NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055251

Metagenome / Metatranscriptome Family F055251

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055251
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 43 residues
Representative Sequence MKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKAQA
Number of Associated Samples 112
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 99.28 %
% of genes near scaffold ends (potentially truncated) 99.28 %
% of genes from short scaffolds (< 2000 bps) 94.96 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (55.396 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.950 % of family members)
Environment Ontology (ENVO) Unclassified
(23.022 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.043 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 55.07%    β-sheet: 0.00%    Coil/Unstructured: 44.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF07813LTXXQ 5.76
PF00839Cys_rich_FGFR 5.04
PF13545HTH_Crp_2 2.16
PF04226Transgly_assoc 1.44
PF02560Cyanate_lyase 0.72
PF12200DUF3597 0.72
PF04632FUSC 0.72
PF01557FAA_hydrolase 0.72
PF01381HTH_3 0.72
PF00072Response_reg 0.72
PF10009DUF2252 0.72
PF00111Fer2 0.72
PF17200sCache_2 0.72
PF00768Peptidase_S11 0.72
PF02518HATPase_c 0.72
PF00226DnaJ 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 23.02
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 1.44
COG1289Uncharacterized membrane protein YccCFunction unknown [S] 0.72
COG1513Cyanate lyaseInorganic ion transport and metabolism [P] 0.72
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A55.40 %
All OrganismsrootAll Organisms44.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c0672101All Organisms → cellular organisms → Bacteria1775Open in IMG/M
3300000789|JGI1027J11758_13080474Not Available655Open in IMG/M
3300000891|JGI10214J12806_12169725Not Available649Open in IMG/M
3300001139|JGI10220J13317_11368463Not Available532Open in IMG/M
3300002075|JGI24738J21930_10055916All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300002077|JGI24744J21845_10043714All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300004800|Ga0058861_10094911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3611Open in IMG/M
3300005093|Ga0062594_103331923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3505Open in IMG/M
3300005105|Ga0066812_1006287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales753Open in IMG/M
3300005164|Ga0066815_10036979Not Available759Open in IMG/M
3300005328|Ga0070676_10069252All Organisms → cellular organisms → Bacteria2114Open in IMG/M
3300005332|Ga0066388_106084135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales609Open in IMG/M
3300005332|Ga0066388_106606844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales584Open in IMG/M
3300005439|Ga0070711_102065870Not Available502Open in IMG/M
3300005457|Ga0070662_100331814Not Available1243Open in IMG/M
3300005458|Ga0070681_11679638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales561Open in IMG/M
3300005559|Ga0066700_10021311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3633Open in IMG/M
3300005564|Ga0070664_101342369Not Available675Open in IMG/M
3300005615|Ga0070702_100448990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium935Open in IMG/M
3300005764|Ga0066903_101603126Not Available1234Open in IMG/M
3300005764|Ga0066903_105705104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069654Open in IMG/M
3300006034|Ga0066656_10885615Not Available572Open in IMG/M
3300006163|Ga0070715_10042702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1907Open in IMG/M
3300006175|Ga0070712_100423556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1104Open in IMG/M
3300006175|Ga0070712_100831425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium794Open in IMG/M
3300006354|Ga0075021_10383622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria880Open in IMG/M
3300006806|Ga0079220_12037734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales513Open in IMG/M
3300006847|Ga0075431_101211647All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300006852|Ga0075433_11104283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium690Open in IMG/M
3300006852|Ga0075433_11158384Not Available672Open in IMG/M
3300006853|Ga0075420_100375639Not Available1230Open in IMG/M
3300006854|Ga0075425_101943706All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300006903|Ga0075426_10980586Not Available639Open in IMG/M
3300007076|Ga0075435_100520812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1029Open in IMG/M
3300009100|Ga0075418_12902853Not Available523Open in IMG/M
3300009101|Ga0105247_10279018Not Available1152Open in IMG/M
3300009147|Ga0114129_10728002Not Available1272Open in IMG/M
3300009156|Ga0111538_11532682Not Available840Open in IMG/M
3300009156|Ga0111538_12273074Not Available681Open in IMG/M
3300009162|Ga0075423_12947222Not Available521Open in IMG/M
3300009553|Ga0105249_11158741Not Available844Open in IMG/M
3300010358|Ga0126370_11333395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium674Open in IMG/M
3300010360|Ga0126372_11583811Not Available693Open in IMG/M
3300010366|Ga0126379_11271322Not Available842Open in IMG/M
3300010371|Ga0134125_11012693All Organisms → cellular organisms → Bacteria → Proteobacteria911Open in IMG/M
3300010375|Ga0105239_10688887All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300010375|Ga0105239_11055667All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300010375|Ga0105239_11953890All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300010400|Ga0134122_13209592Not Available512Open in IMG/M
3300011120|Ga0150983_11111832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium773Open in IMG/M
3300011120|Ga0150983_13893407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae699Open in IMG/M
3300012177|Ga0153943_1021932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1444Open in IMG/M
3300012505|Ga0157339_1063331Not Available518Open in IMG/M
3300012882|Ga0157304_1028922Not Available753Open in IMG/M
3300012951|Ga0164300_10102057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1261Open in IMG/M
3300012951|Ga0164300_10392119Not Available760Open in IMG/M
3300012957|Ga0164303_10362901Not Available880Open in IMG/M
3300012957|Ga0164303_10585526Not Available731Open in IMG/M
3300012960|Ga0164301_11889425Not Available504Open in IMG/M
3300012984|Ga0164309_10914004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium716Open in IMG/M
3300012985|Ga0164308_10049949All Organisms → cellular organisms → Bacteria → Proteobacteria2697Open in IMG/M
3300012988|Ga0164306_10633786Not Available841Open in IMG/M
3300012989|Ga0164305_11065960Not Available692Open in IMG/M
3300012989|Ga0164305_11378367Not Available620Open in IMG/M
3300013100|Ga0157373_10048750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3020Open in IMG/M
3300013296|Ga0157374_11009541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae851Open in IMG/M
3300013297|Ga0157378_10555228Not Available1154Open in IMG/M
3300013306|Ga0163162_13272513Not Available519Open in IMG/M
3300013307|Ga0157372_11159774Not Available893Open in IMG/M
3300014497|Ga0182008_10190402Not Available1041Open in IMG/M
3300015372|Ga0132256_100600517All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300015372|Ga0132256_101692751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria742Open in IMG/M
3300015372|Ga0132256_102408991Not Available629Open in IMG/M
3300015372|Ga0132256_102505812Not Available617Open in IMG/M
3300015372|Ga0132256_102771373Not Available589Open in IMG/M
3300015374|Ga0132255_101739734Not Available946Open in IMG/M
3300015374|Ga0132255_104396444Not Available597Open in IMG/M
3300016294|Ga0182041_10359247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae1227Open in IMG/M
3300016294|Ga0182041_10484645All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300016341|Ga0182035_10846486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae804Open in IMG/M
3300016341|Ga0182035_10927401Not Available769Open in IMG/M
3300016387|Ga0182040_10492386Not Available978Open in IMG/M
3300016387|Ga0182040_11980254Not Available500Open in IMG/M
3300016404|Ga0182037_11102705Not Available695Open in IMG/M
3300016445|Ga0182038_10089773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae2199Open in IMG/M
3300017994|Ga0187822_10034911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1358Open in IMG/M
3300018089|Ga0187774_10199468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1094Open in IMG/M
3300019356|Ga0173481_10232231Not Available819Open in IMG/M
3300019356|Ga0173481_10841771Not Available511Open in IMG/M
3300019361|Ga0173482_10204867Not Available810Open in IMG/M
3300021405|Ga0210387_11505319Not Available576Open in IMG/M
3300021474|Ga0210390_10529450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium991Open in IMG/M
3300023066|Ga0247793_1089017Not Available532Open in IMG/M
3300023261|Ga0247796_1049837Not Available726Open in IMG/M
3300025315|Ga0207697_10320005All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300025900|Ga0207710_10177642Not Available1043Open in IMG/M
3300025904|Ga0207647_10608623Not Available602Open in IMG/M
3300025911|Ga0207654_11336962Not Available522Open in IMG/M
3300025912|Ga0207707_10641027All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300025914|Ga0207671_10241794Not Available1418Open in IMG/M
3300025916|Ga0207663_10743545Not Available779Open in IMG/M
3300025919|Ga0207657_10944554All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300025919|Ga0207657_10996798All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300025924|Ga0207694_10760014Not Available818Open in IMG/M
3300025925|Ga0207650_10312974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1285Open in IMG/M
3300025933|Ga0207706_10111636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2405Open in IMG/M
3300025944|Ga0207661_12065343Not Available516Open in IMG/M
3300025945|Ga0207679_10155032All Organisms → cellular organisms → Bacteria1869Open in IMG/M
3300026078|Ga0207702_10950525Not Available852Open in IMG/M
3300026116|Ga0207674_11221026Not Available721Open in IMG/M
3300026945|Ga0207743_1007571Not Available1216Open in IMG/M
3300027424|Ga0209984_1013643Not Available1067Open in IMG/M
3300027748|Ga0209689_1364186Not Available553Open in IMG/M
3300027765|Ga0209073_10263084Not Available674Open in IMG/M
3300028596|Ga0247821_10827360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter612Open in IMG/M
3300031170|Ga0307498_10450459Not Available516Open in IMG/M
3300031474|Ga0170818_100456256Not Available732Open in IMG/M
3300031668|Ga0318542_10262776Not Available880Open in IMG/M
3300031708|Ga0310686_115575265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1293Open in IMG/M
3300031744|Ga0306918_10965079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae663Open in IMG/M
3300031847|Ga0310907_10323000Not Available784Open in IMG/M
3300031847|Ga0310907_10658797Not Available576Open in IMG/M
3300031890|Ga0306925_10310052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae1697Open in IMG/M
3300031910|Ga0306923_11335299Not Available759Open in IMG/M
3300031910|Ga0306923_12194116Not Available554Open in IMG/M
3300031912|Ga0306921_11152578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae866Open in IMG/M
3300031941|Ga0310912_10379857Not Available1099Open in IMG/M
3300031947|Ga0310909_10118826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2144Open in IMG/M
3300031954|Ga0306926_10836174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae1107Open in IMG/M
3300031954|Ga0306926_11633227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae738Open in IMG/M
3300031954|Ga0306926_11937328Not Available665Open in IMG/M
3300032001|Ga0306922_10235860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1965Open in IMG/M
3300032001|Ga0306922_10874824Not Available935Open in IMG/M
3300032174|Ga0307470_10354406All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300032174|Ga0307470_11407025Not Available576Open in IMG/M
3300032205|Ga0307472_101423439Not Available673Open in IMG/M
3300032515|Ga0348332_14051700Not Available511Open in IMG/M
3300033289|Ga0310914_11230192Not Available651Open in IMG/M
3300033412|Ga0310810_11250822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.23%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.32%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere3.60%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.16%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.16%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.44%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.44%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.44%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.44%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.72%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.72%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.72%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.72%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.72%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.72%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300002075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4Host-AssociatedOpen in IMG/M
3300002077Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3Host-AssociatedOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005105Soil and rhizosphere microbial communities from Laval, Canada - mgHPCEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012177Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaGHost-AssociatedOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026945Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes)EnvironmentalOpen in IMG/M
3300027424Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_067210113300000033SoilMRKMSMIGATLVGAAILCAVPISLHQSQDKGLSLS
JGI1027J11758_1308047423300000789SoilMKKISLIAATLLGAGVLCAAPISLYQSQDKALSFSVDKAQ
JGI10214J12806_1216972523300000891SoilMMKKISVIGATLLGAAVLCAAPISLHKDLSLSVDKAR
JGI10220J13317_1136846313300001139SoilMKKISLIAATLLGAGVLCAAPISLYQSQDKALSFSVDKAQAYYGVARRHNRRVYRRSYYG
JGI24738J21930_1005591613300002075Corn RhizosphereMKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLS
JGI24744J21845_1004371413300002077Corn, Switchgrass And Miscanthus RhizosphereMKNISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKALARI
Ga0058861_1009491113300004800Host-AssociatedMKKISVIGATLVAAAVLCAAPISLQGLSLSVDKARAVVGRPLT
Ga0062594_10333192313300005093SoilMKKISVIGILVGAAVLCAAPISLHQSLDKGLSLSVDKAQA
Ga0066812_100628723300005105SoilMKKISVIGAALLGAAVLWAAPISLHLSQDKGMSLSVDKAQARIG
Ga0066815_1003697913300005164SoilMRKTSVMGATLVAAAMLCAAPISLHQAQDQGLSLSVDKAQAYYGHYRRVNRRHG
Ga0070676_1006925213300005328Miscanthus RhizosphereMMKKISVIGATLLGAAVLCAAPISLHKDLSLSVDKARAVI
Ga0066388_10608413523300005332Tropical Forest SoilMKKISVIAATLMGAAVLWAAPISLHLSQDKGLSLSVDSALACDR*
Ga0066388_10660684413300005332Tropical Forest SoilMKKISVIAATLLGAAVLCAAPISLHRSQDKALSLSVDKAQAYYGVYRRHYRRVYRRGYY
Ga0070711_10206587013300005439Corn, Switchgrass And Miscanthus RhizosphereMKKISLIAATLVGAAVLCASPISLHQAQDKGLSLSVDKAQAYYGHYRRVH
Ga0070662_10033181443300005457Corn RhizosphereMKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKARA
Ga0070681_1167963823300005458Corn RhizosphereMKKISVIGILVGAMLCAAPVSLHQSQHNFSLSVDKAQARIGR
Ga0066700_1002131173300005559SoilMKKMSMIGATLLGAAVLCATPISLHQSQHKGLSLSLDSADARVGQPLSAG
Ga0070664_10134236923300005564Corn RhizosphereMMKKISVIAATLLGAAVLCAAPISLHKDLSLSVDKAR
Ga0070702_10044899013300005615Corn, Switchgrass And Miscanthus RhizosphereMKKISVIGATLLGAAVLCAAPISLHLSQDKGMSLSVDKAQA
Ga0066903_10160312633300005764Tropical Forest SoilMKNISLIAATLLGAAVLCASPISLHQAQDKGLSLSVDKAQAYYGHYRRV
Ga0066903_10570510413300005764Tropical Forest SoilMKKISVIGATLVAAALLCAAPISLNLSQDKGMSLSMDKAQARYGPAGALLRG
Ga0066656_1088561513300006034SoilMKKMSMIGATLLGAAVLCATPISLHQSQHKGLSLSLDSA
Ga0070715_1004270263300006163Corn, Switchgrass And Miscanthus RhizosphereMKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDKAVAYTY
Ga0070712_10042355613300006175Corn, Switchgrass And Miscanthus RhizosphereMKKINVIGAALAAAVLCAAPISFHLSQDKGLTLSVDKA
Ga0070712_10083142513300006175Corn, Switchgrass And Miscanthus RhizosphereMKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKARAR
Ga0075021_1038362223300006354WatershedsMKKISVIGATLVGAAMLWAAPISLHQSRDTGLSLSVDKAQAVIGRPLSA
Ga0079220_1203773423300006806Agricultural SoilMKKISLIAATLVGAAVLCAAPISLRQAQDKGLSLSVDKAQAYYG
Ga0075431_10121164723300006847Populus RhizosphereMKKISVIGATLVAAAVLCPAPISLQGLSLSVDKARAVVGRP
Ga0075433_1110428323300006852Populus RhizosphereMVPIREENVMKKISVIAATLLGAAMLCAAPISLQLSQDKGLTLSVDKARARIGR
Ga0075433_1115838423300006852Populus RhizosphereMKKISVIGATLLGAAVLCAAPISLHKDLSLSVDKARAV
Ga0075420_10037563953300006853Populus RhizosphereMKKISLIAATLVGAAVLCAAPISLHQVQDKGLSLSVDKAQAYYG
Ga0075425_10194370623300006854Populus RhizosphereMKNISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVD
Ga0075426_1098058633300006903Populus RhizosphereMKKISLIAATLVGAAVLCASPISLHQAQDKGLSLSVDKAVAYTYGHHRRVHRRVHRRYY
Ga0075435_10052081213300007076Populus RhizosphereMKKKSMFGATLMGVAILCATPISLHQSQDKGLSLSLDSADARVG
Ga0075418_1290285313300009100Populus RhizosphereMKKISVIGATLMAAAVLWAAPVSFHQDKGLSLSMDKAAAYTYGHAR
Ga0105247_1027901833300009101Switchgrass RhizosphereVMKKISVITATLVGAAVLCAAPISLHQSQDKGLTLSVD
Ga0114129_1072800213300009147Populus RhizosphereMKKISLIAATLVGAAVLCAAPISLHQAQDKSLSLSVDKAQAYYGHHRRVHRRVHRR
Ga0111538_1153268213300009156Populus RhizosphereMKKISVIGATLLGAAVLCAAPISLHKDLSLSVDKARAVIGRPLTPG
Ga0111538_1227307423300009156Populus RhizosphereMKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVD
Ga0075423_1294722223300009162Populus RhizosphereMEKISLIAATLVGAAVLCTSPISLHQAQDKGLSLSVDKA
Ga0105249_1115874113300009553Switchgrass RhizosphereMKNISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKALARIGRP
Ga0126370_1133339513300010358Tropical Forest SoilMKKISVIAATLLGAAVLCAAPISLHRSQDKALSLS
Ga0126372_1158381123300010360Tropical Forest SoilVMKKISLIAAALVGAAVLCTSPISLHQAQDKGLSLSV
Ga0126379_1127132233300010366Tropical Forest SoilMRQKISMIGAILMAAAMLCVAPISLHQSGLSLSVD
Ga0134125_1101269313300010371Terrestrial SoilMKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDKAVAYTYGH
Ga0105239_1068888713300010375Corn RhizosphereVMKKIRVIGATLVAAAVLCAAPISLQGLSLSVDKARAVVGRPLTPGS
Ga0105239_1105566723300010375Corn RhizosphereMKKISVIAATLVGTAVLCAAPISLHQAQDKGLSLSVDKAVAYTYGHH
Ga0105239_1195389013300010375Corn RhizosphereMKKISVIGATLVAAAVLCAAPISLQGLSLSVDKARAVVGRPLTPGS
Ga0134122_1320959213300010400Terrestrial SoilMKKISVIGATLVAAAMLCAAPISLHQDQNQGLSLSVDKAQAYYG
Ga0150983_1111183213300011120Forest SoilMKKLSVIRATLLGAAVLCAAPISLHLSQDKGMSLSVDKAQAVIPPGTP
Ga0150983_1389340723300011120Forest SoilMKKVSVIGATLVGAAVLLATPVSLHQSRDTGLSLSVDKAQAVIG
Ga0153943_102193243300012177Attine Ant Fungus GardensMKKISVIGATLVGAAVLLATPVSLHQSRDAGLSLSVDKAQAVIGRPLSAGSVAG
Ga0157339_106333123300012505Arabidopsis RhizosphereMKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKAQA
Ga0157304_102892223300012882SoilMKKISLIAATLVGAALMCAAPISLHQAQDKGLSLSADK
Ga0164300_1010205733300012951SoilMMKKISVIAATLLGSAVLSAAPISLHKDLSLSVDKARAVIGRPLTP
Ga0164300_1039211933300012951SoilMKKISVIGATLLGAAVLCAAPISLHLFQDKGMSLSVDKAQ
Ga0164303_1036290113300012957SoilMKKLSVIRATLLGAAVLCAAPISLHLSQDKGMSLSVDKAQAFIP
Ga0164303_1058552623300012957SoilMKKLSVIGAALLGAAVLCAAPISLHLSQDKGMSLSVDRAQ
Ga0164301_1188942523300012960SoilMKKVSVIRATLLGAAVLCATPISLHLSQDKGMSLSVDKAQAVIPPGT
Ga0164309_1091400423300012984SoilMKKVSVIGATLLGAAVLCAAPISLHLYQDKGMSLSVDKA
Ga0164308_1004994913300012985SoilMKKLSVIGAALLGAAVLCVAPISLHLSQDKGMSLSVDKAQARI
Ga0164306_1063378613300012988SoilMKKLSVIRATLLGAAVLCAAPISLHLSQDKGMSLSVDKAQAFIPAGTPCK
Ga0164305_1106596013300012989SoilMHMKKISVIGATLLGAAVLCAAPISLHLFQDKGMSLSVDKAQARIG
Ga0164305_1137836723300012989SoilMKKISVIGATLVAAAVLCAAPISLHQSLDKGLSLSVDKA
Ga0157373_1004875013300013100Corn RhizosphereMKNISVIGATLVAAAVLCAAPISLHQSQDKGLSLS
Ga0157374_1100954133300013296Miscanthus RhizosphereMKTISLIAATLVGAAVLCAAPISLHQAQDRGLSLSMDKAVAYTYGHHRR
Ga0157378_1055522813300013297Miscanthus RhizosphereMKKISVITATLVGAAVLCASPISLHQAQDKGLSLSVDKAVAYTY
Ga0163162_1327251313300013306Switchgrass RhizosphereMKNISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKALARIG
Ga0157372_1115977413300013307Corn RhizosphereMKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDKAVAYT
Ga0182008_1019040213300014497RhizosphereVKEENVMKKISVIGATLVAAAVLCAAPISLHQSQDKGLTLS
Ga0132256_10060051733300015372Arabidopsis RhizosphereMKKMSMIGATLLGAAVLCAAPISLHQSQPKGLSLSLDS
Ga0132256_10169275113300015372Arabidopsis RhizosphereMKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDKA
Ga0132256_10240899113300015372Arabidopsis RhizosphereMKKISLIAATLVGAAVLCASPISLHKDLSLSVDKARAVI
Ga0132256_10250581223300015372Arabidopsis RhizosphereMKKISLIAATLVGAAVLCVAPISLHQAQDKGLSLSVDK
Ga0132256_10277137323300015372Arabidopsis RhizosphereMKKMSMIGATLMGVAILCATPVSLHTSQDKGLSLSV
Ga0132255_10173973413300015374Arabidopsis RhizosphereMKKTSVIGATLVAAAVLCAAPISLHQSQDKGLTLS
Ga0132255_10439644423300015374Arabidopsis RhizosphereMKKISVIGATLVAAVMLCAAPISLQLSQDKGLSLSV
Ga0182041_1035924743300016294SoilMKKISIIGATLLGAAVLCAAPVSFHRSQDKALSLSVDKAQAYYGVYRRHYGRV
Ga0182041_1048464513300016294SoilMKKMSMIAATLIGAAILAAVPISLHQSQEKGLSLSVDSAYAVIG
Ga0182035_1084648633300016341SoilMWMKKISVIGATLVGALVLCAAPISLHQSQDKGLTLSVDKARARIGHPLTP
Ga0182035_1092740133300016341SoilMKKISVIAATLVGAAVMCAAPLSLHQAQDKGLLLSVDKAQAYYGHYRRVNR
Ga0182040_1049238613300016387SoilMKKISVIGATLVAAAVLCAAPISLQPSQDKGLSLSVDKAQA
Ga0182040_1198025423300016387SoilMRKISVIGATLVGAAVLCAAPISLHQSQDKGLSLSVDKARAVIGR
Ga0182037_1110270523300016404SoilMIRLIAMKNISVIGATLVAAAVLCAAPISLHQSQDKGL
Ga0182038_1008977353300016445SoilMWMKKLSVIGATLVGALMLCAAPISLQQSQDKGLSLSVDKAQARIGH
Ga0187822_1003491123300017994Freshwater SedimentMKKTSVIGKTSVIGATLLGAAVLLATPVSLHQSRDTGLSLSVDKAQA
Ga0187774_1019946813300018089Tropical PeatlandMKKLSLIAATLVGAAVLCAAPISLHQSQDKGLSLSVDKVQAYYGVHRRHHRVARRYY
Ga0173481_1023223113300019356SoilMKKISVIGATLLGAAVLCAAPISLHKDLSLSVDKARAVIGRP
Ga0173481_1084177113300019356SoilMKKISVVAATLVGAAVLCASPVSLHKDLSLSVDKARAVIGRPLT
Ga0173482_1020486733300019361SoilMKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDK
Ga0210387_1150531923300021405SoilMKKISVIGATLVGAAVLLATPVSLHQSRDTGLSLSVDKAQ
Ga0210390_1052945013300021474SoilMKKVSVIGATLVGAAVLLATPVSLHQSRDTGLSLSVDKAQAVIGR
Ga0247793_108901713300023066SoilMKKISVITATLVGAAVLCAAPISLHQSQDKGLTLS
Ga0247796_104983713300023261SoilMKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDKAVAYTYGHHRRVHRRVHRR
Ga0207697_1032000513300025315Corn, Switchgrass And Miscanthus RhizosphereMKKISVIGATLVAAAVLCAAPISLQGLSLSVDKARAVVGRP
Ga0207710_1017764233300025900Switchgrass RhizosphereMKKISVITATLVGAAVLCAAPISLHQSQDKGLTLSVDK
Ga0207647_1060862313300025904Corn RhizosphereMKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDKAQAYYGHYRRVHRRVHRRY
Ga0207654_1133696223300025911Corn RhizosphereMKKLSMIGILVGAAVLCAAPISLRQSQDKGVSFSVDKAE
Ga0207707_1064102713300025912Corn RhizosphereMKNISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKA
Ga0207671_1024179413300025914Corn RhizosphereMKKISVITATLVGAAVLCAAPISLHQSQDKGLTLSVDKAQAR
Ga0207663_1074354523300025916Corn, Switchgrass And Miscanthus RhizosphereMKKTSVIGATLVAAAVLCAAPISLHQSQDKVLSLSVDKAQARIGRPL
Ga0207657_1094455423300025919Corn RhizosphereMKKISVIGATLVAAAVLCAAPISLQGLSLSVDKARAVV
Ga0207657_1099679813300025919Corn RhizosphereMKKIRVIGATLVAAAVLCAAPISLQGLSLSVDKARAVV
Ga0207694_1076001413300025924Corn RhizosphereMKKISVIAATLLGAAVLCAAPISLHKDLSLSVDKARAVIGRPLTP
Ga0207650_1031297413300025925Switchgrass RhizosphereMKKISVIGATLVAAAVLCAAPISLQGLSLSVDKARAVVG
Ga0207706_1011163663300025933Corn RhizosphereMKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLSV
Ga0207661_1206534313300025944Corn RhizosphereMKKISVIAATLVGAAVLCAAPISLQLSQDKGLTLSVDKARAR
Ga0207679_1015503243300025945Corn RhizosphereMMKKISVIGATLLGAAVLCAAPISLHKDLSLSVDKARAVIGR
Ga0207702_1095052533300026078Corn RhizosphereMKKISLIAATLVGAAVLCASPISLHQAQDKGLSLSVDKAV
Ga0207674_1122102613300026116Corn RhizosphereMKKISVIGATLVAAAVLCAAPISLQLSQDKGLTLSVDKARARIG
Ga0207743_100757133300026945Tropical Forest SoilMNKISVIGATLVAAAVLCAAPLSLHLSQDKGLSLS
Ga0209984_101364313300027424Arabidopsis Thaliana RhizosphereMKNISVIGATLVAAAVLCAAPISLHKDLSLSVDKAQAR
Ga0209689_136418613300027748SoilMKKMSMIGATLLGAAVLCAAPISLHQSQNKGLSLSLDSADARVGQPL
Ga0209073_1026308423300027765Agricultural SoilMKKISLIAATLVGAAVLCAAPISLRQAQDKGLSLSVDKAQAYYGG
Ga0247821_1082736013300028596SoilMKKISVIGATLLGAAVLCAAPISLHLFQDKGMSLSVDKAQAFIPAG
Ga0307498_1045045913300031170SoilMKKISVIGAALVAAAVVCAAPISLHLSQDKGMSLSVDK
Ga0170818_10045625623300031474Forest SoilMKKTSVIGATLAAAAMLCAAPISFQLSHDKGLSLSVDKAG
Ga0318542_1026277613300031668SoilMKKISVIAATLVAAAVLCAAPISLHRSQDKALSLSVE
Ga0310686_11557526513300031708SoilMKKISVIGATLLGAAVLLAAPVSLHQSRDTGLSLSVDKAQAVIGR
Ga0306918_1096507913300031744SoilMWMKKISVIGATLVGALVLCAAPISLHQSQDKGLTLSVDKARARV
Ga0310907_1032300023300031847SoilMKKTSVIGATLAAAAMLCAAPISFQLSQDKGLSLSVDK
Ga0310907_1065879713300031847SoilMKKLSMIGILVGAAVLCAAPISLRQSQDKGVSFSV
Ga0306925_1031005243300031890SoilMKKISIIGATLLGAAVLCAAPVSFHRSQDKALSLSVDKAQAYYGVYRRHYGRVYRRGYYG
Ga0306923_1133529913300031910SoilMKKISVIAATLLGAAVLCTAPLSVHQSQDRGLSVSVDKAQAYYGHYRRVYRRGYYGHGYG
Ga0306923_1219411613300031910SoilMKKMSMIAATLIGAAILAAVPISLHQSQEKGLLLSVDSAYAVI
Ga0306921_1115257813300031912SoilMKKINVIATTLLGAAVLCAVPISLHSGLSLSVDKAQAVIGRPLT
Ga0310912_1037985733300031941SoilMKKISVIAATLVGAAVLCAAPISLHRSQDKALSLSVEKAQAYYGGVYRRHYRRVY
Ga0310909_1011882653300031947SoilMKKIGLIAATLVGAAVLCAAPISLHQSQDKGLTLS
Ga0306926_1083617413300031954SoilMWMKKISVIGATLVGALVLCAAPISLHQSQDKGLTL
Ga0306926_1163322713300031954SoilMKKINVIATTLLGAAVLCAVPISLHSGLSLSVDKAQAV
Ga0306926_1193732813300031954SoilMKKISVIAATLVAAAVLCAAPISLHRSQDKALSLSVEKAQAYYG
Ga0306922_1023586043300032001SoilMKKIGLIAATLVGAAVLCAAPISLHQSQDKGLTLSVDKA
Ga0306922_1087482423300032001SoilMKKISVIAATLVGAAVLCAAPISLHRSQDKALSLSAEKAQAYYG
Ga0307470_1035440613300032174Hardwood Forest SoilMKKISVIGATLVAAAVLCAAPISLHQSQDKGLTLS
Ga0307470_1140702513300032174Hardwood Forest SoilMKKLSVIGATLLGAAVLCAAPITLHLSQDRGLSVDK
Ga0307472_10142343923300032205Hardwood Forest SoilMKKLSVIRATLLGAAVLCAAPISLHLSQDKGMSLSVDKAQAF
Ga0348332_1405170023300032515Plant LitterMRKISVIGATLVGAAVLLATPVSLHQSRDTGLSLSVDKAQAVIG
Ga0310914_1123019223300033289SoilMKKISMIAATLVGGAVLCAAPISLHQSQDKGLTLSVDKARAVIGR
Ga0310810_1125082213300033412SoilMKKISVIGATLVGAAVLCAAPISLQLSQDKGLTLSVDKARA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.