Basic Information | |
---|---|
Family ID | F054807 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 139 |
Average Sequence Length | 41 residues |
Representative Sequence | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATVVSQS |
Number of Associated Samples | 117 |
Number of Associated Scaffolds | 139 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 99.24 % |
% of genes near scaffold ends (potentially truncated) | 94.24 % |
% of genes from short scaffolds (< 2000 bps) | 81.29 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (69.065 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (23.741 % of family members) |
Environment Ontology (ENVO) | Unclassified (64.748 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (74.101 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.85% β-sheet: 3.08% Coil/Unstructured: 83.08% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 139 Family Scaffolds |
---|---|---|
PF10124 | Mu-like_gpT | 46.04 |
PF07460 | NUMOD3 | 1.44 |
PF03237 | Terminase_6N | 1.44 |
PF13640 | 2OG-FeII_Oxy_3 | 0.72 |
PF00583 | Acetyltransf_1 | 0.72 |
PF01844 | HNH | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 69.06 % |
All Organisms | root | All Organisms | 30.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001839|RCM40_1059726 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 920 | Open in IMG/M |
3300002092|JGI24218J26658_1029565 | Not Available | 679 | Open in IMG/M |
3300002307|JGI24890J29729_1077417 | Not Available | 530 | Open in IMG/M |
3300002835|B570J40625_100305630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1609 | Open in IMG/M |
3300003393|JGI25909J50240_1084020 | Not Available | 636 | Open in IMG/M |
3300003815|Ga0007856_1001375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caulobacter phage RW | 2517 | Open in IMG/M |
3300004448|Ga0065861_1214967 | Not Available | 709 | Open in IMG/M |
3300004769|Ga0007748_11647197 | Not Available | 679 | Open in IMG/M |
3300004770|Ga0007804_1102688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria brasiliensis | 727 | Open in IMG/M |
3300004774|Ga0007794_10177592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300005528|Ga0068872_10019763 | Not Available | 4540 | Open in IMG/M |
3300005581|Ga0049081_10038659 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
3300006641|Ga0075471_10006558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → Micavibrio | 7406 | Open in IMG/M |
3300006805|Ga0075464_10336146 | Not Available | 912 | Open in IMG/M |
3300007551|Ga0102881_1216446 | Not Available | 530 | Open in IMG/M |
3300007561|Ga0102914_1142960 | Not Available | 740 | Open in IMG/M |
3300007600|Ga0102920_1123556 | Not Available | 826 | Open in IMG/M |
3300007636|Ga0102856_1038132 | Not Available | 742 | Open in IMG/M |
3300007974|Ga0105747_1342434 | Not Available | 511 | Open in IMG/M |
3300008117|Ga0114351_1021991 | All Organisms → Viruses → Predicted Viral | 4266 | Open in IMG/M |
3300008267|Ga0114364_1188046 | Not Available | 521 | Open in IMG/M |
3300009059|Ga0102830_1166861 | Not Available | 645 | Open in IMG/M |
3300009068|Ga0114973_10219658 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
3300009152|Ga0114980_10610868 | Not Available | 615 | Open in IMG/M |
3300009154|Ga0114963_10174433 | Not Available | 1259 | Open in IMG/M |
3300009154|Ga0114963_10447502 | Not Available | 694 | Open in IMG/M |
3300009154|Ga0114963_10547024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300009155|Ga0114968_10443119 | Not Available | 704 | Open in IMG/M |
3300009158|Ga0114977_10118314 | Not Available | 1598 | Open in IMG/M |
3300009164|Ga0114975_10009963 | Not Available | 5941 | Open in IMG/M |
3300009175|Ga0073936_10776442 | Not Available | 522 | Open in IMG/M |
3300009180|Ga0114979_10121721 | Not Available | 1606 | Open in IMG/M |
3300009181|Ga0114969_10361612 | Not Available | 840 | Open in IMG/M |
3300009182|Ga0114959_10564453 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 545 | Open in IMG/M |
3300009184|Ga0114976_10254704 | Not Available | 950 | Open in IMG/M |
3300010156|Ga0068873_1025040 | Not Available | 610 | Open in IMG/M |
3300010160|Ga0114967_10556894 | Not Available | 555 | Open in IMG/M |
3300010354|Ga0129333_11578739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300012663|Ga0157203_1054362 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 540 | Open in IMG/M |
3300012665|Ga0157210_1071271 | Not Available | 524 | Open in IMG/M |
3300013006|Ga0164294_10292650 | All Organisms → Viruses → Predicted Viral | 1131 | Open in IMG/M |
3300013006|Ga0164294_10347254 | Not Available | 1022 | Open in IMG/M |
3300013285|Ga0136642_1185220 | Not Available | 508 | Open in IMG/M |
3300014960|Ga0134316_1013621 | Not Available | 878 | Open in IMG/M |
3300014967|Ga0182827_10017704 | Not Available | 726 | Open in IMG/M |
3300017722|Ga0181347_1130337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 698 | Open in IMG/M |
3300017736|Ga0181365_1077707 | Not Available | 814 | Open in IMG/M |
3300017736|Ga0181365_1095875 | Not Available | 720 | Open in IMG/M |
3300017747|Ga0181352_1174430 | Not Available | 560 | Open in IMG/M |
3300017754|Ga0181344_1109519 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 799 | Open in IMG/M |
3300017754|Ga0181344_1134024 | Not Available | 710 | Open in IMG/M |
3300017761|Ga0181356_1036767 | All Organisms → Viruses → Predicted Viral | 1734 | Open in IMG/M |
3300017766|Ga0181343_1021609 | Not Available | 1984 | Open in IMG/M |
3300017774|Ga0181358_1067077 | Not Available | 1329 | Open in IMG/M |
3300017774|Ga0181358_1074590 | Not Available | 1247 | Open in IMG/M |
3300017774|Ga0181358_1095557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
3300017774|Ga0181358_1199395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300017777|Ga0181357_1337066 | Not Available | 504 | Open in IMG/M |
3300017778|Ga0181349_1152072 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 831 | Open in IMG/M |
3300017780|Ga0181346_1004536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6054 | Open in IMG/M |
3300017785|Ga0181355_1264514 | Not Available | 656 | Open in IMG/M |
3300019781|Ga0181360_120062 | Not Available | 542 | Open in IMG/M |
3300020543|Ga0208089_1049180 | Not Available | 557 | Open in IMG/M |
3300020550|Ga0208600_1040737 | Not Available | 710 | Open in IMG/M |
3300021115|Ga0214174_100199 | All Organisms → Viruses | 6718 | Open in IMG/M |
3300021519|Ga0194048_10074007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1337 | Open in IMG/M |
3300021602|Ga0194060_10617991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300021961|Ga0222714_10480496 | Not Available | 641 | Open in IMG/M |
3300021962|Ga0222713_10847244 | Not Available | 506 | Open in IMG/M |
3300022173|Ga0181337_1015976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1001 | Open in IMG/M |
3300022190|Ga0181354_1239947 | Not Available | 521 | Open in IMG/M |
3300022407|Ga0181351_1065003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1491 | Open in IMG/M |
3300022407|Ga0181351_1068845 | Not Available | 1437 | Open in IMG/M |
3300022407|Ga0181351_1238399 | Not Available | 576 | Open in IMG/M |
3300022752|Ga0214917_10262413 | Not Available | 796 | Open in IMG/M |
3300022929|Ga0255752_10390008 | Not Available | 553 | Open in IMG/M |
3300023174|Ga0214921_10099213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2196 | Open in IMG/M |
3300024504|Ga0255179_1034630 | Not Available | 724 | Open in IMG/M |
3300024848|Ga0255229_1002496 | All Organisms → Viruses → Predicted Viral | 2475 | Open in IMG/M |
3300024862|Ga0256317_1101275 | Not Available | 632 | Open in IMG/M |
3300025451|Ga0208426_1077947 | Not Available | 511 | Open in IMG/M |
3300025578|Ga0208864_1109692 | Not Available | 639 | Open in IMG/M |
3300025616|Ga0208613_1108876 | Not Available | 626 | Open in IMG/M |
3300025896|Ga0208916_10187734 | Not Available | 893 | Open in IMG/M |
3300026429|Ga0255253_1060731 | Not Available | 608 | Open in IMG/M |
3300027125|Ga0255106_1004091 | Not Available | 2590 | Open in IMG/M |
3300027147|Ga0255113_1043223 | Not Available | 886 | Open in IMG/M |
3300027210|Ga0208802_1060313 | Not Available | 511 | Open in IMG/M |
3300027292|Ga0255134_1000506 | Not Available | 9349 | Open in IMG/M |
3300027367|Ga0208801_1008911 | All Organisms → Viruses → Predicted Viral | 1748 | Open in IMG/M |
3300027589|Ga0255123_1001589 | All Organisms → Viruses | 6596 | Open in IMG/M |
3300027656|Ga0209357_1080286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
3300027659|Ga0208975_1219143 | Not Available | 501 | Open in IMG/M |
3300027688|Ga0209553_1187733 | Not Available | 679 | Open in IMG/M |
3300027697|Ga0209033_1024722 | All Organisms → Viruses → Predicted Viral | 2384 | Open in IMG/M |
3300027708|Ga0209188_1168376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
3300027741|Ga0209085_1393785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300027749|Ga0209084_1017338 | Not Available | 4013 | Open in IMG/M |
3300027749|Ga0209084_1020043 | Not Available | 3641 | Open in IMG/M |
3300027754|Ga0209596_1202466 | Not Available | 845 | Open in IMG/M |
3300027763|Ga0209088_10044816 | All Organisms → Viruses → Predicted Viral | 2170 | Open in IMG/M |
3300027763|Ga0209088_10234968 | Not Available | 768 | Open in IMG/M |
3300027763|Ga0209088_10245929 | Not Available | 745 | Open in IMG/M |
3300027772|Ga0209768_10315755 | Not Available | 651 | Open in IMG/M |
3300027777|Ga0209829_10404661 | Not Available | 528 | Open in IMG/M |
3300027782|Ga0209500_10096596 | Not Available | 1470 | Open in IMG/M |
3300027785|Ga0209246_10297266 | Not Available | 620 | Open in IMG/M |
3300027896|Ga0209777_10369495 | Not Available | 1087 | Open in IMG/M |
3300027969|Ga0209191_1034679 | All Organisms → Viruses → Predicted Viral | 2397 | Open in IMG/M |
3300027969|Ga0209191_1117090 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
3300027971|Ga0209401_1130186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1003 | Open in IMG/M |
3300028392|Ga0304729_1127187 | Not Available | 841 | Open in IMG/M |
3300028393|Ga0304728_1214916 | Not Available | 660 | Open in IMG/M |
3300028393|Ga0304728_1251821 | Not Available | 591 | Open in IMG/M |
3300028393|Ga0304728_1269849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300028394|Ga0304730_1290672 | Not Available | 568 | Open in IMG/M |
3300030339|Ga0311360_10613196 | Not Available | 869 | Open in IMG/M |
3300031673|Ga0307377_10503317 | Not Available | 882 | Open in IMG/M |
3300031673|Ga0307377_10530216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300031707|Ga0315291_10899990 | Not Available | 757 | Open in IMG/M |
3300031707|Ga0315291_11069359 | Not Available | 672 | Open in IMG/M |
3300031746|Ga0315293_10709293 | Not Available | 748 | Open in IMG/M |
3300031952|Ga0315294_10645239 | Not Available | 939 | Open in IMG/M |
3300031997|Ga0315278_11542832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300031999|Ga0315274_10486131 | Not Available | 1401 | Open in IMG/M |
3300031999|Ga0315274_11532550 | Not Available | 631 | Open in IMG/M |
3300032018|Ga0315272_10701775 | Not Available | 515 | Open in IMG/M |
3300032053|Ga0315284_10458167 | Not Available | 1558 | Open in IMG/M |
3300032093|Ga0315902_10098076 | Not Available | 3181 | Open in IMG/M |
3300034068|Ga0334990_0000131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 44204 | Open in IMG/M |
3300034103|Ga0335030_0324690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
3300034105|Ga0335035_0218567 | Not Available | 1164 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 23.74% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 23.74% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.47% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.04% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.04% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.60% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.60% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.88% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.44% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.44% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.44% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.44% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.44% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.44% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.44% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.44% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.72% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.72% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.72% |
Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat | 0.72% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.72% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.72% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.72% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.72% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.72% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.72% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.72% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010156 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300014960 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 | Environmental | Open in IMG/M |
3300014967 | Freshwater microbial mat microbial communities from Canadian High Arctic Lake 9K, Kuujjuarapik, Canada - Sample L9Ka | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020679 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUN2008 hypolimnion | Environmental | Open in IMG/M |
3300021115 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 epilimnion | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022173 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.D.D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024504 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8d | Environmental | Open in IMG/M |
3300024848 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024862 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026429 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027125 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027210 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes) | Environmental | Open in IMG/M |
3300027292 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8d | Environmental | Open in IMG/M |
3300027367 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027589 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8d | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM40_10597262 | 3300001839 | Marine Plankton | MGFATHLGPWLLGTVKNTTGTIPQYGQVRNTGATLVSQTFKRNYSGVTTAGV |
JGI24218J26658_10295651 | 3300002092 | Lentic | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATEVVQEA |
JGI24890J29729_10774171 | 3300002307 | Lentic | MALATHLGSWLLGTVKNTTGTTAGTIRNVGFTQSAQNAVVA |
B570J40625_1003056303 | 3300002835 | Freshwater | MAFASHLGPWLLGTVKNTTGTTAGTIRNMGATVVGQTDAI |
JGI25909J50240_10840201 | 3300003393 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTVGTIENLGSTIVSQTFKKNYTGQAASATTD |
Ga0007856_10013753 | 3300003815 | Freshwater | MSFATHLGPWLLGTVKNTTGTVAGTIRNTGVTSVGQTDPVTYFCWSN* |
Ga0065861_12149672 | 3300004448 | Marine | MGFATHLGPWLLGTIKYTTGTTVGNIRNTGATLVSQTFKKDYTGQAA |
Ga0007748_116471972 | 3300004769 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTVGTIENLGSTIVSQTFKK |
Ga0007804_11026881 | 3300004770 | Freshwater | MSFATHLGPWLLGTVKNTTGTVAGTIRNTGVTSVGQTDPVAY |
Ga0007794_101775923 | 3300004774 | Freshwater | MGLASHLGPWLLGTVKNTTGSTAGTLRNMGATLVAQSIPVLY |
Ga0068872_100197636 | 3300005528 | Freshwater Lake | MGFASHLGPWLLGTVKNTTGTTAGTIRNMGATVVSQSADVVFGT |
Ga0049081_100386593 | 3300005581 | Freshwater Lentic | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATVVSQTFKKDYTGQ |
Ga0075471_100065589 | 3300006641 | Aqueous | MAFASHLGPWLLGTVKNTTGTTPGTVRNMGATIVAQQVPLVAGSAV |
Ga0075464_103361461 | 3300006805 | Aqueous | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATVVSQTFKKNYAGQ |
Ga0102881_12164462 | 3300007551 | Estuarine | MGFATHLGPWLLGTVKNTTGSTAGTIRNMGATIVSQSVAIGTSGTA |
Ga0102914_11429601 | 3300007561 | Estuarine | MGFATHLGPWLLGTVKNTTGTTVGTIENLGSTIVSQTF |
Ga0102920_11235562 | 3300007600 | Estuarine | MGFATHLGPWLLGTVKNTTGTTVGTIENLGSTIVSQTFKKNYTGQAASATT |
Ga0102856_10381322 | 3300007636 | Estuarine | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATMVAQSKAILYTD |
Ga0105747_13424341 | 3300007974 | Estuary Water | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATIVTQSKA |
Ga0114351_10219911 | 3300008117 | Freshwater, Plankton | MGFATHLGPWLLGTVKNTTGTTSGTIRNMGATTVSQSANVVFGT |
Ga0114364_11880461 | 3300008267 | Freshwater, Plankton | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATVVSQTFKKNYAGQAAS |
Ga0102830_11668612 | 3300009059 | Estuarine | MGIASHLGSWLLGTVKNTTGTTAGPVRNLGATTVA |
Ga0114973_102196581 | 3300009068 | Freshwater Lake | MGFASHLGPWLLGTNKYTTGTTAGTIQNMGATVVAQTDTT |
Ga0114980_106108682 | 3300009152 | Freshwater Lake | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATMVSQTFKKNYAGQA |
Ga0114963_100440925 | 3300009154 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTVQNTGCTIVAQTFNLTAAQV |
Ga0114963_101744332 | 3300009154 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTVGNIRNTGATLVSQTFKKDYTG |
Ga0114963_104475021 | 3300009154 | Freshwater Lake | MGFASHLGPWLLGTNKYTTGTTAGTIQNMGATTVAQTGTMTV |
Ga0114963_105470241 | 3300009154 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATVVTQSVPI |
Ga0114968_104431191 | 3300009155 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATVVTQSK |
Ga0114977_101183143 | 3300009158 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTVRNMGATIVAQTYTAPT |
Ga0114975_100099638 | 3300009164 | Freshwater Lake | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATMVSQTFKKNYTG |
Ga0073936_107764422 | 3300009175 | Freshwater Lake Hypolimnion | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATIVSQSY |
Ga0114979_101217213 | 3300009180 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIQNTGTTLVSQ |
Ga0114969_103616122 | 3300009181 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTVGTIDNLGVTIVSQTFKKDY |
Ga0114959_105644531 | 3300009182 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNTGATLVSQ |
Ga0114976_102547042 | 3300009184 | Freshwater Lake | MGFATHLGPWLLGTVKSTTGTTAGTIRNMGATIVSQSIAIGTSGT |
Ga0068873_10250402 | 3300010156 | Freshwater Lake | MGFATHLGPWLLGTVKNTSGTTAGTIRNTGCTAVVQSAA |
Ga0114967_105568941 | 3300010160 | Freshwater Lake | MGFATHLGPWLLGTVKDTTGTTVGTIRNMGATVVSQTGITTV |
Ga0129333_115787391 | 3300010354 | Freshwater To Marine Saline Gradient | MGFASHLGPWLLGTVKNTTGTTAGTIRNMGATIVAQTYTAPASVIL |
Ga0157203_10543621 | 3300012663 | Freshwater | MGFATHLGPWLLGTVKNTTGTTVGTIENLGATVVSQTFKKDYTG |
Ga0157210_10712712 | 3300012665 | Freshwater | MGFATHLGPWLLGTVKNTTGTTSGTVRNLGATVVAQTIPVTFSTFSN |
Ga0164294_102926502 | 3300013006 | Freshwater | MGFASHLGPWLLGTNKYTTGTTAGTIQNMGATVVAQTD |
Ga0164294_103472541 | 3300013006 | Freshwater | MGFATHLGPWLLGTVKNTTGTTAGTVRNTGCTVVAQS |
Ga0136642_11852201 | 3300013285 | Freshwater | MGFATHLGPWLLGTVKNTTGTTAGNIRNMGVTNVSQI |
Ga0134316_10136211 | 3300014960 | Surface Water | MGLATHLGPWLLGTVKDTTGTTAGTVRNIGAATVSQFKTIAYN |
Ga0182827_100177042 | 3300014967 | Microbial Mat | MGFASHLGPWLLGTNKYTTGTTAGTLQNMGATIVLQAGSY |
Ga0181347_11303371 | 3300017722 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNLGATIVAQT |
Ga0181365_10777072 | 3300017736 | Freshwater Lake | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATVVSQTFKKN |
Ga0181365_10958752 | 3300017736 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNLGATIVSQSY |
Ga0181352_11744302 | 3300017747 | Freshwater Lake | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATVVS |
Ga0181344_11095191 | 3300017754 | Freshwater Lake | MGLATHLGPWLLGTVKETTGTTAGTIRNIGATEVTQTVTLSF |
Ga0181344_11340241 | 3300017754 | Freshwater Lake | MVFASHLGPWLLGTVKNTTGTTAGTLRNMGNTIFSFP |
Ga0181356_10367673 | 3300017761 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGATSGTIRNLGATVVSQSKAILYTD |
Ga0181343_10216091 | 3300017766 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTVGTIENLGATVVSQTFKK |
Ga0181358_10670773 | 3300017774 | Freshwater Lake | MGFATHLGPWLVGTVRNTTGTTVGTIENCGATVCSQTFKK |
Ga0181358_10745901 | 3300017774 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNTGATVVSQSKAILYTD |
Ga0181358_10955572 | 3300017774 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNTGATVVSQSKAILY |
Ga0181358_11993952 | 3300017774 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATVVSQS |
Ga0181357_13370662 | 3300017777 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTSGTIRNLGATVVSQSKAILYT |
Ga0181349_11520723 | 3300017778 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTVGTIENLGATVVSQTFKKD |
Ga0181346_10045361 | 3300017780 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNTGATVVSQSKAI |
Ga0181355_12645142 | 3300017785 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNLGATIVTQTKSILYTDIT |
Ga0181355_13311982 | 3300017785 | Freshwater Lake | MGLASHLGPWRLGTVLNTTGTTAGTINNMGATIVAQKAAIAYGTTS |
Ga0181360_1200621 | 3300019781 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATTVSQSVDVVFGTL |
Ga0208089_10491801 | 3300020543 | Freshwater | MGLASHFGPWRLGTVPNTTGTTAGTIRNMGATIVA |
Ga0208600_10407372 | 3300020550 | Freshwater | MGFATHLGPWLLGTVKNTTGTTVGSIENLGATIVSQTFKKNY |
Ga0208053_10050395 | 3300020575 | Freshwater | MAFATHLGPWMLGTVKETTGTTAGTIRNTGLTSSFQTIKLNMVGAV |
Ga0214232_1054413 | 3300020679 | Freshwater | MAFATRLGPWLLGTVKNTTGATAGTINNLGATTVAQTYNLTAAQ |
Ga0214174_1001991 | 3300021115 | Freshwater | MKETTMGLATHLGPWLLGTVKNTTGTVAGTIRNTGV |
Ga0194048_100740073 | 3300021519 | Anoxic Zone Freshwater | MGFATHLGPWLLGTVKSTTGTTAGTIRNLGNTIVSQSYTAPTSVI |
Ga0194060_106179911 | 3300021602 | Anoxic Zone Freshwater | MGFATHLGPWLLGTVKNTTGTTAGTIQNTGATLVSQTKKVVYTG |
Ga0222714_104804961 | 3300021961 | Estuarine Water | MGFATHLGPWLLGTVKNTTGTTAGTLRNMGATVVSQSK |
Ga0222713_108472442 | 3300021962 | Estuarine Water | MGFASHLGPWLLGTVKNTTGTTAGTIRNMGATTVAQTYTAPASV |
Ga0181337_10159761 | 3300022173 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNLGATIVSQSYTAATAT |
Ga0181353_10698253 | 3300022179 | Freshwater Lake | MAFATHLGPWLLGTVRNTTGTTVGTIENLGATVVAQTKKINMVGQTS |
Ga0181354_12399471 | 3300022190 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNLGATVVSQ |
Ga0181351_10650031 | 3300022407 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGSTSGTIRNLGATVVSQS |
Ga0181351_10688453 | 3300022407 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTVGTIENLGSTIVSQTFKKDYT |
Ga0181351_12383992 | 3300022407 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNLGATVVSQSKA |
Ga0214917_102624132 | 3300022752 | Freshwater | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGVTIVSQSYTA |
Ga0255752_103900081 | 3300022929 | Salt Marsh | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATVVSQTFKKNY |
Ga0214921_100992131 | 3300023174 | Freshwater | MGFATHLGPWLLGTVKNTTGTTAGTIQNTGVTLVSQTKKVNYTN |
Ga0255179_10346302 | 3300024504 | Freshwater | MGFATHLGPWLLGTVKNTTGTTAGTIRNTGCTNVTQNATIA |
Ga0255229_10024965 | 3300024848 | Freshwater | MGFATHLGPWLLGTVKNTTGSTAGTIRNMGATIVSQSVAIGTSG |
Ga0256317_11012751 | 3300024862 | Freshwater | MGFATHLGPWLLGTVKNTTGTTSGTVRNLGATVVAQ |
Ga0208426_10779471 | 3300025451 | Aqueous | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATVVSQTFKKNYAGQAASATTD |
Ga0208864_11096923 | 3300025578 | Freshwater | MGFATHLGPWLLGTVKNTTGTTAGTVCNTGCTVVAQSGT |
Ga0208613_11088762 | 3300025616 | Freshwater | MGFATHLGPWLLGTVKNTTGTTAGTVQNTGCTIVAQTFNLTAA |
Ga0208916_101877341 | 3300025896 | Aqueous | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATVVSQTFK |
Ga0255253_10607312 | 3300026429 | Freshwater | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATIVAQTYTA |
Ga0255106_10040911 | 3300027125 | Freshwater | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATVVSQTFKKNYTGQAASATT |
Ga0255113_10432232 | 3300027147 | Freshwater | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATIVAQTYT |
Ga0208802_10603131 | 3300027210 | Estuarine | MGFATHLGPWLLGTVKNTTGATSGTIRNLGATVVSQSK |
Ga0255134_100050612 | 3300027292 | Freshwater | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATVVSQTFKKNYTGQAASAT |
Ga0208801_10089113 | 3300027367 | Estuarine | MAFATHLGPWMLGTVKETTGTTAGTIRNTGLTSSFQ |
Ga0255123_10015899 | 3300027589 | Freshwater | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATVVSQTFKKNYTGQAA |
Ga0209357_10802862 | 3300027656 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTSGTIRNLGATVVSQSKDILYTD |
Ga0208975_12191432 | 3300027659 | Freshwater Lentic | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATIVA |
Ga0209553_11877331 | 3300027688 | Freshwater Lake | MGIASHLGSWLLGTVKNTTGTTVGTIENLGSTIVSQTFKKNYTGQAASAT |
Ga0209033_10247221 | 3300027697 | Freshwater Lake | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATVVSQTFKKDY |
Ga0209188_11683761 | 3300027708 | Freshwater Lake | MSIASHSGPWLLGTVKNTTGTTAGTLRNMGATIVAQS |
Ga0209085_13937852 | 3300027741 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATVVTQSVPIT |
Ga0209084_10173381 | 3300027749 | Freshwater Lake | MGFATHLGPWLLGTNRYSTGTTATTLANTGCTVVSQSGNVV |
Ga0209084_10200435 | 3300027749 | Freshwater Lake | MGFASHLGPWLLGTNKYTTGTTAGTIQNMGATTVAQTGTM |
Ga0209596_12024661 | 3300027754 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTVGTIDNLGVTIVSQTFKK |
Ga0209088_100448161 | 3300027763 | Freshwater Lake | MGFATHLGPWLLGTIKNTTGTTAGTIQNTGATLVAQ |
Ga0209088_102349682 | 3300027763 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATTVAQTYT |
Ga0209088_102459292 | 3300027763 | Freshwater Lake | MGFASHLGPWLLGTVKNTTGTTAGTIRNMGATIVTQTG |
Ga0209768_103157551 | 3300027772 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGDTSGTIRNLGATVVSQ |
Ga0209829_104046612 | 3300027777 | Freshwater Lake | MGFASHLGPWLLGTNKYTTGTTAGTIQNMGATTVAQTG |
Ga0209500_100965961 | 3300027782 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTVRNMGATIVAQTYTAPTS |
Ga0209246_102972661 | 3300027785 | Freshwater Lake | MGLASHFGPWRLGTVPNTTGTTAGTIRNMGATIVAQKETIAYGT |
Ga0209777_103694951 | 3300027896 | Freshwater Lake Sediment | MAFASHLGPWLLGTVKNTTGTTAGLVRNMGATSVGQTAT |
Ga0209191_10346791 | 3300027969 | Freshwater Lake | MGFATHLGPWLLGTVRNTTGTTVGTIENCGATMVSQTFKKNYAGQAASAT |
Ga0209191_11170901 | 3300027969 | Freshwater Lake | MGLASHLGPWLLGTVKNTTGSTAGTLRNMGATLVAQSV |
Ga0209401_11301861 | 3300027971 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGSIRNMGATIVAQTYTAATA |
Ga0209401_13108042 | 3300027971 | Freshwater Lake | MGFATHLGPWLLGTVKETTGTTAGSIRNLGATIVAQTATIAMSGNALTSSPVAQ |
Ga0304729_11271872 | 3300028392 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIQNTGVTLVSQTKKVNYTNAVA |
Ga0304728_12149161 | 3300028393 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATMVA |
Ga0304728_12518211 | 3300028393 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIANVGTTLVSQ |
Ga0304728_12698491 | 3300028393 | Freshwater Lake | MGFATHLGPWLLGTVRDTTGTTVGTIENCGATVVSQ |
Ga0304730_12906722 | 3300028394 | Freshwater Lake | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATVVTQSKSI |
Ga0311360_106131961 | 3300030339 | Bog | MALATHLGPWRLGTVKNTTGTTIGTLANIGLTTVVQTKQ |
Ga0307377_105033171 | 3300031673 | Soil | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATIVSQSYTA |
Ga0307377_105302161 | 3300031673 | Soil | MGFASHLGPWLLGTVKNTTGTTAGTIRNMGCTDVSQSAV |
Ga0315291_108999901 | 3300031707 | Sediment | MGFATHLGPWLLGTVKNTTGTTSGTIRNLGATVVSQSKAI |
Ga0315291_110693591 | 3300031707 | Sediment | MGFATHLGPWLLGTVKHTTGSTVGTLRNIGTTVVSQTKKLDIAGYT |
Ga0315293_107092931 | 3300031746 | Sediment | MGFATHLGPWLLGTVKNTTGTTAGSIRNMGATIVAQT |
Ga0315909_109380342 | 3300031857 | Freshwater | MGLATHLGPWLLGTVKNTTGTVAGTIRNMGATQSVQTGVTTVSDTSA |
Ga0315294_106452391 | 3300031952 | Sediment | MGFASHLGPWLLGTVKNTSGTTAGTIRNMGNTIVSQSVAVLYTDI |
Ga0315278_115428321 | 3300031997 | Sediment | MGFATHLGPWLLGTVKHTTGTTAGSLRNIGATVCSQTKKVNYAGSTAGAHADTI |
Ga0315274_104861311 | 3300031999 | Sediment | MGFATHLDPWLLGTVKNTTGTTAGTIRNLGATVVSQS |
Ga0315274_115325502 | 3300031999 | Sediment | MGFATHLGPWLLGTVKNTTGSTAGTIRNMGATTVSQSVNVVFG |
Ga0315272_107017751 | 3300032018 | Sediment | MAVATHLGPWLLGTVKDTTGTTAGTIRNIGATATAQFKA |
Ga0315284_104581673 | 3300032053 | Sediment | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATTVSQSANVVFG |
Ga0315902_100980765 | 3300032093 | Freshwater | MGFATHLGPWLLGTVKNTTGTTAGTIRNMGATIVSQQL |
Ga0334990_0000131_44082_44204 | 3300034068 | Freshwater | MGFATHLGPWLLGTVKNTTGTTVGTIENCGATVVSQTFKKN |
Ga0335030_0324690_891_1022 | 3300034103 | Freshwater | MSFASHLGPWLLGTVKNTTGTTAGTIRNMGATVVGQTDAITYAD |
Ga0335035_0218567_1050_1163 | 3300034105 | Freshwater | MAFASHLGPWLLGTVKNTTGTTAGTIRNMGATEVTQTV |
⦗Top⦘ |