Metagenome / Metatranscriptome Family F055344

Basic Information
Family ID	F055344
Family Type	Metagenome / Metatranscriptome
Number of Sequences	138
Average Sequence Length	42 residues
Representative Sequence	MQLRNDPKCTQTLCNAPKHEFTVQWGGLGAFVAKNPDVTSWHEFL
Number of Associated Samples	94
Number of Associated Scaffolds	138

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	61.90 %
% of genes near scaffold ends (potentially truncated)	76.09 %
% of genes from short scaffolds (< 2000 bps)	76.09 %
Associated GOLD sequencing projects	91
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.19

Most Common Taxonomy
Group	Unclassified (100.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (40.580 % of family members)
Environment Ontology (ENVO)	Unclassified (79.710 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (78.261 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 12.33% β-sheet: 0.00% Coil/Unstructured: 87.67%
Feature Viewer

Powered by Feature Viewer

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	100.00 %

Scaffold	Taxonomy	Length	IMG/M Link
3300005445\|Ga0070708_101566184	Not Available	614	Open in IMG/M
3300005548\|Ga0070665_101840112	Not Available	612	Open in IMG/M
3300005617\|Ga0068859_100624200	Not Available	1170	Open in IMG/M
3300005617\|Ga0068859_100813609	Not Available	1021	Open in IMG/M
3300005617\|Ga0068859_101012493	Not Available	912	Open in IMG/M
3300005617\|Ga0068859_101591453	Not Available	721	Open in IMG/M
3300005617\|Ga0068859_102114034	Not Available	621	Open in IMG/M
3300005618\|Ga0068864_102028095	Not Available	581	Open in IMG/M
3300005719\|Ga0068861_101314275	Not Available	703	Open in IMG/M
3300005842\|Ga0068858_100808783	Not Available	914	Open in IMG/M
3300009977\|Ga0105141_109625	Not Available	832	Open in IMG/M
3300009980\|Ga0105135_115160	Not Available	637	Open in IMG/M
3300009980\|Ga0105135_118258	Not Available	602	Open in IMG/M
3300009990\|Ga0105132_114478	Not Available	715	Open in IMG/M
3300009992\|Ga0105120_1033706	Not Available	615	Open in IMG/M
3300009995\|Ga0105139_1034146	Not Available	835	Open in IMG/M
3300009995\|Ga0105139_1049558	Not Available	736	Open in IMG/M
3300009995\|Ga0105139_1104774	Not Available	545	Open in IMG/M
3300009995\|Ga0105139_1120249	Not Available	510	Open in IMG/M
3300010396\|Ga0134126_11790186	Not Available	673	Open in IMG/M
3300010400\|Ga0134122_12504622	Not Available	565	Open in IMG/M
3300010400\|Ga0134122_13112237	Not Available	519	Open in IMG/M
3300012949\|Ga0153798_10306803	Not Available	508	Open in IMG/M
3300014968\|Ga0157379_10674207	Not Available	969	Open in IMG/M
3300015270\|Ga0182183_1069640	Not Available	557	Open in IMG/M
3300015284\|Ga0182101_1017402	Not Available	877	Open in IMG/M
3300015293\|Ga0182103_1010494	Not Available	995	Open in IMG/M
3300015306\|Ga0182180_1012505	Not Available	1051	Open in IMG/M
3300015309\|Ga0182098_1007942	Not Available	1189	Open in IMG/M
3300015309\|Ga0182098_1029783	Not Available	820	Open in IMG/M
3300015309\|Ga0182098_1058251	Not Available	663	Open in IMG/M
3300015310\|Ga0182162_1060495	Not Available	666	Open in IMG/M
3300015310\|Ga0182162_1128811	Not Available	504	Open in IMG/M
3300015316\|Ga0182121_1122290	Not Available	542	Open in IMG/M
3300015316\|Ga0182121_1132308	Not Available	524	Open in IMG/M
3300015319\|Ga0182130_1026569	Not Available	882	Open in IMG/M
3300015324\|Ga0182134_1062929	Not Available	697	Open in IMG/M
3300015325\|Ga0182148_1090460	Not Available	605	Open in IMG/M
3300015327\|Ga0182114_1095659	Not Available	626	Open in IMG/M
3300015327\|Ga0182114_1147802	Not Available	523	Open in IMG/M
3300015328\|Ga0182153_1038370	Not Available	833	Open in IMG/M
3300015329\|Ga0182135_1051005	Not Available	765	Open in IMG/M
3300015335\|Ga0182116_1179348	Not Available	500	Open in IMG/M
3300015336\|Ga0182150_1071918	Not Available	699	Open in IMG/M
3300015337\|Ga0182151_1115253	Not Available	585	Open in IMG/M
3300015340\|Ga0182133_1088778	Not Available	697	Open in IMG/M
3300015340\|Ga0182133_1182208	Not Available	514	Open in IMG/M
3300015348\|Ga0182115_1192144	Not Available	655	Open in IMG/M
3300015349\|Ga0182185_1244118	Not Available	546	Open in IMG/M
3300015353\|Ga0182179_1320102	Not Available	506	Open in IMG/M
3300015353\|Ga0182179_1327453	Not Available	500	Open in IMG/M
3300015354\|Ga0182167_1223633	Not Available	684	Open in IMG/M
3300015354\|Ga0182167_1233659	Not Available	666	Open in IMG/M
3300015354\|Ga0182167_1351757	Not Available	515	Open in IMG/M
3300017412\|Ga0182199_1154872	Not Available	562	Open in IMG/M
3300017414\|Ga0182195_1137812	Not Available	611	Open in IMG/M
3300017421\|Ga0182213_1090515	Not Available	846	Open in IMG/M
3300017435\|Ga0182194_1157164	Not Available	500	Open in IMG/M
3300017439\|Ga0182200_1089780	Not Available	623	Open in IMG/M
3300017439\|Ga0182200_1163142	Not Available	504	Open in IMG/M
3300017445\|Ga0182198_1030709	Not Available	998	Open in IMG/M
3300017693\|Ga0182216_1115503	Not Available	656	Open in IMG/M
3300017792\|Ga0163161_11445922	Not Available	602	Open in IMG/M
3300020223\|Ga0182118_101633	Not Available	958	Open in IMG/M
3300020223\|Ga0182118_102603	Not Available	836	Open in IMG/M
3300020223\|Ga0182118_105388	Not Available	684	Open in IMG/M
3300025711\|Ga0207696_1203276	Not Available	520	Open in IMG/M
3300025961\|Ga0207712_10714248	Not Available	876	Open in IMG/M
3300026035\|Ga0207703_11419580	Not Available	668	Open in IMG/M
3300026088\|Ga0207641_12340664	Not Available	533	Open in IMG/M
3300028050\|Ga0268328_1061759	Not Available	532	Open in IMG/M
3300028051\|Ga0268344_1006474	Not Available	765	Open in IMG/M
3300028051\|Ga0268344_1022021	Not Available	532	Open in IMG/M
3300028052\|Ga0268300_1010388	Not Available	536	Open in IMG/M
3300028053\|Ga0268346_1036192	Not Available	538	Open in IMG/M
3300028053\|Ga0268346_1038109	Not Available	529	Open in IMG/M
3300028055\|Ga0268338_1028208	Not Available	584	Open in IMG/M
3300028056\|Ga0268330_1025202	Not Available	694	Open in IMG/M
3300028058\|Ga0268332_1047688	Not Available	608	Open in IMG/M
3300028058\|Ga0268332_1073585	Not Available	517	Open in IMG/M
3300028062\|Ga0268342_1032714	Not Available	561	Open in IMG/M
3300028062\|Ga0268342_1036116	Not Available	542	Open in IMG/M
3300028141\|Ga0268326_1014321	Not Available	504	Open in IMG/M
3300028144\|Ga0268345_1002029	Not Available	1063	Open in IMG/M
3300028144\|Ga0268345_1022601	Not Available	547	Open in IMG/M
3300028150\|Ga0268343_1020119	Not Available	503	Open in IMG/M
3300028151\|Ga0268308_1023465	Not Available	567	Open in IMG/M
3300028154\|Ga0268341_1013648	Not Available	654	Open in IMG/M
3300028248\|Ga0268312_1033871	Not Available	524	Open in IMG/M
3300028248\|Ga0268312_1037184	Not Available	507	Open in IMG/M
3300028253\|Ga0268316_1012858	Not Available	617	Open in IMG/M
3300028256\|Ga0268304_1016077	Not Available	501	Open in IMG/M
3300028380\|Ga0268265_11440274	Not Available	691	Open in IMG/M
3300028469\|Ga0268337_1001102	Not Available	1156	Open in IMG/M
3300028470\|Ga0268307_1004124	Not Available	848	Open in IMG/M
3300028470\|Ga0268307_1014457	Not Available	596	Open in IMG/M
3300028470\|Ga0268307_1019399	Not Available	544	Open in IMG/M
3300028471\|Ga0268323_1006100	Not Available	729	Open in IMG/M
3300028471\|Ga0268323_1016378	Not Available	551	Open in IMG/M
3300028476\|Ga0268329_1001294	Not Available	1184	Open in IMG/M
3300028525\|Ga0268305_100922	Not Available	1140	Open in IMG/M
3300028525\|Ga0268305_107643	Not Available	583	Open in IMG/M
3300028526\|Ga0268339_1008620	Not Available	649	Open in IMG/M
3300028527\|Ga0268335_1005997	Not Available	703	Open in IMG/M
3300033530\|Ga0314760_1168551	Not Available	532	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.38%
Environmental	Environmental	2.90%
Engineered	Engineered	0.72%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.38%
Terrestrial	Environmental → Terrestrial	2.90%
Bioreactor	Engineered → Bioreactor	0.72%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	71.74%
Rhizoplane	Host-Associated → Plants → Rhizoplane	13.04%
Unclassified	Host-Associated → Plants → Unclassified	7.25%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.35%
Soil	Environmental → Terrestrial → Soil	2.90%
Unclassified	Engineered → Bioreactor → Unclassified	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	71.74%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	13.04%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	7.25%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.17%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.17%
Loam	Environmental → Terrestrial → Soil → Loam	0.72%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	71.74%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	13.04%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	7.25%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	2.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.17%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.72%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.72%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	40.58%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	31.16%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	12.32%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	7.25%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.17%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.17%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.45%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.72%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.72%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300009977	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300012949	Switchgrass enrichment cultures co-assembly	Engineered	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300020223	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG	Host-Associated	Open in IMG/M
3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028052	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028055	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028057	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028141	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028144	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028150	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028256	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028469	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028470	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028471	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028525	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028526	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028527	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300033530	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070668_1006719191	3300005347	Switchgrass Rhizosphere	MQLQNDNKCTQTLCNTPKHEFRVQWSGLGAVVAKNPDVTSWHEL
Ga0070668_1020684511	3300005347	Switchgrass Rhizosphere	MQLQKDNKRTQTLCNTPKHEFRVQRSGLGVFVAKNLDATSWHKL
Ga0070708_1015661841	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MQLRNDLKCTQILCNAPKHEFTVQCGGLGAFIAKNPGVTSWH
Ga0070665_1018401122	3300005548	Switchgrass Rhizosphere	MELQNDPKCTQTPYNAPKHEFRVQWGGLGAFVAKNPDVTSWHEL
Ga0068859_1006242002	3300005617	Switchgrass Rhizosphere	PKCTQTLCNAPKHEFTVQWGGLGAFVEKNPYVTSWLELLH*
Ga0068859_1008136091	3300005617	Switchgrass Rhizosphere	NDPKCTQILQNILKHYFRVQWGGLGAFVVKNPDVTSWHELLH*
Ga0068859_1010124931	3300005617	Switchgrass Rhizosphere	ASSFMELRNDPKCTQTLYNAPKHEFRVQWGGLGAFVVKNRNVTSWHELLL*
Ga0068859_1015914531	3300005617	Switchgrass Rhizosphere	MELRNDPKCTQTRYNAPKHEFRVQWGGLGAFVAKNPD
Ga0068859_1021140342	3300005617	Switchgrass Rhizosphere	MELRNDPKCTQTLYNAPKHEFRVQWGGLGAFVVKN
Ga0068864_1018010691	3300005618	Switchgrass Rhizosphere	PKCTQTLYNAPKHEFRVQWGGLGAFVVKNPNVTSWHKLLL*
Ga0068864_1020280952	3300005618	Switchgrass Rhizosphere	MRLRNDPKCTQTLCNAPKHEFRVQWSGLGAFLAKNPDV
Ga0068864_1021206041	3300005618	Switchgrass Rhizosphere	NDPKCTQTLCNTPKHEFRVQWSGLGVLVAKNPDVTSWYVLLH*
Ga0068861_1013142751	3300005719	Switchgrass Rhizosphere	MQLRNDPECTQILCNAPKHEFTVQWGGLGAFVVKNPDVTSWHEL
Ga0068863_1019045891	3300005841	Switchgrass Rhizosphere	MELRNGPKCTPTLCNTPKHEFRVQWGGLGALVEKN
Ga0068858_1008087831	3300005842	Switchgrass Rhizosphere	TSSHYFATSFMQLRNNPKCTQTLRNAPKHEFWVQWGGLGAFVVKNPDVTSWHELLL*
Ga0068860_1019148131	3300005843	Switchgrass Rhizosphere	SSFMQLQNDNKCTQTLCNTPKHEFRVQWSGLGAVVAKNPDVTSWHELVH*
Ga0105141_1096251	3300009977	Switchgrass Associated	MELRNDPKCTQPLYNAPKHEFRVQWGGLGGFIAKIPDVTSWHGLL
Ga0105135_1151601	3300009980	Switchgrass Associated	MQLGNDPKCTQTLCNAPKHEFRVQCGGLGAFIAKNPDVTSWHELMH
Ga0105135_1182582	3300009980	Switchgrass Associated	FAPSFMKLRIDPKYTQILGNIPKHYLRVQLGGLGVSVAKNPDVTSWHELLH*
Ga0105133_1312811	3300009981	Switchgrass Associated	MRLRNDPKCTQTLRNTPKHEFRVQWSGLGAFIAKNQDVT
Ga0105132_1144781	3300009990	Switchgrass Associated	MQLRNDPKSIRTLCNAPKHEFRVQWSGLGEFVAKNVDV
Ga0105120_10337061	3300009992	Switchgrass Associated	MQLRIERKCTQTLCNAPKHEFRVQWGGLGAFVEKNNDMTSW
Ga0105139_10341461	3300009995	Switchgrass Associated	MQLGNNPKCTQTLCNAPKHEFRVQWGGLGAFVEKNPGVT
Ga0105139_10495581	3300009995	Switchgrass Associated	MQLRNDPKCNQTLCYAPKHEFPVQWAGFGAFVVKNLDVTLWHE
Ga0105139_11047742	3300009995	Switchgrass Associated	MQLGNDPKCTQTLCNARKHEFRVQWGGLGAFVAKNRDVAS
Ga0105139_11202491	3300009995	Switchgrass Associated	MQLGNDPKCTQTLCNSPKHEFSVQWGGLGAFVAKNRDVASWHER
Ga0134126_117901861	3300010396	Terrestrial Soil	MELRNDPKCTQTLYNAPKHEFRVQWGGLGAFVAKNPD
Ga0134122_125046221	3300010400	Terrestrial Soil	MQLQNDPECIQTLCNAPKLEFTVQWGGLGEFVEKNP
Ga0134122_131122371	3300010400	Terrestrial Soil	MQLRNDPKCTQTQCNAPKHEFRVQWDGLGAFVVKNPDVT
Ga0153798_103068031	3300012949	Switchgrass Degrading	NDPKCTQTLGNARKHEFRVQWGGLGAFVEKNPDVTSR*
Ga0157379_106742071	3300014968	Switchgrass Rhizosphere	MQVRNDPKCSQTLCNLPKHEFMVQWGGLGAFIAKNPDMTLW
Ga0182183_10278742	3300015270	Switchgrass Phyllosphere	LRNDPKYTQTLSNTPKHECRVQWGGLGAFIEKNPDVTLWQELSN*
Ga0182183_10696401	3300015270	Switchgrass Phyllosphere	MQLRNVNKCTQTLYNATKHEFRVQWSGLDAFVAKNPDVT
Ga0182101_10174021	3300015284	Switchgrass Phyllosphere	MQLRNDPECTQILCNAPKDEFTVQWGGLGAFVVKNPDVT
Ga0182103_10104941	3300015293	Switchgrass Phyllosphere	MQLRNDPKCTQTLWKAPKHEFRVQWGGSGAFVGKNYNVTSWHKLL
Ga0182104_10968911	3300015297	Switchgrass Phyllosphere	MQLQKDNKRTYTLCNTPKHEFRVQRSGLGVFVAKNLDATSWHKLV
Ga0182184_10463621	3300015301	Switchgrass Phyllosphere	KYTQTLCNAPKHEFRVQWGGLGAFIEKNPDVTSWQELSN*
Ga0182184_10468171	3300015301	Switchgrass Phyllosphere	MQLQNDNKCTQTLCNTPKHEFRVQWSGLGAVVAKNPDVT
Ga0182180_10125051	3300015306	Switchgrass Phyllosphere	DPKCTQTLCNAPKHEFGVQQSGLGAFIAKNPDVTSWHVVLH*
Ga0182098_10079421	3300015309	Switchgrass Phyllosphere	MELRNDPKCTQTLYNAPKHEFRVQWGGLGAFIAKNPNV
Ga0182098_10297831	3300015309	Switchgrass Phyllosphere	MQLRNDPECTQTLCNARKHGFGVQWGGLGAFVAKNPDVNSW
Ga0182098_10582511	3300015309	Switchgrass Phyllosphere	MQLRNDPKCTQRIYNAPKHEFRVQWGGLGAFVAKNPYVTSWHELL
Ga0182162_10604951	3300015310	Switchgrass Phyllosphere	FMQLRNDPKCTQTLYNTPKNEFMVKWGGSDVFVAKITT*
Ga0182162_11288111	3300015310	Switchgrass Phyllosphere	MQLRNDPKCIQTLCHAPKHVFRVQWGELGAFVEKNPDVTSWQELSHQLHQFTLFCIEFH
Ga0182182_10125231	3300015311	Switchgrass Phyllosphere	MQLQNDNKCTQTLCNTPKHEFRVQWSGLGAVVAKNPDVTS
Ga0182120_10380751	3300015315	Switchgrass Phyllosphere	NDPKCTQTLCNTPKHEFRVQWSGLGVLVEKNPDVTLRHVLLH*
Ga0182121_11222901	3300015316	Switchgrass Phyllosphere	MQLQNDPKCIQILRNAPKHLFWVQWGRFGPLVVKKPDVTSWHELLH
Ga0182121_11323081	3300015316	Switchgrass Phyllosphere	MRLRNDPKCTRTLCNTPKPEFRVQWGGLGAFVEKNPDVTLWHE
Ga0182181_11143911	3300015318	Switchgrass Phyllosphere	MQLQNDNKCTQTLCNTPKHEFRVQWSGLGAVVAKNPDVTSWHELVH
Ga0182130_10265691	3300015319	Switchgrass Phyllosphere	MQLRNDPKCTQTLCNAPKNEFLVQWGGSSAFVAKNYNVNSWHKLL
Ga0182134_10629291	3300015324	Switchgrass Phyllosphere	MQLRNVNKYTQTLYNAIKHEFRVQWSGLDAFVAKNPDVTSWH
Ga0182148_10904601	3300015325	Switchgrass Phyllosphere	QYIAKYTQNLRDPHKHEFTVQWGGLGAFVAKNSDTTSWYELLH*
Ga0182166_10612961	3300015326	Switchgrass Phyllosphere	MQFQNDNKCTQTLYNAPKHEFRVQWGGLGVFIVKNP
Ga0182114_10956591	3300015327	Switchgrass Phyllosphere	SFMELQNDPKCTQTPYNAPKHEFRVQWGGLGAFVVKNSDVTSWHELLY*
Ga0182114_11478021	3300015327	Switchgrass Phyllosphere	MPLRNDPKCIQTLCNAPKHVFRVQWGGLGVFVEKYPDVTSWQELSHQ
Ga0182153_10383701	3300015328	Switchgrass Phyllosphere	PKCSQTLCNAPKHESRVQWGGLDVLVAKIPDVTLWHELLH*
Ga0182135_10510051	3300015329	Switchgrass Phyllosphere	NDPKCTQILCNAPKHEFRVQWGGLVAFVAKNLDVTSWHELLH*
Ga0182147_10180091	3300015333	Switchgrass Phyllosphere	MQLRNDPKCTQIHRNIPKHYFRVQLGGLGVSVAKNPDV
Ga0182147_11351341	3300015333	Switchgrass Phyllosphere	MQLRNDPKCTQILRNIPKHYFRVQLGGLGLSIAKNPDITSWH
Ga0182132_10985811	3300015334	Switchgrass Phyllosphere	SFVRQPNDPKCTQIVENATKHEFRDQWGGSAAFVAK*
Ga0182116_11793481	3300015335	Switchgrass Phyllosphere	MELRNDSKCTQTLYNAPKHEFRVQWGGLGAFVVKNPNVTSWHELLL
Ga0182150_10303921	3300015336	Switchgrass Phyllosphere	CTQTLCNTQKHEFRVQWSGLGAVVAKNPDVTSWHELVH*
Ga0182150_10719181	3300015336	Switchgrass Phyllosphere	MQLRNVKKYTQKVYNAPKHEFRVQWSGLDAFVAKNPDV
Ga0182151_11152531	3300015337	Switchgrass Phyllosphere	MELQNDPKCTQTLYNAAKHEFRVQWDGLGAFVAKD
Ga0182133_10887781	3300015340	Switchgrass Phyllosphere	MQFCNDPKFTQTLCNAPKHEFRVQWGGLGAFVEKNPGVTSCHELSH
Ga0182133_11822081	3300015340	Switchgrass Phyllosphere	MELGNDPKCNQTLYNAPKHEFRVQWGGLGAFIVKNPNVISWHK
Ga0182115_11921441	3300015348	Switchgrass Phyllosphere	QNDPKCTQTPYNAPKHEFRVQWGGLGAFVAKNPDVTSWH*
Ga0182185_12441181	3300015349	Switchgrass Phyllosphere	TLCNAPKHESRVQWGGLGAFVAKNLDVTSWHELLH*
Ga0182179_13201021	3300015353	Switchgrass Phyllosphere	MGLRNDPKCTQTLYNAPKHEFRVQWGGLGAFVEKNLGVT
Ga0182179_13274531	3300015353	Switchgrass Phyllosphere	MELRNDPKCTQTLYNAPKHEFRVQWGGLGAFVVKT
Ga0182167_12236331	3300015354	Switchgrass Phyllosphere	MQLRNDPKCTQILRNAPKHWYRVQWGGLVVFVAKNPDVTSWHEL
Ga0182167_12336591	3300015354	Switchgrass Phyllosphere	MQLRNDPKCTQTLCNAPKHEFTVQWGGLGAFVAKNPDVTSWHEFL
Ga0182167_12426261	3300015354	Switchgrass Phyllosphere	NDPKCTQTLFNTPKHEFRVQWGGLGAFVVKNPDVTSWHELLL*
Ga0182167_13517571	3300015354	Switchgrass Phyllosphere	MQLRIDPKCTQTLYNTPKHEFRVQWGVLGAFVVKNPDVT
Ga0182197_10589841	3300017408	Switchgrass Phyllosphere	MQLQKDNKRTKTLCNTPKHEFRVQRSGLGVFVAKNLDATSWHK
Ga0182199_11548722	3300017412	Switchgrass Phyllosphere	MQLGNDPKCTQTLCNAPKHEFTVQWGGLGAFVVKNPDVTSWHELL
Ga0182195_11378121	3300017414	Switchgrass Phyllosphere	MQLQNDPECIQTLCNAPKLEFTVQWGGLGEFVEKNPDMT
Ga0182213_10905151	3300017421	Switchgrass Phyllosphere	NDPKCIQTLCNVPKHESRVQWGGLGALVAKNPEVTSWYKL
Ga0182194_11571641	3300017435	Switchgrass Phyllosphere	MQLQNDPKCIQTLCNAPKLEFTVQWGGLGAFVEKNPDMTS
Ga0182200_10897801	3300017439	Switchgrass Phyllosphere	MQLRNDPKYTQTLCNAPKHEFRVQWSGLGAFVAKNPD
Ga0182200_11631421	3300017439	Switchgrass Phyllosphere	MQLRNDPKCTQTLLKAPKHEFRVQWGGSGVFVGKNYNVT
Ga0182198_10307091	3300017445	Switchgrass Phyllosphere	DPKCSQTICNAPKYEFRVQWGGLGAIIAKNPDVTLWHELLH
Ga0182216_11155031	3300017693	Switchgrass Phyllosphere	MQLRNVNKCTETLYNATKDEFRVQWSALDVFVAKNPDVTSWHELL
Ga0163161_114459221	3300017792	Switchgrass Rhizosphere	MQLRNDPKCTQTLCDAPKHEFRVQWDGLGAFVAKNADLTSWHEL
Ga0182118_1016331	3300020223	Switchgrass Phyllosphere	MQLRNDPKCTQTQCNAPKYEFRVQWGALGAFVVKNPDLTS
Ga0182118_1026031	3300020223	Switchgrass Phyllosphere	MELQNDPKGTQTPYNAPKHEFRVQWGGLGAFVAKSPD
Ga0182118_1053881	3300020223	Switchgrass Phyllosphere	MQLRNDPKCTQTLCNAPKHESRVQWGGLDALVAKIPDVTSWHEL
Ga0207696_12032761	3300025711	Switchgrass Rhizosphere	MRLRNDPKCTQTLRNAPKHEFRVQWGGLGAFVVKNPD
Ga0207712_107142481	3300025961	Switchgrass Rhizosphere	MELRNDPKCTQTLYNAPKHEFRVQWGGLGAFVVKNPNVT
Ga0207703_114195801	3300026035	Switchgrass Rhizosphere	MQLRNNPKCTQTLRNATKHEFWVQWGGLGAFVVKNPDVDS
Ga0207703_115846221	3300026035	Switchgrass Rhizosphere	MQLQNDNKCTQTLCNTPKHEFRVQWSGLGAVVAKNPDV
Ga0207641_123406641	3300026088	Switchgrass Rhizosphere	MELQNDPKCTQTPYNAPKHEFRVQWGRLGAFVAKNPDVT
Ga0268322_10376281	3300028049	Phyllosphere	MQLQNDNKCTQTLCNTPIHVFRVQWSGLGAVVAKNPDV
Ga0268328_10617591	3300028050	Phyllosphere	MQLRNDPKCSQTLYNAPKHKSRVQWGELGVLVVKNPDV
Ga0268344_10064741	3300028051	Phyllosphere	MRLLNDPKCTQTLCNAPKHEFGVQWGGLGAFFEENLGVTSWHELS
Ga0268344_10220211	3300028051	Phyllosphere	VELRNDPKCTQTLYNAPKHEFGVQWGGLGAFVAKNPDVTSWHE
Ga0268300_10103881	3300028052	Phyllosphere	MQLQNDPKCTQILQNILKHYFRVQWGGLGAFVAKNPDV
Ga0268346_10361921	3300028053	Phyllosphere	MELRNDPKCTQTLYNAPKHEFRVQWGRLGGFVAKNSDVTSWHERL
Ga0268346_10381091	3300028053	Phyllosphere	MRLRNDPKCTQTLCDAPKHEFRVQWSGFGAFIAKNPDVTSWHVLL
Ga0268338_10105441	3300028055	Phyllosphere	NDNKCTQTLCNTPKHEFRVQWSGLGAVVAKNPDVTSWHELVH
Ga0268338_10282082	3300028055	Phyllosphere	MEFRNDPKCTQTLYNAPKHEFRVQWGGLGEFVAKNPD
Ga0268330_10252021	3300028056	Phyllosphere	MQLQNDPKCTQILQNISKHYFRVQWGGSGASIAKNPDVDWVHSFGKI
Ga0268352_10412631	3300028057	Phyllosphere	MQLQNDNKCTQTLCNTPKHEFRVQWSGLGAVVAKNPDVTSWHE
Ga0268332_10476881	3300028058	Phyllosphere	LRGTDICINCTSSPYFALSFMELQNDPKCTQTPYNAPKHEFRVQWGELGAFVEKNPDVTSWRELLY
Ga0268332_10735851	3300028058	Phyllosphere	MQLRNDPKCIPILCNAPKHEFRVQWSGLGAFIAKNPDVT
Ga0268314_10167481	3300028061	Phyllosphere	MQLRNDPKCTQIIRNGRKHLFRVQWGGLGAFVAENLDVTSWH
Ga0268342_10327141	3300028062	Phyllosphere	MELRNDPKCTQPLYNAPKHEFRVQWGGLGGFIAKN
Ga0268342_10361161	3300028062	Phyllosphere	MQLRIDPKCTQTLCNTQKHEFTVQWGGLGAFVEKNPGVTSWHELS
Ga0268326_10143211	3300028141	Phyllosphere	CFALSFMELQNDPKCTQTPYNAPKHEFRVQWGGLGAFVAKNPDVTSWHELLY
Ga0268345_10020291	3300028144	Phyllosphere	FVRQPNSPKCIQMVGNAPKLEFRVPWGGLGAFVAKKI
Ga0268345_10226012	3300028144	Phyllosphere	MELRNDPKCTQTLYNAPKHEFRVQWGGLGAFVVKNPNVTSWHELLL
Ga0268343_10201191	3300028150	Phyllosphere	MELRNDPKCTQTLYNAPKHEFRVQWGRLGGFVVKNSDVT
Ga0268308_10234652	3300028151	Phyllosphere	FMELQNDPKGTQTPYNAPKHEFRVQWGGLGAFVAKSPDVTSWHKLLY
Ga0268320_10134301	3300028153	Phyllosphere	NDPKCTQTLCNTPKHEFRVQWSGLGAFIAKNHDVTALHELVQ
Ga0268320_10278121	3300028153	Phyllosphere	TQTLCNAPKHEFRLQWGGLGAFIEKNLEVTSWQELSN
Ga0268341_10136481	3300028154	Phyllosphere	MELRNDSKCTQTLYNALKHEFRVQWGGLGAFVVKNPNVSSWHELF
Ga0268312_10338711	3300028248	Phyllosphere	FVELRNDPKCTQTLCNAPKLEFRVQWGGLGAFVAKNPDVASWHELLH
Ga0268312_10371841	3300028248	Phyllosphere	MQLRNDPKCIQTLYNIPKHEFRVQCGGLGAFVEKNPDVTS
Ga0268316_10128581	3300028253	Phyllosphere	MRLRNDPKCTQTLYNAPKHEFRVQCGRLGAYVAKNPDVTSGH
Ga0268304_10160771	3300028256	Phyllosphere	MQIRNNPKYTQTLCNAPKHEFRVQWGGLGAFVMKNPDVDSWHEL
Ga0268310_10076001	3300028262	Phyllosphere	TLCNTPKHEFRVQWSGLGAVVAKNPDVTLWHELVH
Ga0268310_10098741	3300028262	Phyllosphere	ELRNDPKYTQTLCNAPKHEFRVQWGGLGAFIEKNPDVTSWQELSN
Ga0268265_114402741	3300028380	Switchgrass Rhizosphere	DPKCTQTPYNAPKHEFRVQWGRLGAFVAKNPDVTSWHELLY
Ga0268264_114511261	3300028381	Switchgrass Rhizosphere	NKCTQTLCNTQKHEFRVQWSGLGAVVAKNPDVTSWHELVH
Ga0268337_10011021	3300028469	Phyllosphere	MQLRNDPKCTQRIYNAPKQEFRVQWGGLGAFVAKNPYVT
Ga0268307_10041241	3300028470	Phyllosphere	FMQLRNDPKCTQTLYNTPKHEFRVQWGVLGAFVVKNPDVTSWHELLL
Ga0268307_10144571	3300028470	Phyllosphere	RNDPKCIQTLYNAPKHEFRVQWDGLGAFIAKNPDVASWH
Ga0268307_10193991	3300028470	Phyllosphere	MELRNDPKCTQILCNAPKHESRVQWGGLGAFVAKNPNVTSWHDL
Ga0268323_10061001	3300028471	Phyllosphere	NDPKCAQTLCNAPIHEFRVQWSGLGSFVVKNPDVTVWHEIMH
Ga0268323_10163781	3300028471	Phyllosphere	MQIRNDPKCAQTLCNAPKHEFRVQWSGLGAFVAKNPDVTYWQELSHELHQFTLFCIE
Ga0268315_10022331	3300028472	Phyllosphere	ELRNDPKYTQTLCNKPKHEFRVQWGGLGAFIEKNPDVTLWQELSN
Ga0268329_10012941	3300028476	Phyllosphere	MQLRIDPKCTQTLCNTQKHEFTVQWGGLGAFVAKNPNVTSWHEL
Ga0268305_1009221	3300028525	Phyllosphere	SPCFALSFMELQNDPKCTQTPYNAPKHEFRVQWGGLGAFVAKNPDVTSWHELLY
Ga0268305_1056401	3300028525	Phyllosphere	MQLQNDNKCTQTLCNTPKHEFRVQWSGLGAVVAKNPYVTS
Ga0268305_1076431	3300028525	Phyllosphere	MKLRNDPKCTQTLWKAPKHEFRVQWGGSGAFIGKNYN
Ga0268339_10086201	3300028526	Phyllosphere	MQLQNDPKCTQILQNILKHYFRVQWGGLGAFVVKNPDVTLWHE
Ga0268335_10059971	3300028527	Phyllosphere	MQLRNDTKCTQILRNAPKYRFWVQWGGLGAFVAKNTDVT
Ga0314760_11685511	3300033530	Switchgrass Phyllosphere	MQIRNDPKCAQTLCNAPKHEFRVQWSGLGAFVAKNPDVTSWQQLSHEL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.19
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.19
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F055344

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign