Basic Information | |
---|---|
Family ID | F054717 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 139 |
Average Sequence Length | 41 residues |
Representative Sequence | STEEIASSANQLAEAADKLTGAVKSFRLLADEEPPPERQAAD |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 139 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.56 % |
% of genes from short scaffolds (< 2000 bps) | 79.86 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.209 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (25.899 % of family members) |
Environment Ontology (ENVO) | Unclassified (55.396 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.432 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 139 Family Scaffolds |
---|---|---|
PF01842 | ACT | 15.83 |
PF02826 | 2-Hacid_dh_C | 7.91 |
PF02274 | ADI | 7.91 |
PF02738 | MoCoBD_1 | 6.47 |
PF16576 | HlyD_D23 | 4.32 |
PF12704 | MacB_PCD | 2.88 |
PF00583 | Acetyltransf_1 | 1.44 |
PF03544 | TonB_C | 1.44 |
PF00266 | Aminotran_5 | 1.44 |
PF12700 | HlyD_2 | 1.44 |
PF00326 | Peptidase_S9 | 1.44 |
PF13205 | Big_5 | 1.44 |
PF00072 | Response_reg | 0.72 |
PF01734 | Patatin | 0.72 |
PF00903 | Glyoxalase | 0.72 |
PF13589 | HATPase_c_3 | 0.72 |
PF14559 | TPR_19 | 0.72 |
PF00271 | Helicase_C | 0.72 |
PF01634 | HisG | 0.72 |
PF02412 | TSP_3 | 0.72 |
PF13517 | FG-GAP_3 | 0.72 |
PF07969 | Amidohydro_3 | 0.72 |
PF07676 | PD40 | 0.72 |
PF00529 | CusB_dom_1 | 0.72 |
PF00069 | Pkinase | 0.72 |
PF14026 | DUF4242 | 0.72 |
PF05973 | Gp49 | 0.72 |
PF01863 | YgjP-like | 0.72 |
PF13491 | FtsK_4TM | 0.72 |
PF02774 | Semialdhyde_dhC | 0.72 |
PF06114 | Peptidase_M78 | 0.72 |
COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
---|---|---|---|
COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 7.91 |
COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 7.91 |
COG4874 | Uncharacterized conserved protein | Function unknown [S] | 7.91 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.88 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.44 |
COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.72 |
COG0040 | ATP phosphoribosyltransferase | Amino acid transport and metabolism [E] | 0.72 |
COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.72 |
COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.72 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.72 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.72 |
COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.72 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.72 |
COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.21 % |
Unclassified | root | N/A | 10.79 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002908|JGI25382J43887_10046287 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
3300002908|JGI25382J43887_10252491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
3300005167|Ga0066672_10044053 | All Organisms → cellular organisms → Bacteria | 2525 | Open in IMG/M |
3300005174|Ga0066680_10184151 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
3300005179|Ga0066684_10968134 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
3300005180|Ga0066685_10053189 | All Organisms → cellular organisms → Bacteria | 2605 | Open in IMG/M |
3300005181|Ga0066678_10784876 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300005184|Ga0066671_10210248 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300005434|Ga0070709_10218557 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
3300005444|Ga0070694_101331615 | Not Available | 605 | Open in IMG/M |
3300005446|Ga0066686_10046882 | All Organisms → cellular organisms → Bacteria | 2620 | Open in IMG/M |
3300005446|Ga0066686_10983740 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005451|Ga0066681_10452402 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 789 | Open in IMG/M |
3300005471|Ga0070698_101641386 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300005540|Ga0066697_10245146 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300005552|Ga0066701_10670994 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 625 | Open in IMG/M |
3300005555|Ga0066692_10938931 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005556|Ga0066707_10061512 | Not Available | 2211 | Open in IMG/M |
3300005557|Ga0066704_10778280 | All Organisms → cellular organisms → Bacteria → FCB group | 596 | Open in IMG/M |
3300005558|Ga0066698_11067015 | All Organisms → cellular organisms → Bacteria → FCB group | 511 | Open in IMG/M |
3300005576|Ga0066708_11064017 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
3300005586|Ga0066691_10258905 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300006031|Ga0066651_10233261 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300006034|Ga0066656_10877502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 574 | Open in IMG/M |
3300006046|Ga0066652_100817515 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300006046|Ga0066652_102041076 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300006794|Ga0066658_10875593 | All Organisms → cellular organisms → Bacteria → FCB group | 514 | Open in IMG/M |
3300006800|Ga0066660_10095177 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
3300006800|Ga0066660_10296281 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300006800|Ga0066660_10717690 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300006903|Ga0075426_10803750 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300006914|Ga0075436_100596940 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300007076|Ga0075435_100611323 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300007258|Ga0099793_10083680 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
3300007258|Ga0099793_10322260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 753 | Open in IMG/M |
3300007258|Ga0099793_10338071 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300007258|Ga0099793_10341975 | Not Available | 730 | Open in IMG/M |
3300009012|Ga0066710_101098813 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300009012|Ga0066710_101800585 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 925 | Open in IMG/M |
3300009012|Ga0066710_102230316 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 798 | Open in IMG/M |
3300009088|Ga0099830_11019621 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 686 | Open in IMG/M |
3300009100|Ga0075418_11063324 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300009137|Ga0066709_100472924 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
3300009147|Ga0114129_11092325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_66_5 | 999 | Open in IMG/M |
3300009162|Ga0075423_11528067 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300010127|Ga0127489_1137778 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300010304|Ga0134088_10046622 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1985 | Open in IMG/M |
3300010304|Ga0134088_10153484 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300010320|Ga0134109_10067131 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300010320|Ga0134109_10213166 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 717 | Open in IMG/M |
3300010320|Ga0134109_10391060 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300010321|Ga0134067_10171989 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300010322|Ga0134084_10259540 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 631 | Open in IMG/M |
3300010322|Ga0134084_10382094 | Not Available | 545 | Open in IMG/M |
3300010323|Ga0134086_10127415 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300010326|Ga0134065_10131393 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300010333|Ga0134080_10014527 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
3300010333|Ga0134080_10071303 | Not Available | 1394 | Open in IMG/M |
3300010333|Ga0134080_10072826 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
3300010336|Ga0134071_10129188 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1219 | Open in IMG/M |
3300010336|Ga0134071_10414414 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 687 | Open in IMG/M |
3300012160|Ga0137349_1051615 | Not Available | 724 | Open in IMG/M |
3300012198|Ga0137364_10092439 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2114 | Open in IMG/M |
3300012198|Ga0137364_10183304 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
3300012198|Ga0137364_10828909 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300012200|Ga0137382_10073948 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2192 | Open in IMG/M |
3300012200|Ga0137382_10160634 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
3300012200|Ga0137382_10552416 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300012200|Ga0137382_10998529 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300012200|Ga0137382_11123149 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4 | 561 | Open in IMG/M |
3300012206|Ga0137380_10562278 | Not Available | 1000 | Open in IMG/M |
3300012208|Ga0137376_10061264 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3104 | Open in IMG/M |
3300012208|Ga0137376_10139886 | Not Available | 2078 | Open in IMG/M |
3300012208|Ga0137376_10668505 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4 | 897 | Open in IMG/M |
3300012211|Ga0137377_10100528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2739 | Open in IMG/M |
3300012350|Ga0137372_10601046 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300012351|Ga0137386_10078249 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
3300012353|Ga0137367_10206231 | Not Available | 1423 | Open in IMG/M |
3300012354|Ga0137366_10035898 | All Organisms → cellular organisms → Bacteria | 3843 | Open in IMG/M |
3300012354|Ga0137366_10209116 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300012358|Ga0137368_10096604 | All Organisms → cellular organisms → Bacteria | 2305 | Open in IMG/M |
3300012358|Ga0137368_10160981 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 1645 | Open in IMG/M |
3300012359|Ga0137385_10130690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2215 | Open in IMG/M |
3300012360|Ga0137375_10008094 | All Organisms → cellular organisms → Bacteria | 12508 | Open in IMG/M |
3300012401|Ga0134055_1112912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
3300012923|Ga0137359_11239248 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300012927|Ga0137416_10194994 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1621 | Open in IMG/M |
3300012976|Ga0134076_10009489 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → unclassified Rhodothermaceae → Rhodothermaceae bacterium RA | 3288 | Open in IMG/M |
3300013297|Ga0157378_11619585 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300014157|Ga0134078_10644624 | Not Available | 513 | Open in IMG/M |
3300014157|Ga0134078_10673292 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300014166|Ga0134079_10748879 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300015356|Ga0134073_10021091 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae | 1564 | Open in IMG/M |
3300015358|Ga0134089_10067872 | Not Available | 1327 | Open in IMG/M |
3300015359|Ga0134085_10269669 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300015359|Ga0134085_10319673 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 685 | Open in IMG/M |
3300015371|Ga0132258_10481585 | All Organisms → cellular organisms → Bacteria | 3099 | Open in IMG/M |
3300017657|Ga0134074_1200022 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300017659|Ga0134083_10480020 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300018056|Ga0184623_10037810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2187 | Open in IMG/M |
3300018056|Ga0184623_10071872 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1592 | Open in IMG/M |
3300018082|Ga0184639_10198997 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1063 | Open in IMG/M |
3300018431|Ga0066655_10258921 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300018433|Ga0066667_10010120 | All Organisms → cellular organisms → Bacteria | 4487 | Open in IMG/M |
3300018433|Ga0066667_10223402 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
3300018433|Ga0066667_12157703 | Not Available | 517 | Open in IMG/M |
3300018482|Ga0066669_10469191 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300020003|Ga0193739_1027137 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1488 | Open in IMG/M |
3300021081|Ga0210379_10263344 | Not Available | 750 | Open in IMG/M |
3300021086|Ga0179596_10390390 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300021344|Ga0193719_10297835 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 677 | Open in IMG/M |
3300021560|Ga0126371_13583213 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300025322|Ga0209641_10436660 | Not Available | 939 | Open in IMG/M |
3300026298|Ga0209236_1019040 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3874 | Open in IMG/M |
3300026301|Ga0209238_1181110 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 620 | Open in IMG/M |
3300026307|Ga0209469_1007417 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4354 | Open in IMG/M |
3300026307|Ga0209469_1051869 | Not Available | 1290 | Open in IMG/M |
3300026308|Ga0209265_1097160 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300026313|Ga0209761_1003351 | All Organisms → cellular organisms → Bacteria | 10583 | Open in IMG/M |
3300026316|Ga0209155_1174319 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300026323|Ga0209472_1121473 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1022 | Open in IMG/M |
3300026331|Ga0209267_1290191 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300026332|Ga0209803_1062112 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
3300026342|Ga0209057_1200652 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300026343|Ga0209159_1143538 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300026529|Ga0209806_1119410 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300026536|Ga0209058_1014892 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5328 | Open in IMG/M |
3300026548|Ga0209161_10471951 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
3300027273|Ga0209886_1074592 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300027480|Ga0208993_1005468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2137 | Open in IMG/M |
3300027725|Ga0209178_1129916 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300027765|Ga0209073_10186951 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300027787|Ga0209074_10123037 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300027787|Ga0209074_10212325 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300027846|Ga0209180_10180835 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300027875|Ga0209283_10011009 | All Organisms → cellular organisms → Bacteria | 5360 | Open in IMG/M |
3300033432|Ga0326729_1001246 | All Organisms → cellular organisms → Bacteria | 5503 | Open in IMG/M |
3300033502|Ga0326731_1095142 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300033814|Ga0364930_0318232 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.90% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.02% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 19.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.07% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.32% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.88% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.16% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.44% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.72% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.72% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.72% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25382J43887_100462871 | 3300002908 | Grasslands Soil | TEEIASSANQLAEAADKLTGAVKTFRLLKDEEQRTEQAAD* |
JGI25382J43887_102524912 | 3300002908 | Grasslands Soil | EEIASSANQLAEAADKLTGAVKTFRLLKDEERRTEQAAD* |
Ga0066672_100440533 | 3300005167 | Soil | EQSASTEEIASSANQLAEAADKLTGAVKSFRLLADEEPPPERQAAD* |
Ga0066680_101841511 | 3300005174 | Soil | EIASSANQLAEAADRLTGAVKSFRLLADEVPPPERQAAD* |
Ga0066684_109681342 | 3300005179 | Soil | STEEIASSANQLAEAADRLTGAVKSFRLLADEQQHQQAAD* |
Ga0066685_100531891 | 3300005180 | Soil | SASTEEIASSANQLAEAADKLQGAVKTFRLLQDEVVEPTRQAAD* |
Ga0066678_107848762 | 3300005181 | Soil | EIASSANQLAEAADKLTGAVKSFRLLADEAPPPERQAAD* |
Ga0066671_102102481 | 3300005184 | Soil | SASTEEIASSANQLAEAADKLTGAVKSFRLLADEEPPREQAAD* |
Ga0070709_102185571 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SASTQEIASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD* |
Ga0070694_1013316151 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | STQEIASSANQLAEAADRLTGAVKSFRLLADEQSQEQPQAAD* |
Ga0066686_100468821 | 3300005446 | Soil | EIASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD* |
Ga0066686_109837401 | 3300005446 | Soil | QEIASSANQLAEASDRLTGAVKSFRLLADEEPPARQAAD* |
Ga0066681_104524022 | 3300005451 | Soil | EEIASSANQLAEAADKLQGAVKSFRLLQDEVVEPTRQAAD* |
Ga0070698_1016413862 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GQEQSASTEEIAASANRLAEAADKLTGAVKSFRLLADEVHTPEREAAD* |
Ga0066697_102451461 | 3300005540 | Soil | SQEQSASTEEIASSANQLAEAADKLQGAVKTFRLLQDEVVEPTRQAAD* |
Ga0066701_106709941 | 3300005552 | Soil | AASANQLAEAADKLSDAVKSFRLLADEGPPPERQAAD* |
Ga0066692_109389312 | 3300005555 | Soil | SASTEEIAASANQLAEAADKLSDAVKSFRLLADEGPPPERQAAD* |
Ga0066707_100615121 | 3300005556 | Soil | EEIASSANQLAEAADKLTGAVKSFRLLADEEPPPERQAAD* |
Ga0066704_107782802 | 3300005557 | Soil | STEEIASSANQLAEAADKLTGAVKSFRLLADEEPPPERQAAD* |
Ga0066698_110670152 | 3300005558 | Soil | IASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD* |
Ga0066708_110640172 | 3300005576 | Soil | EEQSASTEEIASSANQLAEAADRLTGAVKSFRLLADEQQEQAAD* |
Ga0066691_102589051 | 3300005586 | Soil | SANQLAEAADKLTGAVKSFRLLADEAPPPERQAAD* |
Ga0066651_102332611 | 3300006031 | Soil | SASTEEIASSANQLAEAADKLQGAVKTFRLLQDEAVEPTRQAAD* |
Ga0066656_108775022 | 3300006034 | Soil | EEQSASTEEIASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD* |
Ga0066652_1008175151 | 3300006046 | Soil | TEEIASSANQLAEAADKLTGAVKSFRLLADEEPPREQAAD* |
Ga0066652_1020410762 | 3300006046 | Soil | EEIASSANQLAEAADRLTGAVKSFRLLADEVQQAAD* |
Ga0066658_108755932 | 3300006794 | Soil | EEIASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD* |
Ga0066660_100951771 | 3300006800 | Soil | EEQSASTEEIASSANQLAEAADKLTGAVKSFRLLADEEPPPERQAAD* |
Ga0066660_102962811 | 3300006800 | Soil | SEEQSASTEEIASSANQLAEAADKLTGAVKSFRLLADEEPHRQQAAD* |
Ga0066660_107176902 | 3300006800 | Soil | QSASTEEIASSANQLAEAADKLTGAVKSFRLLADEEPPREQAAD* |
Ga0075426_108037501 | 3300006903 | Populus Rhizosphere | QSASTEEIASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD* |
Ga0075436_1005969401 | 3300006914 | Populus Rhizosphere | EIASSANQLAQAADHLTGAVKSFRLTATDEPEQPREAAD* |
Ga0075435_1006113232 | 3300007076 | Populus Rhizosphere | GEEQSASTEEIASSANQLAEAADRLTGAVKSFRLLADEVQPQAAD* |
Ga0099793_100836801 | 3300007258 | Vadose Zone Soil | TEEIASSANQLAEAADRLTGAVKSFRLLADEPQQRQAAD* |
Ga0099793_103222602 | 3300007258 | Vadose Zone Soil | EEIASSANQLAEAADRLTGAVKSFRLLEDEQQQQAAD* |
Ga0099793_103380711 | 3300007258 | Vadose Zone Soil | TASTQEIAASANQLAEAADKLSDAVKSFRLLAEQAAVPGSSPTQEAAD* |
Ga0099793_103419751 | 3300007258 | Vadose Zone Soil | EQSASTEEIASSANQLAEAADRLTGAVQSFRLLEDEQQQQAAD* |
Ga0066710_1010988132 | 3300009012 | Grasslands Soil | EEIASSANQLAEAADRLTGAVKSFRLLADEVPPPERQAAD |
Ga0066710_1018005852 | 3300009012 | Grasslands Soil | SSANQLAEAADKLQGAVKTFRLLQDEPEEPTRQAAD |
Ga0066710_1022303161 | 3300009012 | Grasslands Soil | EIASSANQLAEAADKLQGAVKTFRLLQDEVVEPTRQAAD |
Ga0099830_110196211 | 3300009088 | Vadose Zone Soil | SANQLAEAADKLTGAVKTFRLLAEEEQQPPAQAAD* |
Ga0075418_110633241 | 3300009100 | Populus Rhizosphere | EEIASSANQLAEAADKLTGAVKTFRLLADTEPPASQAAD* |
Ga0066709_1004729244 | 3300009137 | Grasslands Soil | LEPSSANQLAEAADKLTGAVKSFRLLADEEPPREQAAD* |
Ga0114129_110923251 | 3300009147 | Populus Rhizosphere | ASTEEIAASANRLAEAADKLTGAVKSFRLLADEEHIPEREAAD* |
Ga0075423_115280671 | 3300009162 | Populus Rhizosphere | IASSANQLAQAADNLTATVKSFRLLADQAPEPETRQAAD* |
Ga0127489_11377783 | 3300010127 | Grasslands Soil | VNQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD* |
Ga0134088_100466221 | 3300010304 | Grasslands Soil | QTASTEEIASSANQLAEAADKLTGAVKTFRLLKDEERRSEQAAD* |
Ga0134088_101534842 | 3300010304 | Grasslands Soil | ASTEEIASSANQLAEAADKLTGAVKSFRLLADEAPPPQQQAAD* |
Ga0134109_100671312 | 3300010320 | Grasslands Soil | ASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD* |
Ga0134109_102131661 | 3300010320 | Grasslands Soil | SANQLAEAADKLTGAVKSFRLLADEEPPPERQAAD* |
Ga0134109_103910601 | 3300010320 | Grasslands Soil | TEEIASSANQLADAADRLTGAVKSFRLLADEPQQEQAAD* |
Ga0134067_101719891 | 3300010321 | Grasslands Soil | TEEIASSANQLAEAADKLTGAVKSFRLLADEEPPRQQAAD* |
Ga0134084_102595401 | 3300010322 | Grasslands Soil | TEEIASSANQLAEAADKLQGAVKSFRLLQDEVVEPTRQAAD* |
Ga0134084_103820942 | 3300010322 | Grasslands Soil | TEEIASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD* |
Ga0134086_101274152 | 3300010323 | Grasslands Soil | STEEIASSANQLAEAADKLTGAVKSFRLLADEAPPPERQAAD* |
Ga0134065_101313932 | 3300010326 | Grasslands Soil | QSASTQEIASSANQLAEASDRLTGAVKSFRLLADEEPPARQAAD* |
Ga0134080_100145271 | 3300010333 | Grasslands Soil | EQSASTEEIASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD* |
Ga0134080_100713032 | 3300010333 | Grasslands Soil | SQQQSASTQEIASSANQLAEASDRLTGAVKSFRLLADEAPPARQAAD* |
Ga0134080_100728261 | 3300010333 | Grasslands Soil | STEEIASSANQLAEAADRLTGAVKSFRLLADEVQQAAD* |
Ga0134071_101291881 | 3300010336 | Grasslands Soil | ANQLAEAADKLQGAVKTFRLLQDEPEEPTRQAAD* |
Ga0134071_104144141 | 3300010336 | Grasslands Soil | EQSASTEEIASSANQLAEAADRLTGAVKSFRLLADEATPPPEQQAAD* |
Ga0137349_10516151 | 3300012160 | Soil | EQTASTQEVASSANQLAEAADRLTGAVQSFRLLAEEQDPAREAAAD* |
Ga0137364_100924393 | 3300012198 | Vadose Zone Soil | SANQLAEAADKLTGAVKSFRLLADEEPPREQAAD* |
Ga0137364_101833042 | 3300012198 | Vadose Zone Soil | SSANQLAEAADKLTGAVKSFRLLADEEPPREQAAD* |
Ga0137364_108289091 | 3300012198 | Vadose Zone Soil | QSASTEEIASSANQLAEAADRLTGAVKSFRLLADEVQQAAD* |
Ga0137382_100739483 | 3300012200 | Vadose Zone Soil | SSANQLAEAADKLTGAVKSFRLLADEVPPPERQAAD* |
Ga0137382_101606341 | 3300012200 | Vadose Zone Soil | SSANQLAEAADRLTGAVKSCRLLADEQQQQQAAD* |
Ga0137382_105524162 | 3300012200 | Vadose Zone Soil | IASSANQLAEAADRLTGAVKSFRLLADEVQQAAD* |
Ga0137382_109985292 | 3300012200 | Vadose Zone Soil | TEEIASSANQLAEAADRLTGAVKSFRLLADEVQQAAD* |
Ga0137382_111231491 | 3300012200 | Vadose Zone Soil | TQEIAASANQLAEAADKLSDAVKSFRLLADAAAPEPPAREAAD* |
Ga0137380_105622781 | 3300012206 | Vadose Zone Soil | QTASTQEIAASANQLAEAADKLSDAVKSFRLLAEQASVPPLGSPTQEAAD* |
Ga0137376_100612641 | 3300012208 | Vadose Zone Soil | ANQLAEAADKLTGAVKSFRLLADEVPPPERQAAD* |
Ga0137376_101398862 | 3300012208 | Vadose Zone Soil | EEQSASTQEIAASANRLAEAADKLSDAVKSFRLLADAAAPEPPAREAAD* |
Ga0137376_106685052 | 3300012208 | Vadose Zone Soil | STQEIAASANQLAEAADKLSDAVKSFRLLADEVAPGPPAREAAD* |
Ga0137377_101005285 | 3300012211 | Vadose Zone Soil | SGQEQSASTQEIAASANRLAEAADKLTGAVKSFRLLSDEEQPPPAEREAAD* |
Ga0137372_106010462 | 3300012350 | Vadose Zone Soil | SSANQLAEAADRLTGAVKSFRLLADEPQQQQAAD* |
Ga0137386_100782491 | 3300012351 | Vadose Zone Soil | EIASSANQLAEASDRLTGAVKSFRLLADEEPPVQREAAD* |
Ga0137367_102062311 | 3300012353 | Vadose Zone Soil | SASTEEIASSANQLAEASDRLTGAVKSFRLLADEAPPPERQAAD* |
Ga0137366_100358981 | 3300012354 | Vadose Zone Soil | SASTEEIASSANQLAEAADKLQGAVKSFRLLQDEVVEPTRQAAD* |
Ga0137366_102091162 | 3300012354 | Vadose Zone Soil | SSANQLADAADKLTGAVKSFRLLADEEPPQRQAAD* |
Ga0137368_100966043 | 3300012358 | Vadose Zone Soil | EEIASSANQLAEAADKLTGAVKSFRLFADEEAPPQPQAAD* |
Ga0137368_101609811 | 3300012358 | Vadose Zone Soil | EAADRLTGAVKSFRLLADEAAAPPPAPPERQAAG* |
Ga0137385_101306903 | 3300012359 | Vadose Zone Soil | EIASSANQLAEAADRLQGAVKTFRLLQDEAVEPTRQAAD* |
Ga0137375_1000809413 | 3300012360 | Vadose Zone Soil | STEEIASSANQLAEAADKLTGAVKSFRLFADEEAPPQPQAAD* |
Ga0134055_11129122 | 3300012401 | Grasslands Soil | EIASSANQLAEAADRLTGAVKSFRLLADEQQQQQAAD* |
Ga0137359_112392481 | 3300012923 | Vadose Zone Soil | SASTEEIASSANQLAEAADKLTGAVKSFRLLADEAPPPQQQAAD* |
Ga0137416_101949942 | 3300012927 | Vadose Zone Soil | ASTQEIASSANQLAEAADKLTGAVKTFRLLAEEEQQPPAQAAD* |
Ga0134076_100094891 | 3300012976 | Grasslands Soil | ASSANQLAEAADRLTGAVKSFRLLADEVPPPERQAAD* |
Ga0157378_116195851 | 3300013297 | Miscanthus Rhizosphere | EEIASSANQLAEAADKLTGAVKSFRLLADEQQDRQQAAD* |
Ga0134078_106446241 | 3300014157 | Grasslands Soil | TEEIASSANQLAEAADKLTGAVKSFRLLADEVPPPERQAAD* |
Ga0134078_106732922 | 3300014157 | Grasslands Soil | EIASSANQLAEAADRLTGAVKSFRLLADEANPPPEQQAAD* |
Ga0134079_107488792 | 3300014166 | Grasslands Soil | STEEIASSANQLAEAADKLTGAVKSFRLLADEEPPRQQAAD* |
Ga0134073_100210911 | 3300015356 | Grasslands Soil | ASTEEIASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD* |
Ga0134089_100678721 | 3300015358 | Grasslands Soil | EIASSANQLAEASDRLTGAVKSFRLLADEEPPARQAAD* |
Ga0134085_102696691 | 3300015359 | Grasslands Soil | QQSASTEEIASSANQLAEAADKLTGAVKSFRLLADEVPPPERQAAD* |
Ga0134085_103196731 | 3300015359 | Grasslands Soil | EIASSANQLAEAADKLQGAVKTFRLLQDEAVEPTRQAAD* |
Ga0132258_104815854 | 3300015371 | Arabidopsis Rhizosphere | ANQLAEAADRLTGAVKSFRLLADETTPPEQQAAD* |
Ga0134074_12000221 | 3300017657 | Grasslands Soil | QSASTEEIASSANQLAEAADKLTGAVKSFRLLADEAPPPERQAAD |
Ga0134083_104800201 | 3300017659 | Grasslands Soil | EIASSANQLAEASDRLTGAVKSFRLLADEEPPARQAAD |
Ga0184623_100378103 | 3300018056 | Groundwater Sediment | SSANQLAEAADRLTGAVKSFRLLADEQQPQQQAAD |
Ga0184623_100718721 | 3300018056 | Groundwater Sediment | TEEIASSANQLAEAADRLTGAVKSFRLLADEQQQQQAAD |
Ga0184639_101989973 | 3300018082 | Groundwater Sediment | GEEQSASTQEIASSANQLAEAADRLTGAVKSFRLLADEGQPPEREAAD |
Ga0066655_102589212 | 3300018431 | Grasslands Soil | ASTEEIASSANQLAEAADRLTGAVKSFRLLADEVPPPERQAAD |
Ga0066667_100101204 | 3300018433 | Grasslands Soil | LEPSSANQLAEAADKLTGAVKSFRLLADEEPPREQAAD |
Ga0066667_102234021 | 3300018433 | Grasslands Soil | EIASSANQLAEAADKLTGAVKSFRLLADEVPPPERQAAD |
Ga0066667_121577031 | 3300018433 | Grasslands Soil | EEQSASTEEIASSANQLAEAADKLTGAVKSFRLLADEEPPPERQAAD |
Ga0066669_104691911 | 3300018482 | Grasslands Soil | TEEIASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD |
Ga0193739_10271372 | 3300020003 | Soil | ASTEEIASSANQLAEAAEKLTGAIKSFRLFADDEPATRQAAD |
Ga0210379_102633443 | 3300021081 | Groundwater Sediment | STQEVASSANQLAEAADRLTGAVQSFRLLAEEQDPAREAAAD |
Ga0179596_103903902 | 3300021086 | Vadose Zone Soil | TEEIASSANQLAEAADRLTGAVKSFRLLADEPQQQQAAD |
Ga0193719_102978351 | 3300021344 | Soil | STEEIAASANRLAEAADKLTGAVKSFRLLSDEELPPAQAAD |
Ga0126371_135832131 | 3300021560 | Tropical Forest Soil | TQEIASSANQLATAADSLTGAVQTFRLMADETRQEAAD |
Ga0209641_104366601 | 3300025322 | Soil | QSASTQEIASSANQLAEASDRLTSAVKSFRLLGENEEPPQREAAD |
Ga0209236_10190405 | 3300026298 | Grasslands Soil | ASTEEIASSANQLAEAADKLQGAVKTFRLLQDEAVEPTRQAAD |
Ga0209238_11811102 | 3300026301 | Grasslands Soil | QSASTEEIASSANQLAEAADRLTGAVKSFRLLADEQQEQAAD |
Ga0209469_10074176 | 3300026307 | Soil | EEIASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD |
Ga0209469_10518691 | 3300026307 | Soil | IASSANQLAEASDRLTGAVKSFRLLADEEPPARQAAD |
Ga0209265_10971601 | 3300026308 | Soil | EIASSANQLAEAADELTGAVKSFRLLADEEPPRQQAAD |
Ga0209761_100335112 | 3300026313 | Grasslands Soil | IASSANRLAEAADKLTGAVKTFRLLAEEEQQPPAQAAD |
Ga0209155_11743192 | 3300026316 | Soil | TEEIASSANQLAEAADKLTGAVKSFRLLADEVPPPERQAAD |
Ga0209472_11214732 | 3300026323 | Soil | ANQLAEAADRLTGAVKSFRLLADEATPPPEQQAAD |
Ga0209267_12901912 | 3300026331 | Soil | ASTEEIASSANQLAEAADKLTGAVKSFRLLADEEPPRQAAD |
Ga0209803_10621122 | 3300026332 | Soil | ASSANQLAEASDRLTGAVKSFRLLADEEPPARQAAD |
Ga0209057_12006521 | 3300026342 | Soil | SANQLAEAADKLTGAVKSFRLLADEVPPPERQAAD |
Ga0209159_11435382 | 3300026343 | Soil | ASTEEIASSANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD |
Ga0209806_11194102 | 3300026529 | Soil | EIASSANQLAEAADKLTGAVKSFRLLADEEPPPERQAAD |
Ga0209058_10148927 | 3300026536 | Soil | STEEIASSANQLAEAADRLTGAVKSFRLLADEVPPPERQAAD |
Ga0209161_104719512 | 3300026548 | Soil | EEQTASTEEIASSANQLAEAADKLTGAVKTFRLLKDEGQRTEQAAD |
Ga0209886_10745921 | 3300027273 | Groundwater Sand | ASTQEIASSANQLAEASDRLTSAVKSFRLLAEDEEPAQRQAAD |
Ga0208993_10054681 | 3300027480 | Forest Soil | SANQLAEAADKLTGAVKSFRLLADEEPPPQQQAAD |
Ga0209178_11299161 | 3300027725 | Agricultural Soil | SASTQEIASSANQLAEAADKLTGAVKSFRLLADEEPPHQQAAD |
Ga0209073_101869512 | 3300027765 | Agricultural Soil | QEQSASTQEIASSANQLAEAADKLTGAVKSFRLLADEESPHQQAAD |
Ga0209074_101230371 | 3300027787 | Agricultural Soil | GEEQSASTEEIASSANQLAEAADRLTGAVKSFRLLADEVQPQAAD |
Ga0209074_102123252 | 3300027787 | Agricultural Soil | STQEIASSANQLAEAADKLTGAVKSFRLLADEEPPHQQAAD |
Ga0209180_101808351 | 3300027846 | Vadose Zone Soil | SASTEEIASSANQLAEAADKLTGAVKTFRLLKDEEQRTEQAAD |
Ga0209283_100110097 | 3300027875 | Vadose Zone Soil | ASSANQLAEAADKLTGAVKTFRLLAEEEQQPPAQAAD |
Ga0326729_10012465 | 3300033432 | Peat Soil | SSEQQSASTQEIASSANQLAEAADRLQGAVKTFRIVADAT |
Ga0326731_10951422 | 3300033502 | Peat Soil | NQLAEAADRLTGAVQSFRLLATDQSPPPPVQEAAD |
Ga0364930_0318232_387_521 | 3300033814 | Sediment | ASTEEIASSANRLAEAADKLTGAVKSFRLLADEEQQPPDRAAAD |
⦗Top⦘ |