Basic Information | |
---|---|
Family ID | F055251 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 139 |
Average Sequence Length | 43 residues |
Representative Sequence | MKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKAQA |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 139 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 99.28 % |
% of genes near scaffold ends (potentially truncated) | 99.28 % |
% of genes from short scaffolds (< 2000 bps) | 94.96 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (55.396 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.950 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.022 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.043 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 139 Family Scaffolds |
---|---|---|
PF07813 | LTXXQ | 5.76 |
PF00839 | Cys_rich_FGFR | 5.04 |
PF13545 | HTH_Crp_2 | 2.16 |
PF04226 | Transgly_assoc | 1.44 |
PF02560 | Cyanate_lyase | 0.72 |
PF12200 | DUF3597 | 0.72 |
PF04632 | FUSC | 0.72 |
PF01557 | FAA_hydrolase | 0.72 |
PF01381 | HTH_3 | 0.72 |
PF00072 | Response_reg | 0.72 |
PF10009 | DUF2252 | 0.72 |
PF00111 | Fer2 | 0.72 |
PF17200 | sCache_2 | 0.72 |
PF00768 | Peptidase_S11 | 0.72 |
PF02518 | HATPase_c | 0.72 |
PF00226 | DnaJ | 0.72 |
COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
---|---|---|---|
COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 23.02 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.44 |
COG1289 | Uncharacterized membrane protein YccC | Function unknown [S] | 0.72 |
COG1513 | Cyanate lyase | Inorganic ion transport and metabolism [P] | 0.72 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 55.40 % |
All Organisms | root | All Organisms | 44.60 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c0672101 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
3300000789|JGI1027J11758_13080474 | Not Available | 655 | Open in IMG/M |
3300000891|JGI10214J12806_12169725 | Not Available | 649 | Open in IMG/M |
3300001139|JGI10220J13317_11368463 | Not Available | 532 | Open in IMG/M |
3300002075|JGI24738J21930_10055916 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300002077|JGI24744J21845_10043714 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300004800|Ga0058861_10094911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 611 | Open in IMG/M |
3300005093|Ga0062594_103331923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 505 | Open in IMG/M |
3300005105|Ga0066812_1006287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 753 | Open in IMG/M |
3300005164|Ga0066815_10036979 | Not Available | 759 | Open in IMG/M |
3300005328|Ga0070676_10069252 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
3300005332|Ga0066388_106084135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 609 | Open in IMG/M |
3300005332|Ga0066388_106606844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 584 | Open in IMG/M |
3300005439|Ga0070711_102065870 | Not Available | 502 | Open in IMG/M |
3300005457|Ga0070662_100331814 | Not Available | 1243 | Open in IMG/M |
3300005458|Ga0070681_11679638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 561 | Open in IMG/M |
3300005559|Ga0066700_10021311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3633 | Open in IMG/M |
3300005564|Ga0070664_101342369 | Not Available | 675 | Open in IMG/M |
3300005615|Ga0070702_100448990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 935 | Open in IMG/M |
3300005764|Ga0066903_101603126 | Not Available | 1234 | Open in IMG/M |
3300005764|Ga0066903_105705104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 654 | Open in IMG/M |
3300006034|Ga0066656_10885615 | Not Available | 572 | Open in IMG/M |
3300006163|Ga0070715_10042702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1907 | Open in IMG/M |
3300006175|Ga0070712_100423556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1104 | Open in IMG/M |
3300006175|Ga0070712_100831425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 794 | Open in IMG/M |
3300006354|Ga0075021_10383622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 880 | Open in IMG/M |
3300006806|Ga0079220_12037734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 513 | Open in IMG/M |
3300006847|Ga0075431_101211647 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300006852|Ga0075433_11104283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 690 | Open in IMG/M |
3300006852|Ga0075433_11158384 | Not Available | 672 | Open in IMG/M |
3300006853|Ga0075420_100375639 | Not Available | 1230 | Open in IMG/M |
3300006854|Ga0075425_101943706 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300006903|Ga0075426_10980586 | Not Available | 639 | Open in IMG/M |
3300007076|Ga0075435_100520812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1029 | Open in IMG/M |
3300009100|Ga0075418_12902853 | Not Available | 523 | Open in IMG/M |
3300009101|Ga0105247_10279018 | Not Available | 1152 | Open in IMG/M |
3300009147|Ga0114129_10728002 | Not Available | 1272 | Open in IMG/M |
3300009156|Ga0111538_11532682 | Not Available | 840 | Open in IMG/M |
3300009156|Ga0111538_12273074 | Not Available | 681 | Open in IMG/M |
3300009162|Ga0075423_12947222 | Not Available | 521 | Open in IMG/M |
3300009553|Ga0105249_11158741 | Not Available | 844 | Open in IMG/M |
3300010358|Ga0126370_11333395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 674 | Open in IMG/M |
3300010360|Ga0126372_11583811 | Not Available | 693 | Open in IMG/M |
3300010366|Ga0126379_11271322 | Not Available | 842 | Open in IMG/M |
3300010371|Ga0134125_11012693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 911 | Open in IMG/M |
3300010375|Ga0105239_10688887 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300010375|Ga0105239_11055667 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300010375|Ga0105239_11953890 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300010400|Ga0134122_13209592 | Not Available | 512 | Open in IMG/M |
3300011120|Ga0150983_11111832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 773 | Open in IMG/M |
3300011120|Ga0150983_13893407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 699 | Open in IMG/M |
3300012177|Ga0153943_1021932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1444 | Open in IMG/M |
3300012505|Ga0157339_1063331 | Not Available | 518 | Open in IMG/M |
3300012882|Ga0157304_1028922 | Not Available | 753 | Open in IMG/M |
3300012951|Ga0164300_10102057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1261 | Open in IMG/M |
3300012951|Ga0164300_10392119 | Not Available | 760 | Open in IMG/M |
3300012957|Ga0164303_10362901 | Not Available | 880 | Open in IMG/M |
3300012957|Ga0164303_10585526 | Not Available | 731 | Open in IMG/M |
3300012960|Ga0164301_11889425 | Not Available | 504 | Open in IMG/M |
3300012984|Ga0164309_10914004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 716 | Open in IMG/M |
3300012985|Ga0164308_10049949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2697 | Open in IMG/M |
3300012988|Ga0164306_10633786 | Not Available | 841 | Open in IMG/M |
3300012989|Ga0164305_11065960 | Not Available | 692 | Open in IMG/M |
3300012989|Ga0164305_11378367 | Not Available | 620 | Open in IMG/M |
3300013100|Ga0157373_10048750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3020 | Open in IMG/M |
3300013296|Ga0157374_11009541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 851 | Open in IMG/M |
3300013297|Ga0157378_10555228 | Not Available | 1154 | Open in IMG/M |
3300013306|Ga0163162_13272513 | Not Available | 519 | Open in IMG/M |
3300013307|Ga0157372_11159774 | Not Available | 893 | Open in IMG/M |
3300014497|Ga0182008_10190402 | Not Available | 1041 | Open in IMG/M |
3300015372|Ga0132256_100600517 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300015372|Ga0132256_101692751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
3300015372|Ga0132256_102408991 | Not Available | 629 | Open in IMG/M |
3300015372|Ga0132256_102505812 | Not Available | 617 | Open in IMG/M |
3300015372|Ga0132256_102771373 | Not Available | 589 | Open in IMG/M |
3300015374|Ga0132255_101739734 | Not Available | 946 | Open in IMG/M |
3300015374|Ga0132255_104396444 | Not Available | 597 | Open in IMG/M |
3300016294|Ga0182041_10359247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 1227 | Open in IMG/M |
3300016294|Ga0182041_10484645 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300016341|Ga0182035_10846486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 804 | Open in IMG/M |
3300016341|Ga0182035_10927401 | Not Available | 769 | Open in IMG/M |
3300016387|Ga0182040_10492386 | Not Available | 978 | Open in IMG/M |
3300016387|Ga0182040_11980254 | Not Available | 500 | Open in IMG/M |
3300016404|Ga0182037_11102705 | Not Available | 695 | Open in IMG/M |
3300016445|Ga0182038_10089773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 2199 | Open in IMG/M |
3300017994|Ga0187822_10034911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1358 | Open in IMG/M |
3300018089|Ga0187774_10199468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1094 | Open in IMG/M |
3300019356|Ga0173481_10232231 | Not Available | 819 | Open in IMG/M |
3300019356|Ga0173481_10841771 | Not Available | 511 | Open in IMG/M |
3300019361|Ga0173482_10204867 | Not Available | 810 | Open in IMG/M |
3300021405|Ga0210387_11505319 | Not Available | 576 | Open in IMG/M |
3300021474|Ga0210390_10529450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 991 | Open in IMG/M |
3300023066|Ga0247793_1089017 | Not Available | 532 | Open in IMG/M |
3300023261|Ga0247796_1049837 | Not Available | 726 | Open in IMG/M |
3300025315|Ga0207697_10320005 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300025900|Ga0207710_10177642 | Not Available | 1043 | Open in IMG/M |
3300025904|Ga0207647_10608623 | Not Available | 602 | Open in IMG/M |
3300025911|Ga0207654_11336962 | Not Available | 522 | Open in IMG/M |
3300025912|Ga0207707_10641027 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300025914|Ga0207671_10241794 | Not Available | 1418 | Open in IMG/M |
3300025916|Ga0207663_10743545 | Not Available | 779 | Open in IMG/M |
3300025919|Ga0207657_10944554 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300025919|Ga0207657_10996798 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300025924|Ga0207694_10760014 | Not Available | 818 | Open in IMG/M |
3300025925|Ga0207650_10312974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1285 | Open in IMG/M |
3300025933|Ga0207706_10111636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2405 | Open in IMG/M |
3300025944|Ga0207661_12065343 | Not Available | 516 | Open in IMG/M |
3300025945|Ga0207679_10155032 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
3300026078|Ga0207702_10950525 | Not Available | 852 | Open in IMG/M |
3300026116|Ga0207674_11221026 | Not Available | 721 | Open in IMG/M |
3300026945|Ga0207743_1007571 | Not Available | 1216 | Open in IMG/M |
3300027424|Ga0209984_1013643 | Not Available | 1067 | Open in IMG/M |
3300027748|Ga0209689_1364186 | Not Available | 553 | Open in IMG/M |
3300027765|Ga0209073_10263084 | Not Available | 674 | Open in IMG/M |
3300028596|Ga0247821_10827360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter | 612 | Open in IMG/M |
3300031170|Ga0307498_10450459 | Not Available | 516 | Open in IMG/M |
3300031474|Ga0170818_100456256 | Not Available | 732 | Open in IMG/M |
3300031668|Ga0318542_10262776 | Not Available | 880 | Open in IMG/M |
3300031708|Ga0310686_115575265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1293 | Open in IMG/M |
3300031744|Ga0306918_10965079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 663 | Open in IMG/M |
3300031847|Ga0310907_10323000 | Not Available | 784 | Open in IMG/M |
3300031847|Ga0310907_10658797 | Not Available | 576 | Open in IMG/M |
3300031890|Ga0306925_10310052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 1697 | Open in IMG/M |
3300031910|Ga0306923_11335299 | Not Available | 759 | Open in IMG/M |
3300031910|Ga0306923_12194116 | Not Available | 554 | Open in IMG/M |
3300031912|Ga0306921_11152578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 866 | Open in IMG/M |
3300031941|Ga0310912_10379857 | Not Available | 1099 | Open in IMG/M |
3300031947|Ga0310909_10118826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2144 | Open in IMG/M |
3300031954|Ga0306926_10836174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 1107 | Open in IMG/M |
3300031954|Ga0306926_11633227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 738 | Open in IMG/M |
3300031954|Ga0306926_11937328 | Not Available | 665 | Open in IMG/M |
3300032001|Ga0306922_10235860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1965 | Open in IMG/M |
3300032001|Ga0306922_10874824 | Not Available | 935 | Open in IMG/M |
3300032174|Ga0307470_10354406 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300032174|Ga0307470_11407025 | Not Available | 576 | Open in IMG/M |
3300032205|Ga0307472_101423439 | Not Available | 673 | Open in IMG/M |
3300032515|Ga0348332_14051700 | Not Available | 511 | Open in IMG/M |
3300033289|Ga0310914_11230192 | Not Available | 651 | Open in IMG/M |
3300033412|Ga0310810_11250822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.23% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.32% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.60% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 3.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.16% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.16% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.16% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.44% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.44% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.44% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.44% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.72% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.72% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.72% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005105 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026945 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes) | Environmental | Open in IMG/M |
3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_06721011 | 3300000033 | Soil | MRKMSMIGATLVGAAILCAVPISLHQSQDKGLSLS |
JGI1027J11758_130804742 | 3300000789 | Soil | MKKISLIAATLLGAGVLCAAPISLYQSQDKALSFSVDKAQ |
JGI10214J12806_121697252 | 3300000891 | Soil | MMKKISVIGATLLGAAVLCAAPISLHKDLSLSVDKAR |
JGI10220J13317_113684631 | 3300001139 | Soil | MKKISLIAATLLGAGVLCAAPISLYQSQDKALSFSVDKAQAYYGVARRHNRRVYRRSYYG |
JGI24738J21930_100559161 | 3300002075 | Corn Rhizosphere | MKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLS |
JGI24744J21845_100437141 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKALARI |
Ga0058861_100949111 | 3300004800 | Host-Associated | MKKISVIGATLVAAAVLCAAPISLQGLSLSVDKARAVVGRPLT |
Ga0062594_1033319231 | 3300005093 | Soil | MKKISVIGILVGAAVLCAAPISLHQSLDKGLSLSVDKAQA |
Ga0066812_10062872 | 3300005105 | Soil | MKKISVIGAALLGAAVLWAAPISLHLSQDKGMSLSVDKAQARIG |
Ga0066815_100369791 | 3300005164 | Soil | MRKTSVMGATLVAAAMLCAAPISLHQAQDQGLSLSVDKAQAYYGHYRRVNRRHG |
Ga0070676_100692521 | 3300005328 | Miscanthus Rhizosphere | MMKKISVIGATLLGAAVLCAAPISLHKDLSLSVDKARAVI |
Ga0066388_1060841352 | 3300005332 | Tropical Forest Soil | MKKISVIAATLMGAAVLWAAPISLHLSQDKGLSLSVDSALACDR* |
Ga0066388_1066068441 | 3300005332 | Tropical Forest Soil | MKKISVIAATLLGAAVLCAAPISLHRSQDKALSLSVDKAQAYYGVYRRHYRRVYRRGYY |
Ga0070711_1020658701 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKISLIAATLVGAAVLCASPISLHQAQDKGLSLSVDKAQAYYGHYRRVH |
Ga0070662_1003318144 | 3300005457 | Corn Rhizosphere | MKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKARA |
Ga0070681_116796382 | 3300005458 | Corn Rhizosphere | MKKISVIGILVGAMLCAAPVSLHQSQHNFSLSVDKAQARIGR |
Ga0066700_100213117 | 3300005559 | Soil | MKKMSMIGATLLGAAVLCATPISLHQSQHKGLSLSLDSADARVGQPLSAG |
Ga0070664_1013423692 | 3300005564 | Corn Rhizosphere | MMKKISVIAATLLGAAVLCAAPISLHKDLSLSVDKAR |
Ga0070702_1004489901 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKISVIGATLLGAAVLCAAPISLHLSQDKGMSLSVDKAQA |
Ga0066903_1016031263 | 3300005764 | Tropical Forest Soil | MKNISLIAATLLGAAVLCASPISLHQAQDKGLSLSVDKAQAYYGHYRRV |
Ga0066903_1057051041 | 3300005764 | Tropical Forest Soil | MKKISVIGATLVAAALLCAAPISLNLSQDKGMSLSMDKAQARYGPAGALLRG |
Ga0066656_108856151 | 3300006034 | Soil | MKKMSMIGATLLGAAVLCATPISLHQSQHKGLSLSLDSA |
Ga0070715_100427026 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDKAVAYTY |
Ga0070712_1004235561 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKINVIGAALAAAVLCAAPISFHLSQDKGLTLSVDKA |
Ga0070712_1008314251 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKARAR |
Ga0075021_103836222 | 3300006354 | Watersheds | MKKISVIGATLVGAAMLWAAPISLHQSRDTGLSLSVDKAQAVIGRPLSA |
Ga0079220_120377342 | 3300006806 | Agricultural Soil | MKKISLIAATLVGAAVLCAAPISLRQAQDKGLSLSVDKAQAYYG |
Ga0075431_1012116472 | 3300006847 | Populus Rhizosphere | MKKISVIGATLVAAAVLCPAPISLQGLSLSVDKARAVVGRP |
Ga0075433_111042832 | 3300006852 | Populus Rhizosphere | MVPIREENVMKKISVIAATLLGAAMLCAAPISLQLSQDKGLTLSVDKARARIGR |
Ga0075433_111583842 | 3300006852 | Populus Rhizosphere | MKKISVIGATLLGAAVLCAAPISLHKDLSLSVDKARAV |
Ga0075420_1003756395 | 3300006853 | Populus Rhizosphere | MKKISLIAATLVGAAVLCAAPISLHQVQDKGLSLSVDKAQAYYG |
Ga0075425_1019437062 | 3300006854 | Populus Rhizosphere | MKNISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVD |
Ga0075426_109805863 | 3300006903 | Populus Rhizosphere | MKKISLIAATLVGAAVLCASPISLHQAQDKGLSLSVDKAVAYTYGHHRRVHRRVHRRYY |
Ga0075435_1005208121 | 3300007076 | Populus Rhizosphere | MKKKSMFGATLMGVAILCATPISLHQSQDKGLSLSLDSADARVG |
Ga0075418_129028531 | 3300009100 | Populus Rhizosphere | MKKISVIGATLMAAAVLWAAPVSFHQDKGLSLSMDKAAAYTYGHAR |
Ga0105247_102790183 | 3300009101 | Switchgrass Rhizosphere | VMKKISVITATLVGAAVLCAAPISLHQSQDKGLTLSVD |
Ga0114129_107280021 | 3300009147 | Populus Rhizosphere | MKKISLIAATLVGAAVLCAAPISLHQAQDKSLSLSVDKAQAYYGHHRRVHRRVHRR |
Ga0111538_115326821 | 3300009156 | Populus Rhizosphere | MKKISVIGATLLGAAVLCAAPISLHKDLSLSVDKARAVIGRPLTPG |
Ga0111538_122730742 | 3300009156 | Populus Rhizosphere | MKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVD |
Ga0075423_129472222 | 3300009162 | Populus Rhizosphere | MEKISLIAATLVGAAVLCTSPISLHQAQDKGLSLSVDKA |
Ga0105249_111587411 | 3300009553 | Switchgrass Rhizosphere | MKNISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKALARIGRP |
Ga0126370_113333951 | 3300010358 | Tropical Forest Soil | MKKISVIAATLLGAAVLCAAPISLHRSQDKALSLS |
Ga0126372_115838112 | 3300010360 | Tropical Forest Soil | VMKKISLIAAALVGAAVLCTSPISLHQAQDKGLSLSV |
Ga0126379_112713223 | 3300010366 | Tropical Forest Soil | MRQKISMIGAILMAAAMLCVAPISLHQSGLSLSVD |
Ga0134125_110126931 | 3300010371 | Terrestrial Soil | MKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDKAVAYTYGH |
Ga0105239_106888871 | 3300010375 | Corn Rhizosphere | VMKKIRVIGATLVAAAVLCAAPISLQGLSLSVDKARAVVGRPLTPGS |
Ga0105239_110556672 | 3300010375 | Corn Rhizosphere | MKKISVIAATLVGTAVLCAAPISLHQAQDKGLSLSVDKAVAYTYGHH |
Ga0105239_119538901 | 3300010375 | Corn Rhizosphere | MKKISVIGATLVAAAVLCAAPISLQGLSLSVDKARAVVGRPLTPGS |
Ga0134122_132095921 | 3300010400 | Terrestrial Soil | MKKISVIGATLVAAAMLCAAPISLHQDQNQGLSLSVDKAQAYYG |
Ga0150983_111118321 | 3300011120 | Forest Soil | MKKLSVIRATLLGAAVLCAAPISLHLSQDKGMSLSVDKAQAVIPPGTP |
Ga0150983_138934072 | 3300011120 | Forest Soil | MKKVSVIGATLVGAAVLLATPVSLHQSRDTGLSLSVDKAQAVIG |
Ga0153943_10219324 | 3300012177 | Attine Ant Fungus Gardens | MKKISVIGATLVGAAVLLATPVSLHQSRDAGLSLSVDKAQAVIGRPLSAGSVAG |
Ga0157339_10633312 | 3300012505 | Arabidopsis Rhizosphere | MKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKAQA |
Ga0157304_10289222 | 3300012882 | Soil | MKKISLIAATLVGAALMCAAPISLHQAQDKGLSLSADK |
Ga0164300_101020573 | 3300012951 | Soil | MMKKISVIAATLLGSAVLSAAPISLHKDLSLSVDKARAVIGRPLTP |
Ga0164300_103921193 | 3300012951 | Soil | MKKISVIGATLLGAAVLCAAPISLHLFQDKGMSLSVDKAQ |
Ga0164303_103629011 | 3300012957 | Soil | MKKLSVIRATLLGAAVLCAAPISLHLSQDKGMSLSVDKAQAFIP |
Ga0164303_105855262 | 3300012957 | Soil | MKKLSVIGAALLGAAVLCAAPISLHLSQDKGMSLSVDRAQ |
Ga0164301_118894252 | 3300012960 | Soil | MKKVSVIRATLLGAAVLCATPISLHLSQDKGMSLSVDKAQAVIPPGT |
Ga0164309_109140042 | 3300012984 | Soil | MKKVSVIGATLLGAAVLCAAPISLHLYQDKGMSLSVDKA |
Ga0164308_100499491 | 3300012985 | Soil | MKKLSVIGAALLGAAVLCVAPISLHLSQDKGMSLSVDKAQARI |
Ga0164306_106337861 | 3300012988 | Soil | MKKLSVIRATLLGAAVLCAAPISLHLSQDKGMSLSVDKAQAFIPAGTPCK |
Ga0164305_110659601 | 3300012989 | Soil | MHMKKISVIGATLLGAAVLCAAPISLHLFQDKGMSLSVDKAQARIG |
Ga0164305_113783672 | 3300012989 | Soil | MKKISVIGATLVAAAVLCAAPISLHQSLDKGLSLSVDKA |
Ga0157373_100487501 | 3300013100 | Corn Rhizosphere | MKNISVIGATLVAAAVLCAAPISLHQSQDKGLSLS |
Ga0157374_110095413 | 3300013296 | Miscanthus Rhizosphere | MKTISLIAATLVGAAVLCAAPISLHQAQDRGLSLSMDKAVAYTYGHHRR |
Ga0157378_105552281 | 3300013297 | Miscanthus Rhizosphere | MKKISVITATLVGAAVLCASPISLHQAQDKGLSLSVDKAVAYTY |
Ga0163162_132725131 | 3300013306 | Switchgrass Rhizosphere | MKNISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKALARIG |
Ga0157372_111597741 | 3300013307 | Corn Rhizosphere | MKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDKAVAYT |
Ga0182008_101904021 | 3300014497 | Rhizosphere | VKEENVMKKISVIGATLVAAAVLCAAPISLHQSQDKGLTLS |
Ga0132256_1006005173 | 3300015372 | Arabidopsis Rhizosphere | MKKMSMIGATLLGAAVLCAAPISLHQSQPKGLSLSLDS |
Ga0132256_1016927511 | 3300015372 | Arabidopsis Rhizosphere | MKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDKA |
Ga0132256_1024089911 | 3300015372 | Arabidopsis Rhizosphere | MKKISLIAATLVGAAVLCASPISLHKDLSLSVDKARAVI |
Ga0132256_1025058122 | 3300015372 | Arabidopsis Rhizosphere | MKKISLIAATLVGAAVLCVAPISLHQAQDKGLSLSVDK |
Ga0132256_1027713732 | 3300015372 | Arabidopsis Rhizosphere | MKKMSMIGATLMGVAILCATPVSLHTSQDKGLSLSV |
Ga0132255_1017397341 | 3300015374 | Arabidopsis Rhizosphere | MKKTSVIGATLVAAAVLCAAPISLHQSQDKGLTLS |
Ga0132255_1043964442 | 3300015374 | Arabidopsis Rhizosphere | MKKISVIGATLVAAVMLCAAPISLQLSQDKGLSLSV |
Ga0182041_103592474 | 3300016294 | Soil | MKKISIIGATLLGAAVLCAAPVSFHRSQDKALSLSVDKAQAYYGVYRRHYGRV |
Ga0182041_104846451 | 3300016294 | Soil | MKKMSMIAATLIGAAILAAVPISLHQSQEKGLSLSVDSAYAVIG |
Ga0182035_108464863 | 3300016341 | Soil | MWMKKISVIGATLVGALVLCAAPISLHQSQDKGLTLSVDKARARIGHPLTP |
Ga0182035_109274013 | 3300016341 | Soil | MKKISVIAATLVGAAVMCAAPLSLHQAQDKGLLLSVDKAQAYYGHYRRVNR |
Ga0182040_104923861 | 3300016387 | Soil | MKKISVIGATLVAAAVLCAAPISLQPSQDKGLSLSVDKAQA |
Ga0182040_119802542 | 3300016387 | Soil | MRKISVIGATLVGAAVLCAAPISLHQSQDKGLSLSVDKARAVIGR |
Ga0182037_111027052 | 3300016404 | Soil | MIRLIAMKNISVIGATLVAAAVLCAAPISLHQSQDKGL |
Ga0182038_100897735 | 3300016445 | Soil | MWMKKLSVIGATLVGALMLCAAPISLQQSQDKGLSLSVDKAQARIGH |
Ga0187822_100349112 | 3300017994 | Freshwater Sediment | MKKTSVIGKTSVIGATLLGAAVLLATPVSLHQSRDTGLSLSVDKAQA |
Ga0187774_101994681 | 3300018089 | Tropical Peatland | MKKLSLIAATLVGAAVLCAAPISLHQSQDKGLSLSVDKVQAYYGVHRRHHRVARRYY |
Ga0173481_102322311 | 3300019356 | Soil | MKKISVIGATLLGAAVLCAAPISLHKDLSLSVDKARAVIGRP |
Ga0173481_108417711 | 3300019356 | Soil | MKKISVVAATLVGAAVLCASPVSLHKDLSLSVDKARAVIGRPLT |
Ga0173482_102048673 | 3300019361 | Soil | MKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDK |
Ga0210387_115053192 | 3300021405 | Soil | MKKISVIGATLVGAAVLLATPVSLHQSRDTGLSLSVDKAQ |
Ga0210390_105294501 | 3300021474 | Soil | MKKVSVIGATLVGAAVLLATPVSLHQSRDTGLSLSVDKAQAVIGR |
Ga0247793_10890171 | 3300023066 | Soil | MKKISVITATLVGAAVLCAAPISLHQSQDKGLTLS |
Ga0247796_10498371 | 3300023261 | Soil | MKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDKAVAYTYGHHRRVHRRVHRR |
Ga0207697_103200051 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKISVIGATLVAAAVLCAAPISLQGLSLSVDKARAVVGRP |
Ga0207710_101776423 | 3300025900 | Switchgrass Rhizosphere | MKKISVITATLVGAAVLCAAPISLHQSQDKGLTLSVDK |
Ga0207647_106086231 | 3300025904 | Corn Rhizosphere | MKKISLIAATLVGAAVLCAAPISLHQAQDKGLSLSVDKAQAYYGHYRRVHRRVHRRY |
Ga0207654_113369622 | 3300025911 | Corn Rhizosphere | MKKLSMIGILVGAAVLCAAPISLRQSQDKGVSFSVDKAE |
Ga0207707_106410271 | 3300025912 | Corn Rhizosphere | MKNISVIGATLVAAAVLCAAPISLHQSQDKGLSLSVDKA |
Ga0207671_102417941 | 3300025914 | Corn Rhizosphere | MKKISVITATLVGAAVLCAAPISLHQSQDKGLTLSVDKAQAR |
Ga0207663_107435452 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTSVIGATLVAAAVLCAAPISLHQSQDKVLSLSVDKAQARIGRPL |
Ga0207657_109445542 | 3300025919 | Corn Rhizosphere | MKKISVIGATLVAAAVLCAAPISLQGLSLSVDKARAVV |
Ga0207657_109967981 | 3300025919 | Corn Rhizosphere | MKKIRVIGATLVAAAVLCAAPISLQGLSLSVDKARAVV |
Ga0207694_107600141 | 3300025924 | Corn Rhizosphere | MKKISVIAATLLGAAVLCAAPISLHKDLSLSVDKARAVIGRPLTP |
Ga0207650_103129741 | 3300025925 | Switchgrass Rhizosphere | MKKISVIGATLVAAAVLCAAPISLQGLSLSVDKARAVVG |
Ga0207706_101116366 | 3300025933 | Corn Rhizosphere | MKKISVIGATLVAAAVLCAAPISLHQSQDKGLSLSV |
Ga0207661_120653431 | 3300025944 | Corn Rhizosphere | MKKISVIAATLVGAAVLCAAPISLQLSQDKGLTLSVDKARAR |
Ga0207679_101550324 | 3300025945 | Corn Rhizosphere | MMKKISVIGATLLGAAVLCAAPISLHKDLSLSVDKARAVIGR |
Ga0207702_109505253 | 3300026078 | Corn Rhizosphere | MKKISLIAATLVGAAVLCASPISLHQAQDKGLSLSVDKAV |
Ga0207674_112210261 | 3300026116 | Corn Rhizosphere | MKKISVIGATLVAAAVLCAAPISLQLSQDKGLTLSVDKARARIG |
Ga0207743_10075713 | 3300026945 | Tropical Forest Soil | MNKISVIGATLVAAAVLCAAPLSLHLSQDKGLSLS |
Ga0209984_10136431 | 3300027424 | Arabidopsis Thaliana Rhizosphere | MKNISVIGATLVAAAVLCAAPISLHKDLSLSVDKAQAR |
Ga0209689_13641861 | 3300027748 | Soil | MKKMSMIGATLLGAAVLCAAPISLHQSQNKGLSLSLDSADARVGQPL |
Ga0209073_102630842 | 3300027765 | Agricultural Soil | MKKISLIAATLVGAAVLCAAPISLRQAQDKGLSLSVDKAQAYYGG |
Ga0247821_108273601 | 3300028596 | Soil | MKKISVIGATLLGAAVLCAAPISLHLFQDKGMSLSVDKAQAFIPAG |
Ga0307498_104504591 | 3300031170 | Soil | MKKISVIGAALVAAAVVCAAPISLHLSQDKGMSLSVDK |
Ga0170818_1004562562 | 3300031474 | Forest Soil | MKKTSVIGATLAAAAMLCAAPISFQLSHDKGLSLSVDKAG |
Ga0318542_102627761 | 3300031668 | Soil | MKKISVIAATLVAAAVLCAAPISLHRSQDKALSLSVE |
Ga0310686_1155752651 | 3300031708 | Soil | MKKISVIGATLLGAAVLLAAPVSLHQSRDTGLSLSVDKAQAVIGR |
Ga0306918_109650791 | 3300031744 | Soil | MWMKKISVIGATLVGALVLCAAPISLHQSQDKGLTLSVDKARARV |
Ga0310907_103230002 | 3300031847 | Soil | MKKTSVIGATLAAAAMLCAAPISFQLSQDKGLSLSVDK |
Ga0310907_106587971 | 3300031847 | Soil | MKKLSMIGILVGAAVLCAAPISLRQSQDKGVSFSV |
Ga0306925_103100524 | 3300031890 | Soil | MKKISIIGATLLGAAVLCAAPVSFHRSQDKALSLSVDKAQAYYGVYRRHYGRVYRRGYYG |
Ga0306923_113352991 | 3300031910 | Soil | MKKISVIAATLLGAAVLCTAPLSVHQSQDRGLSVSVDKAQAYYGHYRRVYRRGYYGHGYG |
Ga0306923_121941161 | 3300031910 | Soil | MKKMSMIAATLIGAAILAAVPISLHQSQEKGLLLSVDSAYAVI |
Ga0306921_111525781 | 3300031912 | Soil | MKKINVIATTLLGAAVLCAVPISLHSGLSLSVDKAQAVIGRPLT |
Ga0310912_103798573 | 3300031941 | Soil | MKKISVIAATLVGAAVLCAAPISLHRSQDKALSLSVEKAQAYYGGVYRRHYRRVY |
Ga0310909_101188265 | 3300031947 | Soil | MKKIGLIAATLVGAAVLCAAPISLHQSQDKGLTLS |
Ga0306926_108361741 | 3300031954 | Soil | MWMKKISVIGATLVGALVLCAAPISLHQSQDKGLTL |
Ga0306926_116332271 | 3300031954 | Soil | MKKINVIATTLLGAAVLCAVPISLHSGLSLSVDKAQAV |
Ga0306926_119373281 | 3300031954 | Soil | MKKISVIAATLVAAAVLCAAPISLHRSQDKALSLSVEKAQAYYG |
Ga0306922_102358604 | 3300032001 | Soil | MKKIGLIAATLVGAAVLCAAPISLHQSQDKGLTLSVDKA |
Ga0306922_108748242 | 3300032001 | Soil | MKKISVIAATLVGAAVLCAAPISLHRSQDKALSLSAEKAQAYYG |
Ga0307470_103544061 | 3300032174 | Hardwood Forest Soil | MKKISVIGATLVAAAVLCAAPISLHQSQDKGLTLS |
Ga0307470_114070251 | 3300032174 | Hardwood Forest Soil | MKKLSVIGATLLGAAVLCAAPITLHLSQDRGLSVDK |
Ga0307472_1014234392 | 3300032205 | Hardwood Forest Soil | MKKLSVIRATLLGAAVLCAAPISLHLSQDKGMSLSVDKAQAF |
Ga0348332_140517002 | 3300032515 | Plant Litter | MRKISVIGATLVGAAVLLATPVSLHQSRDTGLSLSVDKAQAVIG |
Ga0310914_112301922 | 3300033289 | Soil | MKKISMIAATLVGGAVLCAAPISLHQSQDKGLTLSVDKARAVIGR |
Ga0310810_112508221 | 3300033412 | Soil | MKKISVIGATLVGAAVLCAAPISLQLSQDKGLTLSVDKARA |
⦗Top⦘ |