake | MNHTERPCAAAGLTSYRYAATSTQDALNEADRSLTHGAATVDGTP* |
Ga0136558_11706621 | 3300011189 | Saline Lake | MTHHTERPCAAAGLTSYRYGSIMIGATSTQDALNEAD |
Ga0136572_10063275 | 3300012029 | Saline Lake | MNHHTERPCAAPGLTSYRYGHIMIGATSTRDALNEADRSLTQG |
Ga0136561_10464001 | 3300012031 | Saline Lake | MNHTERPCAAHGLTSYRYGHIMIGATSTRDALNEADRSLTQGAATVD* |
Ga0136589_10973911 | 3300012033 | Saline Lake | MTHHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEADRSLTQGAATVDR |
Ga0136600_11198112 | 3300012036 | Saline Lake | MTHHTERPCAAHGWTFYRYAGRYGSIMIGATSTQDALNEADRMQ* |
Ga0136600_11198114 | 3300012036 | Saline Lake | MNSPCAAHGWTSYRYGTIMIGATSTQDALNEADRM |
Ga0136582_10507593 | 3300012128 | Saline Lake | MTHHTERPCAAHGLTSYRYAGRHGSIMIGATSTQDALNKADRS |
Ga0136557_11111321 | 3300012178 | Saline Lake | MNHTERPCAAHGWTSYRYAGRYGYIMIGATSTRDA |
Ga0136556_11540532 | 3300012182 | Saline Lake | MNHTERPCADAGLTSYRYGTIMIGATSTQDALNEADRSLTRG |
Ga0136556_11779801 | 3300012182 | Saline Lake | MIYHTERPCAAAGLTSYRYRAQHGFVMIGATSTQDALN |
Ga0136564_10126595 | 3300012263 | Saline Lake | MNHTERPCAAPGLTSYRYGTIMIGATSTQDALNEA |
Ga0136591_10591842 | 3300012267 | Saline Lake | MNHTERPCAAHGWTSYRYAGRYGSIMIGATSTRDALNEA |
Ga0136591_10648552 | 3300012267 | Saline Lake | MNHTERPCAAAGLTSYRYGTIMIGATSTRDALNEANRSLTQGAA |
Ga0136591_10726733 | 3300012267 | Saline Lake | MNSPCAAHGWTSYRYAGRYGSIMIGATSTQDALNEADRSLTQGA |
Ga0136590_10544951 | 3300012268 | Saline Lake | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEADRSLTQGAATVDR |
Ga0136604_11015533 | 3300012270 | Saline Lake | MNHTERPCAAAGLTSYRYGHIMIGATSTQDALNDADRSL |
Ga0222647_10220973 | 3300022827 | Saline Water | MTHHTERPCAAGLTSYRYGSIMIGATSTRDALVQADRSL |
Ga0222654_10459043 | 3300022836 | Saline Water | MTHHTERPCAAVGLTSYRYGHIMIGATSTQDALNEANRSLTHGTVTVDRL |
Ga0222649_10074754 | 3300022839 | Saline Water | MTHHTERPCAAGLTSYRYGSIMIGATSTRDALVQADRSPDWKSGTP |
Ga0222698_10663173 | 3300022860 | Saline Water | MNHTERPCAAHGLTSYRYGHIMIGATSTQDALNEADRSLTHG |
Ga0222629_10060613 | 3300022867 | Saline Water | VTHHTERPCAAVGLTSYRYGHIMIGATSTQDALNE |
Ga0222659_10053571 | 3300023236 | Saline Water | MTHHTERPCAAVGLTSYRYGHIMIGATSTQDALNEANRSLTHGTVTVDRLE |
Ga0222708_10404293 | 3300023242 | Saline Water | MKHHADRPCAAAGLTSYRYGQIMIGATSTQDALNEADRSLTQ |
Ga0222708_10493703 | 3300023242 | Saline Water | MTHHTERPCAAVGLTSYRYGHIMIGATSTRDALNEAD |
Ga0222664_10213403 | 3300023296 | Saline Water | VTHHTERPCAAVGLTSYRYGHIMIGATSTQDALNEANRSL |
Ga0208413_100160217 | 3300025513 | Saline Lake | VTHHTERPCAAVGLTSYRYGHIMIGATSTQDALNEANRS |
Ga0208769_11539941 | 3300025697 | Saline Lake | MNHHTERHCAAPGLTSYRYGSIMIGATSAQDALNEANRSLTHGVAT |
Ga0306900_10363481 | 3300028367 | Saline Lake | MTHHTERPCAAAGLTSYRYGTIMIGATSTQDALNEADRSLTQGA |
Ga0306908_10343651 | 3300028371 | Saline Lake | VSARHHTERPCAAAGLTSYRYGHIMIGATSTQDALNEADRSLTQ |
Ga0306901_10262721 | 3300028372 | Saline Lake | MNHTERPCAAVGLTSYRYGHIMIGATSTQDVLNEAD |
Ga0306912_10008621 | 3300028376 | Saline Lake | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEADRSLTQG |
Ga0306912_10692223 | 3300028376 | Saline Lake | MNHTERPCAAAGLTSYRYGTIMIGATSTQDALNET |
Ga0306866_10524191 | 3300028410 | Saline Lake | MNHTERPCAAAGLTSYRYAATSTQDALNEADRSLTQGAATVDRLE |
Ga0306910_10108893 | 3300028412 | Saline Lake | MTHHTERPCAAHGWTFYRYAGRYGSIMIGATSTQDALNEADRMQ |
Ga0306867_10154541 | 3300028415 | Saline Lake | MIYHTERPCAAHGWTSYRYAGRYGNIMIGATSTRDALN |
Ga0306867_10929331 | 3300028415 | Saline Lake | MNHTERPCADAGLTSYRYGTIMIGATSTQDALNEADRSLT |
Ga0307931_10112551 | 3300031208 | Saline Water | MNHTERPCAAHGWTSYRYGTIMIGATSTQDALNEA |
Ga0307931_10691671 | 3300031208 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEADR |
Ga0307955_10742631 | 3300031209 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEADRSLTQGAATVER |
Ga0307955_10770432 | 3300031209 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTRDALNEADR |
Ga0307955_10898653 | 3300031209 | Saline Water | MNHTERPCAAAGLTSYRYGTIMIGATSTQDALNEA |
Ga0307955_10970721 | 3300031209 | Saline Water | MIHHTERPCAAHGWTSYRYGTIMIGATSTQDALNEADRSLTQGA |
Ga0307955_11054432 | 3300031209 | Saline Water | MTIETRPSAAHRWTSYRYAGRYGHIMIGATSTRDALNEADRSLTQGAATVERL |
Ga0307964_10595851 | 3300031210 | Saline Water | LSIFNHTEHPCAAHGLTSYRYGTIMIGATSTQDALNEADRSLTQ |
Ga0307974_10589301 | 3300031211 | Saline Water | MNHTERPCAAHGWTSYRYGTIMIGATSTQDALNEADRSL |
Ga0307974_10997653 | 3300031211 | Saline Water | MTIETRPSAAHGWTSYRYAGRYGTIMIGATSTQDAL |
Ga0307959_10559244 | 3300031212 | Saline Water | MNHTERPCAAHGWTSYRYGTIMIGATSTQDALNEADRSLTQGAATVERLE |
Ga0307959_10872641 | 3300031212 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALN |
Ga0307959_10887961 | 3300031212 | Saline Water | MNSPCAAHGWTSYRYADRYGSIMIGATSTQDALNEADRSLTQGAATVERLE |
Ga0307959_11132753 | 3300031212 | Saline Water | MNHTERPCAAAGLTSYRYGTIMIGATSTQDALNEADRSLTQ |
Ga0307959_11493703 | 3300031212 | Saline Water | MIHHTERPCAAHGWTSYRYAGRYGSIMIGATSTQDALNEADRSL |
Ga0307959_11781451 | 3300031212 | Saline Water | MTHHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEAD |
Ga0307937_10213783 | 3300031213 | Saline Water | MTIKHGRPCAAHGWTSYRYAGRYGTIMIGASSTQDALNEADRSLTQGA |
Ga0307937_11247741 | 3300031213 | Saline Water | MTIETRPSAAHRWTSYRYAGRYGTIMIGATSTQDALNEADRSLTQGAATVDRL |
Ga0307935_10216441 | 3300031215 | Saline Water | MTIETRPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEADRSLTQGA |
Ga0307935_10259135 | 3300031215 | Saline Water | MTHHTERPCAAVGLTSYRYGTIMIGATSTQDALNEAGRSL |
Ga0307935_10283343 | 3300031215 | Saline Water | VNLSIFNHTEHPCAAHGLTSYRYGTIMIGATSTQDALNEADRSLTQGAATVDR |
Ga0307935_10541933 | 3300031215 | Saline Water | VVKAGDGMTHHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALN |
Ga0307935_10619561 | 3300031215 | Saline Water | MNHTERPCAAAGLTSYRYGTIMIGATSTQDALNEADRSLTQG |
Ga0307935_10665141 | 3300031215 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEADRSLTQGAA |
Ga0307980_10369623 | 3300031216 | Saline Water | MNYTERPCAAHGWTSYRYAGRYGSIMIGATSTQDALNEAD |
Ga0307980_10457511 | 3300031216 | Saline Water | MTHHTERPCAAAGLTSYRYGYIMIGATSTQDALNEADR |
Ga0307980_10583584 | 3300031216 | Saline Water | MTHHTERPCAAAGLTSYRYGTIMIGATSTQDALNEADRSLTHGA |
Ga0307980_10748453 | 3300031216 | Saline Water | MTHHTERPCAAVGLTSYRYAGRYGSIMIGATSTRDALNEADR |
Ga0307939_10317593 | 3300031220 | Saline Water | MTHHTERPCAAHGLTSYRYAGRYGTIMIGATSTQD |
Ga0307939_10684111 | 3300031220 | Saline Water | MNHTERPCAAAGLTSYRYGSIMIGATSTQDALNEADRSLTQG |
Ga0307939_11163862 | 3300031220 | Saline Water | MTNPTERPCAAHGWTSYRYAGRYGSIMIGATSTRDALNEADRSLTQ |
Ga0307939_11267222 | 3300031220 | Saline Water | MNHTERPCAAHGLTSYRYAGRYGHIMIGATSTQDALNEAG |
Ga0307939_11327301 | 3300031220 | Saline Water | MNHTERPCAAHGWTSYRYADRYGSIMIGATSTQDALNEADRS |
Ga0307939_11331612 | 3300031220 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGSIMIGATSTQDALNEADRSL |
Ga0307939_11409511 | 3300031220 | Saline Water | MTHHTERPCAAHGWTSYRYAGRYGTIMIGATSTRDALNEADRSL |
Ga0307948_10949721 | 3300031221 | Saline Water | VNLSIFNHTEHPCAAHGLTSYRYGTIMIGATSTQDALNEADRSLTQGAATVDRLE |
Ga0307972_11423181 | 3300031222 | Saline Water | MNHTERPCAAVGLTSYRYGTIMIGATSTQDALNEADRSLTQGAA |
Ga0307972_11642963 | 3300031222 | Saline Water | MTIETRPSAAHGWTSYRYAGRYGTIMIGATSTQDALNEA |
Ga0307972_11856781 | 3300031222 | Saline Water | MNHTERPCAAVGLTSYRYGNIMIGATSTQDALNEADRSLTQ |
Ga0307972_12024901 | 3300031222 | Saline Water | MNYTERPCADHGLTSYRYAGRYGTIMIGATSTQDALNEADRSLT |
Ga0307972_12054511 | 3300031222 | Saline Water | MTHHTERPCAAHGWTSYRYGTIMIGATSTQDALNEAD |
Ga0307972_12162812 | 3300031222 | Saline Water | MNHTERPCAAVGLTSYRYGTIMIGATSTQDALNEADRSL |
Ga0307972_12174612 | 3300031222 | Saline Water | MTHHTERPCAAHGLTSYRYAGRYGTIMIGATSTQDALN |
Ga0307972_12239992 | 3300031222 | Saline Water | MNHTERPCGAHGWTSYRYAGRYGTIMIGATSTQDALNEADRSLTKGAAT |
Ga0307981_11498281 | 3300031223 | Saline Water | MTIETRPSAAHRWTSYRYAGRYGHIMIGATSTRDALNEADRSLTQGAATVERLEIWN |
Ga0307981_11554941 | 3300031223 | Saline Water | MTHHTERPCAAHGWTSYRYGTIMIGATSTQDALNEADRSLTQ |
Ga0307982_11389931 | 3300031224 | Saline Water | MTHHTKHPCAAHGWTSYRYAGRYGTIMIGATSTQDA |
Ga0307982_11616391 | 3300031224 | Saline Water | MNHTERPCAAAGLTSYRYGTIMIGATSTQDALNEADR |
Ga0307942_11989961 | 3300031225 | Saline Water | MTHYTERPCAAHGWTSYRYAGRYGHIMIGASSTQDALNEADRSLT |
Ga0307970_10295091 | 3300031243 | Saline Water | MNHTERPCAAHGWTSYRYGTIMIGATSTQDALNEADRSLTQ |
Ga0307970_11329421 | 3300031243 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEAD |
Ga0307970_11369632 | 3300031243 | Saline Water | MTIETRPSAAHRWTSYRYAGRYGHIMIGATSTRDALNEADRS |
Ga0307983_10551724 | 3300031269 | Saline Water | MNSPCAAHGWTSYRYAGRYGTIMIGATNTQDALNEADRSLT |
Ga0307983_10599021 | 3300031269 | Saline Water | MTIETRPSAAHRWTSYRYAGRYGTIMIGATNTQDALNEADRSLTQGAATVERLEIWNALTGL |
Ga0307983_10948671 | 3300031269 | Saline Water | MNHTERPCAAHGWTSYRYGHIMIGATSTRDALNEADRSLTQGA |
Ga0307934_10577034 | 3300031329 | Saline Water | MTIETRPSAAHRWTSYRYAGRYGHIMIGATSTRDALNEADRSLTQGAATV |
Ga0307934_10891371 | 3300031329 | Saline Water | MTHHTKHPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEADRSLTQGAA |
Ga0307936_11137253 | 3300031333 | Saline Water | MNHTERPCAAHGWTSYRYGTIMIGATSTQDALNEADRSLTQG |
Ga0307936_11296602 | 3300031333 | Saline Water | MTIETRPSAAHRWTSYRYAGRYGTIMIGATSTQDALNEADRSLTQGAATVDRLE |
Ga0307936_11573111 | 3300031333 | Saline Water | MNHTERPCAAAGLTSYRYGHIMIGATSTQDALNEADRSLTQGA |
Ga0307936_11598311 | 3300031333 | Saline Water | MNSPCAAHGWTSYRYADRYGSIMIGATSTQDALNEADRSLTQGA |
Ga0307936_11686862 | 3300031333 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEAGRSLTQGAATVDRLE |
Ga0307936_11777312 | 3300031333 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGHIMIGATSTQDALNEAD |
Ga0307936_11794661 | 3300031333 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDAL |
Ga0307936_11838381 | 3300031333 | Saline Water | MTHHTERPCAAHGWTSYRYGSIMIGATSTQDALNEADRSLTQGA |
Ga0307936_11998111 | 3300031333 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGHIMIGASSTQDALN |
Ga0307969_10997961 | 3300031334 | Saline Water | MTHHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEADR |
Ga0307951_10642041 | 3300031335 | Saline Water | MTHHTERPCAAAGLTSYRYGSIMIGATSTRDALVQADRSLTYGA |
Ga0307951_10779223 | 3300031335 | Saline Water | MNHTERPCAAHGLTSYRYAGRYGHIMIGATSTQDALNEA |
Ga0307951_11080991 | 3300031335 | Saline Water | MTHHTERPCAAHGWTSYRYAGRYGTIMIGASSTQDALNEADR |
Ga0307932_10995012 | 3300031339 | Saline Water | LSIFNHTEHPCAAHGLTSYRYGTIMIGATSTQDALNEADRSLTQGAATVDR |
Ga0307952_11573582 | 3300031343 | Saline Water | MTNPTERPCAAHGWTSYRYAGRYGSIMIGATSTRDALNE |
Ga0307947_10617971 | 3300031387 | Saline Water | MNHTERPCAAAGLTSYRYGTIMIGATSTQDALNEAGR |
Ga0307975_11293743 | 3300031392 | Saline Water | MNHTERPCAAHGWTSYRYAGRYDQIMIGATSTQDALNEAGRSLTQ |
Ga0307975_11786092 | 3300031392 | Saline Water | MTIETRPSAAHRWTSYRYAGRYGTIMIGATSTQDALN |
Ga0307963_10648983 | 3300031394 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEADRSLTQGAAT |
Ga0307963_11366252 | 3300031394 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEADRSLTQGAATV |
Ga0307957_10551511 | 3300031395 | Saline Water | MTHHTERPCAAHGLTSYRYGTIMIGATSTQDALNEADRS |
Ga0307957_11119322 | 3300031395 | Saline Water | MNHTERPCAAAGLTSYRYGSIMIGATSTQDALNEADRS |
Ga0307944_11413232 | 3300031396 | Saline Water | MTHHTERPCAAHGWTSYRYAGRYGSIMIGATSTRDALNEA |
Ga0307944_11619362 | 3300031396 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTRDALNEADRSL |
Ga0307944_11635652 | 3300031396 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGSIMIGATSTQDALNEADRS |
Ga0307960_11102011 | 3300031397 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATNTQDALNE |
Ga0307960_11400011 | 3300031397 | Saline Water | MNHTERPCAAHGWTSYRYGHIMIGATSTRDALNEADR |
Ga0307960_11521692 | 3300031397 | Saline Water | MTHHTERPCAAHGWTSYRYAGRYGSIMIGATSTRDALNEADRSL |
Ga0307979_10695652 | 3300031398 | Saline Water | MTHHTKHPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEADRSLTQGAATVD |
Ga0307933_11904891 | 3300031403 | Saline Water | MNHTERPCAAAGLTSYRYGSIMIGATSTQDALNEADQSLTQG |
Ga0307945_11545112 | 3300031404 | Saline Water | MTHHTERPCAAHGWTSYRYAGRYGSIMIGATSTRDALNEADRSLTQ |
Ga0307945_11821161 | 3300031404 | Saline Water | MNHTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALNEAGR |
Ga0307930_12228612 | 3300031600 | Saline Water | MNHTERPCAAHGWTSYRYADRYGSIMIGATSTQDALNEAD |
Ga0307966_13134131 | 3300031607 | Saline Water | MTHHTERPCAAPGLTSYRYGSIMIGATSTRDALVQADRSLTYGAA |
Ga0307946_11544131 | 3300031684 | Saline Water | MNHTERPCAAHGLTSYRYAGRSGHIMIGATSTQDALN |
Ga0307946_11656801 | 3300031684 | Saline Water | MNYTERPCAAHGWTSYRYAGRYGTIMIGATSTQDALN |
Ga0307943_10813951 | 3300031704 | Saline Water | MNHTERPCAAHGLTSYRYGTIMIGATSTQDALNEADRS |
Ga0307943_11549761 | 3300031704 | Saline Water | MTIETRPSAAHRWTSYRYAGRYGHIMIGATSTRDALNEADRSLTQ |
⦗Top⦘ |