NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055385

Metagenome / Metatranscriptome Family F055385

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055385
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 80 residues
Representative Sequence MDPFRPAPRFDGTGFQRWKILMQAHLQATGLNVWRVVSEGIKNNGQQEKQYDVTAKCIILSSLSDNVFNRVYSCENAK
Number of Associated Samples 93
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 91.79 %
% of genes near scaffold ends (potentially truncated) 61.59 %
% of genes from short scaffolds (< 2000 bps) 97.10 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (84.783 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(81.884 % of family members)
Environment Ontology (ENVO) Unclassified
(94.928 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(71.014 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 59.43%    β-sheet: 0.00%    Coil/Unstructured: 40.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF13961DUF4219 45.65
PF14223Retrotran_gag_2 14.49


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.78 %
UnclassifiedrootN/A15.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005365|Ga0070688_101559181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300005445|Ga0070708_101282062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum685Open in IMG/M
3300005618|Ga0068864_102234737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum553Open in IMG/M
3300009101|Ga0105247_10806576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum717Open in IMG/M
3300009975|Ga0105129_118519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300009977|Ga0105141_113550All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300009977|Ga0105141_121867All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300009980|Ga0105135_119717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum588Open in IMG/M
3300009989|Ga0105131_116727All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum690Open in IMG/M
3300009995|Ga0105139_1094142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum573Open in IMG/M
3300010371|Ga0134125_13029253All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum509Open in IMG/M
3300010373|Ga0134128_12627606Not Available555Open in IMG/M
3300010400|Ga0134122_11027113All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum810Open in IMG/M
3300015273|Ga0182102_1018255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum648Open in IMG/M
3300015278|Ga0182099_1048545All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum568Open in IMG/M
3300015280|Ga0182100_1054090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300015284|Ga0182101_1048959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes643Open in IMG/M
3300015293|Ga0182103_1041920Not Available675Open in IMG/M
3300015293|Ga0182103_1070043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum575Open in IMG/M
3300015293|Ga0182103_1103258Not Available502Open in IMG/M
3300015297|Ga0182104_1071126All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum609Open in IMG/M
3300015297|Ga0182104_1114624All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300015309|Ga0182098_1043343All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum729Open in IMG/M
3300015309|Ga0182098_1094351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum562Open in IMG/M
3300015310|Ga0182162_1044062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum741Open in IMG/M
3300015311|Ga0182182_1037713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum756Open in IMG/M
3300015312|Ga0182168_1100058Not Available570Open in IMG/M
3300015312|Ga0182168_1101644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M
3300015312|Ga0182168_1131156Not Available512Open in IMG/M
3300015313|Ga0182164_1081017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum617Open in IMG/M
3300015315|Ga0182120_1062122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum685Open in IMG/M
3300015316|Ga0182121_1043599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum802Open in IMG/M
3300015318|Ga0182181_1068894All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum603Open in IMG/M
3300015319|Ga0182130_1084201All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum604Open in IMG/M
3300015319|Ga0182130_1137255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300015320|Ga0182165_1011459All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1215Open in IMG/M
3300015320|Ga0182165_1074591All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300015320|Ga0182165_1120523All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum546Open in IMG/M
3300015320|Ga0182165_1143643All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300015324|Ga0182134_1092762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum605Open in IMG/M
3300015325|Ga0182148_1043064All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum782Open in IMG/M
3300015325|Ga0182148_1077692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum639Open in IMG/M
3300015327|Ga0182114_1074968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum687Open in IMG/M
3300015327|Ga0182114_1158819All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300015331|Ga0182131_1079951All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum656Open in IMG/M
3300015332|Ga0182117_1048608All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum832Open in IMG/M
3300015332|Ga0182117_1052552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum809Open in IMG/M
3300015332|Ga0182117_1121669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum581Open in IMG/M
3300015334|Ga0182132_1113775All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum595Open in IMG/M
3300015334|Ga0182132_1132295All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum559Open in IMG/M
3300015336|Ga0182150_1048341All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum805Open in IMG/M
3300015336|Ga0182150_1111994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum591Open in IMG/M
3300015336|Ga0182150_1131211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum555Open in IMG/M
3300015336|Ga0182150_1135052Not Available548Open in IMG/M
3300015338|Ga0182137_1101660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum642Open in IMG/M
3300015338|Ga0182137_1126865All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum585Open in IMG/M
3300015340|Ga0182133_1129497All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum597Open in IMG/M
3300015348|Ga0182115_1060251All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1133Open in IMG/M
3300015348|Ga0182115_1158640Not Available725Open in IMG/M
3300015348|Ga0182115_1240826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum576Open in IMG/M
3300015349|Ga0182185_1288126Not Available502Open in IMG/M
3300015350|Ga0182163_1200479All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum625Open in IMG/M
3300015350|Ga0182163_1297682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum504Open in IMG/M
3300015352|Ga0182169_1169044Not Available714Open in IMG/M
3300015352|Ga0182169_1232745All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum600Open in IMG/M
3300015352|Ga0182169_1287255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300015353|Ga0182179_1151550All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum723Open in IMG/M
3300015354|Ga0182167_1152440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum853Open in IMG/M
3300015354|Ga0182167_1284899All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum589Open in IMG/M
3300017412|Ga0182199_1070052Not Available758Open in IMG/M
3300017412|Ga0182199_1131319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum600Open in IMG/M
3300017412|Ga0182199_1200785Not Available507Open in IMG/M
3300017414|Ga0182195_1117335All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum650Open in IMG/M
3300017414|Ga0182195_1129767All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum625Open in IMG/M
3300017414|Ga0182195_1140902Not Available605Open in IMG/M
3300017414|Ga0182195_1179804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300017422|Ga0182201_1049428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum725Open in IMG/M
3300017422|Ga0182201_1093506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum586Open in IMG/M
3300017432|Ga0182196_1119940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum552Open in IMG/M
3300017435|Ga0182194_1100119All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum592Open in IMG/M
3300017435|Ga0182194_1140790All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300017439|Ga0182200_1087366All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum629Open in IMG/M
3300017445|Ga0182198_1172168All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum537Open in IMG/M
3300017447|Ga0182215_1139651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum555Open in IMG/M
3300017691|Ga0182212_1128271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum575Open in IMG/M
3300017692|Ga0182210_1118984All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum576Open in IMG/M
3300017693|Ga0182216_1048319Not Available907Open in IMG/M
3300017693|Ga0182216_1200435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum526Open in IMG/M
3300017693|Ga0182216_1215903All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300017693|Ga0182216_1224418All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300020023|Ga0182178_1014918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum584Open in IMG/M
3300028050|Ga0268328_1024814All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum731Open in IMG/M
3300028053|Ga0268346_1010961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum774Open in IMG/M
3300028055|Ga0268338_1025556All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum602Open in IMG/M
3300028062|Ga0268342_1027901All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum592Open in IMG/M
3300028062|Ga0268342_1037059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300028141|Ga0268326_1002503All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum827Open in IMG/M
3300028144|Ga0268345_1006224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum789Open in IMG/M
3300028151|Ga0268308_1016969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum629Open in IMG/M
3300028155|Ga0268349_1044076All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300028262|Ga0268310_1001454All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1531Open in IMG/M
3300028476|Ga0268329_1014748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum622Open in IMG/M
3300032464|Ga0214492_1045959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum849Open in IMG/M
3300032465|Ga0214493_1055547All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum937Open in IMG/M
3300032466|Ga0214503_1107185All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum870Open in IMG/M
3300032467|Ga0214488_1054163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum888Open in IMG/M
3300032469|Ga0214491_1088683All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum746Open in IMG/M
3300032550|Ga0321340_1056152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum542Open in IMG/M
3300032590|Ga0214489_1028457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum836Open in IMG/M
3300032591|Ga0214484_1081897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum676Open in IMG/M
3300032591|Ga0214484_1123613Not Available519Open in IMG/M
3300032625|Ga0214501_1218812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum605Open in IMG/M
3300032689|Ga0214497_1116867All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300032698|Ga0214485_1088136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum587Open in IMG/M
3300032761|Ga0314733_1069244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum675Open in IMG/M
3300032761|Ga0314733_1103260Not Available533Open in IMG/M
3300032781|Ga0314742_1088832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum520Open in IMG/M
3300032789|Ga0314725_1017033All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum887Open in IMG/M
3300032790|Ga0314731_1053532All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum670Open in IMG/M
3300032790|Ga0314731_1080211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum527Open in IMG/M
3300032791|Ga0314748_1089062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum652Open in IMG/M
3300032823|Ga0314723_1097794Not Available547Open in IMG/M
3300032915|Ga0314749_1079458All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum707Open in IMG/M
3300032934|Ga0314741_1094606All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum691Open in IMG/M
3300033530|Ga0314760_1080798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum806Open in IMG/M
3300033530|Ga0314760_1118128Not Available653Open in IMG/M
3300033530|Ga0314760_1172128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum526Open in IMG/M
3300033532|Ga0314767_1200088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300033533|Ga0314770_1183010All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum658Open in IMG/M
3300033534|Ga0314757_1111645All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum660Open in IMG/M
3300033535|Ga0314759_1053768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1209Open in IMG/M
3300033539|Ga0314762_1036649All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum927Open in IMG/M
3300033540|Ga0314764_1048891All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum706Open in IMG/M
3300033542|Ga0314769_1028494All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1624Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere81.88%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere7.97%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated5.07%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009977Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028053Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028141Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028144Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028151Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028155Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028476Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300032464Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032469Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032550Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032590Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032781Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032789Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032790Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032823Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032915Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032934Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033532Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033533Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033534Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033535Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033539Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033540Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033542Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070688_10155918113300005365Switchgrass RhizosphereMDPFRPAPRFDGTGFQRWKILMQAHLQATGLNVWRVVSEGIKNNGQQEKQYDVTAKCIILSSLSDNVFNRVYSCENAK
Ga0070708_10128206213300005445Corn, Switchgrass And Miscanthus RhizosphereMDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSEGMKNNGHQDKQHDVTAKCIILSSLSDN
Ga0068864_10223473713300005618Switchgrass RhizosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQERQYDAIAKCVILNSLGENVFNRVFACENAKVLWKTIS
Ga0105247_1080657613300009101Switchgrass RhizosphereMNSLGPPPRFDGTGFQRWKILIESHLQAKGLNVWRVTSEGMKNQAQQEKQFDAIAKCVILNSLDDKIFNRVFACENAKDLWKTTMRAQKM*
Ga0105129_11851913300009975Switchgrass AssociatedMDSLGPPPHFNGTGLQRWKILKQSHLQAKGLNVWRVTSEGMKGNSQQEKQYDAIAKCAILNSLGDNMFNHVFACKNTKKL*
Ga0105141_11355013300009977Switchgrass AssociatedMDPFRPDPRFDGTGFQRWKILMQAHLQATGLNVWRVMSEGVKNIGQQEKQYDVTAKYITL
Ga0105141_12186713300009977Switchgrass AssociatedMDSLGPPPCFDGTGFRRWKILRQSHLQANGLNVWRVTSEGVKSKSQQERLYDVIAKCAILSSFGDNVFNRDFACKNTKEL*
Ga0105135_11971713300009980Switchgrass AssociatedMDPFRPAPRFDSTGFQRWKVLMLAHLQATGLNVWRVVSEGVKNNGQQEKQHDVTAKCIILSSLSDNVFNRIYSCENAKELWKTI
Ga0105131_11672713300009989Switchgrass AssociatedLGPPPRFDGTGFQRWKILIQSHLQANGLNVWRVTSEGVKSKSQQERQYDVLAKCAILSSLGDTMFNRVFCL*
Ga0105139_100911713300009995Switchgrass AssociatedMGFQRWKILMQAHIQATGLNVWRVVSEGVKNNGQQEKQHDITAKCIILYSLSDNVFNRVYFFENTKELWKTIIENHEGTEDIANER*
Ga0105139_109414213300009995Switchgrass AssociatedMDPFRNAPRFDDTGFQPWKVLMQAHLQATGLNVWRVVSEGTKSNSQQERQYDATVKSIILSSLNENVFNRVYYCENAKKL*
Ga0134125_1302925313300010371Terrestrial SoilGMDSLGSPPRFDGSGFQRWKILMQSHLQANGLNVWRVTSEGIKSNSQQEKQYDAIAKCAILNSLGENAIAK*
Ga0134128_1262760613300010373Terrestrial SoilMDPFRLAPRFDGTGFQRWKILMQGHLQTTGLNVWRVVSEGVKNNGQQEKQHDVTAKCITLSSLSDNVFNRVNSCENAKE
Ga0134122_1102711323300010400Terrestrial SoilMDSLGPPPRFDGTGFQRWKILMESHLQAKGLNVWRVTSEGMKSKGQQEKQFDAIAKCAILSSLGDTVFNRVFACENTKDL*
Ga0182102_101825513300015273Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILIESHLQAKGLNVWRITSEGMKNKGQQEKQFDAIAKCVILSSLDDKIFNCVFACENVKDL*
Ga0182099_104854513300015278Switchgrass PhyllosphereMDPFRPAPRFDGMGFQQWKVLMQVHLQATGLNIWRVVSEGVKNNGQQEKQHDVTAKCIILSSLSNNVFNRVFSCENAQKLWKT
Ga0182100_105409013300015280Switchgrass PhyllosphereMDPFRNAPRFDGMGFQHWKVLMEAYLQAMSLNVWRVVSEGTKSNSQQERQYDATAKSIILSSLNENVFNHLYSCENAHKLWKTIIENHE
Ga0182101_104895913300015284Switchgrass PhyllosphereMDSLGPPPRFDGTGFQQWKILMQSHLQAKGLNVSRVTSEETKSNSQQEKHYDAIAKCAILNSLGENVFNRVF
Ga0182103_104192013300015293Switchgrass PhyllosphereMDPFRSAPRFDGTGFQCWKILLQIHLQATSLNVWRVISEGMKNTTQQEKQYDATRKCTILSSL
Ga0182103_107004313300015293Switchgrass PhyllosphereMYPFRPAPRFDGTGFQRWKILMQAHLQATGLNVWRVVSEGVKNNGLQEKQHDVTAKCIILSSLSDNMFNRVYSCENAKEL*
Ga0182103_110325813300015293Switchgrass PhyllosphereVSQLFGEGKDPFRNAPRFDGTGFQRWKVLMQAHLQATWLEVRNVVSEGVKFKTLNEKQNDILAKSIILSSLSDNIFNRVYSCE
Ga0182104_107112623300015297Switchgrass PhyllosphereFRPAPRFDGMGFQRWKVLMQTHLQATGLNVWRVVSEGVKNNGQQEKQHDVTAKCIILNSFSDNVLNRVYSCENAKELWKTII*
Ga0182104_111462413300015297Switchgrass PhyllosphereMDPFRNAPWFDGTGFQHWKVLKQAHLQATGLEVWNVVNEGIKFKTLKEKQNDVIAKSIILSSLGDSVFNRVFTCENARVMKDYQRES*
Ga0182098_104334313300015309Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILIESHLQAKGLNVWRITSEGMKNKGQQEKQFDAIAKCVILSSLGNKIFNRVFACENAKDLGKLSRKTMRLQKM
Ga0182098_109435113300015309Switchgrass PhyllosphereMDPFRNAPRFDGMGFQHWKVLMEAHLQAMSLNVWRVVSEGTKSNSQQEKQYDAIAKCAILNSLGENVFNRVFACENAKVL*
Ga0182162_104406213300015310Switchgrass PhyllosphereMNSLGPPPRFDGTGFQRWKILMQSHLQAKVLNIWRVTSDGVKSNSQQERQYDAIAKCAILSSLGDNVFNHVFACENAKDL*
Ga0182182_103771313300015311Switchgrass PhyllosphereMNPFRIAPRFDGTGFQCWKVLMEAHLQATGLEVWNVVNEGIKFKTLKEKQNDVIAKSIILSSFRDNIFNRVYSCENTKKL*
Ga0182168_110005813300015312Switchgrass PhyllosphereMDPFRSAPWFDGTGFQRWKILMQAHLQATSLNVWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNVFNRV
Ga0182168_110164413300015312Switchgrass PhyllosphereMDPFRIAPRFDDMGFQHWKVLMEAHLQATGLNVWRVVSEGTKSNSQQERQYDATAKS
Ga0182168_112302613300015312Switchgrass PhyllosphereKCSVVRWHGLPHWKILMQAHLQATGLEVWNIVREGIKFKMLKERQHDVIAKNIILSSLSDNVFNRVYACENAFELCKTIKENHEGT*
Ga0182168_113115613300015312Switchgrass PhyllosphereMDPFKSAPRFDGTGFQRWKILMQTHLQATGLNVWRVVSEGVKNNGQQEKQHDVTAKCIILSSL
Ga0182164_108101713300015313Switchgrass PhyllosphereMDPFGNTPRFDGTGFQHWKVLMKAHLQTTGLDVWRVVSEGITNTSRKEKQNDVIAKSIILYSLSDSVFNGMFSCENTKELWKTIKEYH
Ga0182120_106212213300015315Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMESHLQAKGLNVWRITSEGMKNKGQQEKQFDAIAKCVILSSLDNKIFNRVFACENAKDLGKLSRKTMRVQKMWQTKDIMFSLID*
Ga0182121_104359923300015316Switchgrass PhyllosphereMDSLGHSLRFDGTCFQRWKILMQSHLQAKGLNVWRVTSEGVKSNSQQERQYDAIAKCAILSSFGDTMFNRVFACENAKNL*
Ga0182181_106889413300015318Switchgrass PhyllosphereMDSLGPPPRFNGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQKRQYDAIAKCAILNSIGENVFNRVFACENANVLW
Ga0182130_108420113300015319Switchgrass PhyllosphereMDSLGPPPRFNGTGFQRWKILMQSHLQAKGLNVWRVTSEGVKSNSQQDRQYDAIAKCAILSSLSDIVFNRVFACENAKNLW
Ga0182130_113725513300015319Switchgrass PhyllosphereMDPFRPAPWFDGTGFQRWKVLMQAHLQATGLNVWRIVSEGVKNNGQQEKQYDVTAKCIILSSLSDNVFNRVYSC
Ga0182165_101145913300015320Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQSKGLNVWRVTSEETKSNSQQEKQYDAIVKCAILNSLGEN
Ga0182165_107459113300015320Switchgrass PhyllosphereMDPFIPAPRFDGTGFQRWKILMQTHLQATGLNVWRVVSEGIKNNGHQEKQHDITAKCIILSSLSDNIFNRVYSCENTKEL*
Ga0182165_112052313300015320Switchgrass PhyllosphereMDSLGPPPYFDGMGFQRWKILIQSHLQTKGLNVWRVTSEGGKSKSQQERQYDAIAKYAILSSLDDIVFNRVFACQNA*
Ga0182165_114364313300015320Switchgrass PhyllosphereMDSLGPPSRFDDTAFQRWKILMQSHLQAKGLNVWRVTSEGTKSNGQQEKQYDAIAKCAILNSLGESVFNRVFACENANV
Ga0182134_109276213300015324Switchgrass PhyllosphereMYPFRPAPRFDGTGFQRWKILMQAHLQATGLNVWRVVSEGVKNNGLQEKQHYVTAKCIILSSLSDNVFNRVYSCENAKEL*
Ga0182148_104306423300015325Switchgrass PhyllosphereMDPFRPAPWFDGTGFQRWKVLMQAHLQAMGLNVWRVVSEGVKNNSQQEKQNDVTAKCIILSSFSDNVFNRVYSCENAKEL*
Ga0182148_107769213300015325Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILIQSHIQAKGLNVWRVTSEGTKNNSQQEKQYDAIEKCAILNSLGENVFNHVFDCENTKKLWKNYL*
Ga0182114_107496813300015327Switchgrass PhyllosphereMDSLGPPPWFDVTGFQRWKILIESHLQAKGLNIWRVTSAGMKNKGEQEKQFDTIAKCVILSSLEDNIFNHVFAYENAKEL*
Ga0182114_115881913300015327Switchgrass PhyllosphereMDPFRPAPRFDDTGFQRWKVLMQAHLQATGLNVWRVVSEGVKNNGQQEKQHNVTTKCIILSSHSDNVFIELWKTTIENHEGMEDV
Ga0182131_107995113300015331Switchgrass PhyllosphereMDPFRNTPWFDGACLQRWKVLMQAHLQAMGLNIWRVVSEGIKNNGHQKRQYDVTVKCIILSSLSDNVFNRVYSCENA*
Ga0182117_104860813300015332Switchgrass PhyllosphereMDPFGNTPRFDGTGFQHWKVLMKAHLQTTGLDVWRVVSEGITNTSRKEKQNDVIAKSIILYSLSDSVFNGMFSCENAKELWKTIKEYHEG
Ga0182117_105255223300015332Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKVLMEAHLQAKGLNVWRVTSEGMKGNTQQEKQHDAIAKCAILSSLGDNVVNHVFA*
Ga0182117_112166913300015332Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKVLMQAHLQVTGLNIWRVVSEGVKNNGQQEKQYNVTAECIILSSLSDNVFNRVFSCENAKKLWNTII
Ga0182132_111377513300015334Switchgrass PhyllosphereMNPFRIAPRFNSTGFQRWKVLMEAHLQATGLNVWRVVSEGTKSNSQQERQYDATAKSIILSSLNENVFNRVFSCENAKKL*
Ga0182132_113229513300015334Switchgrass PhyllosphereMHSLGPPPRFNGTGFQRWKILMRFHLQENCLNVWRVTSEGVKSNSQQERQYDAITKCAVLSSLGDTVFNRVFSCENAKDL*
Ga0182150_104834123300015336Switchgrass PhyllosphereVSKLFGEEMDPFRLAQRFDGTGFQRWKVLMEAHLQATGLNVWRVVSEGTKSNSQQERQYDATTKSIILSSLNENVFNRVYSCEDAKKL*
Ga0182150_111199423300015336Switchgrass PhyllosphereDPFRPAPRFDGTGFQRWKVLMQAHLQAMGLNGWRVVSECVKNNGQQEKQYDVTAKCIILSSLSDNVLNRVYSCANAKEL*
Ga0182150_113121113300015336Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYGAIAKCAILNSLAENIFNRVFACENAQVLWKTIS
Ga0182150_113505213300015336Switchgrass PhyllosphereMDPFRPAPQFDDMGFQRRKILMQAHLQATELNVWRVVSKGLKNNGQQEKQHNVTTKCIILSSYSDNVFIELWKTIIENHEGMEDVA
Ga0182137_110166013300015338Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKVLMQAHLQVTGLNIWRVVSEGVKNNGQQEKQYDITAKCIILSSLCDNVF
Ga0182137_112686513300015338Switchgrass PhyllosphereMGPFRPTPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSDGVENNSQQEKQNDVTTKYIILSSLS
Ga0182133_112949713300015340Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSEGVKNNGQQEKQYDVTAKCIILSSLSDNVFNR
Ga0182115_106025113300015348Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKVLMQAHLQVTGLNIWRVVSEGVKNNGQQEKQYNVTAKCIILSSLSDNVFNRVYSYANTKEL*
Ga0182115_115864013300015348Switchgrass PhyllosphereMDPFRPAPWFDGAGFQRWKILMIVHLQATGLNVWRVVSEGVKNNSHQEKQYDVTAKCIILSSLSD
Ga0182115_124082613300015348Switchgrass PhyllosphereMDSLGPPPHYDDTDFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQERQYDAIAKCAILSSLGDNVFNHVF
Ga0182185_128812613300015349Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRCKVLMQAHLQATGLNIWRVVSEGVINNGQQEKQHNVTAKCIILYSLSDNVFNHVYSCENAKE
Ga0182163_120047913300015350Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKVLMESHLQAKGLNVWRVTSEGMKNKSQQEKQFDAIAKCVILSSLEDKIFNRVFACENAKEL*
Ga0182163_129768213300015350Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILLQSHLQAKGLNVWRVTSEGIKSNNQQERQYDAIAKCAILNSLGENVFNRVFACE
Ga0182169_116904413300015352Switchgrass PhyllosphereMDPSRNAPWFDGTGFQHWKVLIQAHLQATALDVWRVVSEEIKNTSRKEKQNDVIAKSIILYS
Ga0182169_123274513300015352Switchgrass PhyllosphereMDPFRPAPRFDGTSFQRWKVLMQTHLQATGLNFWRVVSEGVKNNGQQEKQYDVTAKCIILSSLSDNVLIHVYSCANAKEL*
Ga0182169_128725513300015352Switchgrass PhyllosphereMYPFRNAPWFVGTSFQCWKVLMEAHLQTMGLNVWRVVSEGTKSNSQQERQYDTTAKSKILSSLNENMFNRVYSCENAKKNYGRLSLKTMKARMM*
Ga0182179_115155013300015353Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKVLMQAHLQVTGLNIWRVVSEGVKNKGQQEKQYDVTAKCIILSSLSDNVFN
Ga0182167_115244013300015354Switchgrass PhyllosphereMDPSRNAPWFDGTGFQHWKVLIQAHLQATALDVWRVVSEEIKNTSRKEKQNDVIAKSIILYSLSDSVFSGVFSCENAKELWKTIKEYHE
Ga0182167_128489913300015354Switchgrass PhyllosphereMDPFRNAPRFDGTGFQRWKVLMQAHLQATGLEVWNVVSEGVKFKTLKEKQNDVIAKSIILSSDSDNIFNRIYSCENAKELWKTINENHESTKDVANERYHVLIDNVTPLV
Ga0182199_107005213300017412Switchgrass PhyllosphereMDHFRNTPRFDGAGFQRWKVLIQAHLQATALDVWRVVSEEIKNTSRKEKQNDVIVKSIILSSLGGSVFNHVFTYEN
Ga0182199_113131913300017412Switchgrass PhyllosphereMDPFRNAPRFDGTGFQHWKVLMEAHLQAMSLNVWRVVSEGTKSNSQQERQYDATAKSIILSSLNENVFNRVFSCENAKKL
Ga0182199_120078513300017412Switchgrass PhyllosphereMDPFRSAPRFDDMGFQRWKVLIQAHLQPTCLEVWNVVNEGIKFKTLKEKQNDVIAKSIILSSLSHNVFNHIYSCENANELWETIIENHEGMEDVANERYYVLVD
Ga0182195_111733523300017414Switchgrass PhyllosphereVDFLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWIFTSEGMKNKGEQEKQFDTIAKCVILSSLEDKIFNRVFACENAKEL
Ga0182195_112976723300017414Switchgrass PhyllosphereMDPFRPTPRFDGTGFQRWKVLMQAHVQATGLNIWRVVSEGIKNNGHQERQHDVTTKCIILSSLSDKVFNHVYSYENA
Ga0182195_114090213300017414Switchgrass PhyllosphereMDLFRPAPRFDGMGFQRWKVLIQAHLQATGQNVWRVVSEGVKNNSQQEKQYDVTAKCIILSSLSDNVLNRVYTR
Ga0182195_117980413300017414Switchgrass PhyllosphereMDPFGNTPRFDGTGFQHWKVLMKAHLQTTGLDVWRVVSEGITNTSRKEKQNDVIAKSIILSSLGDSMFNRVFTYKNTKELWKTIKENHEGTKDVANERYHV
Ga0182201_104942813300017422Switchgrass PhyllosphereMDPFRSAPRFDGTGFQRWKILMETHLQATGLNVWRVVSEGTKSNSQQERQYDATAKNIILSSLNENVFNCVYSCENVKKL
Ga0182201_109350613300017422Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSEGVKNNGQQEKQYDITAKCIILSSLSDNVFNRIFSCENAKKLWKTIIENHEGTENVANERYHVLI
Ga0182196_111994013300017432Switchgrass PhyllosphereMDSLGPPPRFDGTGFQHWKILIQAHLQATGLNVWRVVSDGMKKNSGQQEKQHDVTAKCIILSSLSDNVFN
Ga0182194_110011913300017435Switchgrass PhyllosphereMDPYRIAPRFDGTGFQCWKVLMEAHLQATGLNAWRVVSEGTKSNSQQERQYDATAKSVILSSLNENVFNHVYSCENAKKLWKT
Ga0182194_114079013300017435Switchgrass PhyllosphereMDPFRSAPRFDGTGFQRWKVLMQTHLQATGLNIWRVVSKGIKNNGHQEKQHDVTAKCIILSSLSDNVFIRVYSCENTKEL
Ga0182200_108736623300017439Switchgrass PhyllospherePPHFNGTGFQRWKILMQSHLQAKGLNVWRITSEGMKDDNQQEKQYDAIAKCAILNSFGDNVFNRIFACKNAKEL
Ga0182200_115464213300017439Switchgrass PhyllosphereMDSLGPPPRFDGMGFQRWKILMQSHLQAKGLNVWRVTSEGVKSNSQQERQYDAIAKYVILSS
Ga0182198_117216813300017445Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSEGVKNNGQQEKQYDVTAKCIILSSLSDNVFNRVYSCENAKTL
Ga0182215_113965123300017447Switchgrass PhyllosphereFDGTGFQRWKILIESHLQAKGLNVWRVTSEGMKNQGQQEKQFDAIAKCVILSSLDNKIFNRVFACENAKDLGKLSRKTMRVQKMWQTKDIMFSLID
Ga0182212_112827123300017691Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKILMQTHLQATGLNVWRVVSDGMKKNGGQQEKQHDVTAKYIILSSLSDNVVNHIYSCENAKKL
Ga0182210_111898413300017692Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSEGIKNNGQQEKQYDVTAKCIILSSL
Ga0182216_104831913300017693Switchgrass PhyllosphereMDPFRNAPQFDGTGFQCWKVLMKSHLQTTGLDVWRVVSEGITNTSRKEKQNNVIAKSIILYSLSDSVFNGVFSWKMVKSYGRLSKSIMRA
Ga0182216_120043513300017693Switchgrass PhyllosphereMDPFRNAPWFEGTGFQCWKVLMQAHLQATGLNVWRVTSEGMKGNSQQGKQHDAIAKCAILSSLGDNVFNHVFACKN
Ga0182216_121590313300017693Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKVLMQAHLQVTGLNIWRVVSEGVKNKGQQEKQYDVTAKCIILSSLSDNVFNRVYSCAN
Ga0182216_122441813300017693Switchgrass PhyllosphereMDTFRPAPRFNGTGFQRWKALMQAHLQATGLNVWRVVSEGIKNNGQQEKQYDVTTKCIILSSLSDTVFNRVCSCENAKTLWKTI
Ga0182178_101491813300020023Switchgrass PhyllosphereMDSLGPPPQFDGTDFQRWKILMESHLQAMSLNIWRVTSEGMKSKGQQEKQFDAIAKCVILSSLDDKIFNRVFACENAK
Ga0268328_102481413300028050PhyllosphereMDPFRPAPRFDGTGFQHWKILMQDHLQATGLNVWRVVSEGIKNNGQQEKQYDVTAKCIILSSLS
Ga0268346_101096113300028053PhyllosphereMDPFRNAPQFDDTGFQHWKVLMQAHLQATGLNVWRVVSEGTKSSSQQERQYDATAKSIILSSLNENVFNHVYSCENAHKLWKTIIENHE
Ga0268338_102555613300028055PhyllosphereMDPFRPAPWFDSMGFQRWKVLMQAHLQATGLNVWRVVSEGIKNNGQQEKQYDVTAKCIIMSSLSDNVFNRVYSCENAK
Ga0268342_102790113300028062PhyllosphereMDPFRPAPRFDGTSFQCWKVLMQAHLQATGLNVWRVVSKGVKNNGQQEKQYDVTAKCIILSSLSDNMLNRVYSCANAKEL
Ga0268342_103705923300028062PhyllosphereMDSLGPLPRFDGTGFQRWKILIQSHLQAKGLNIWRVTSDGVKSNSQQERQYDAIAKCAILSSFGDTVFNRVFAYENAKDL
Ga0268326_100250313300028141PhyllosphereMDPFRPAPRFDGTSFQCWKVLMQAHLQATGLNVWRVVSEGVKNNGQQEKQYDVTAKCIILSSLSDNVFNRVFSCENAKKLWKT
Ga0268345_100622423300028144PhyllosphereGPPPRFDGSGFQRWKILMESHLQAKGLNVWRVTSEGMKNKGQQEKQFDAIAKCVILSSLDNKIFNRVFACENAKDLGKLSRKTMRVQKMWQTKDIMFSLID
Ga0268308_101696913300028151PhyllosphereMDPFRPAPRFDGTGFQHWKVLMQAHLQVTGLNIWRVVSEGVKNNGQQEKQYNVTAKCIILSSL
Ga0268349_104407613300028155PhyllosphereMDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSEGIKNNGHQEKQHDITAKCIILSSLSDNVFNRVYSCENAKEL
Ga0268310_100145413300028262PhyllosphereMDPFRPAPRFDGTGFQHWKVLMQAHLQVTGLNIWRVVSEGVKNNGQQEKQYNVTAKCIILSSLSDNVFNRVYSYANTKEL
Ga0268329_101474813300028476PhyllosphereMDPFGNTPRFDGTGFQHWKVLMKAHLQTTGLDVWRVVSEGITNTSRKEKQNDVIAKSIILYSLSDSVFNGMFSCENAKELWK
Ga0214492_104595923300032464Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKILMQDHLQATGLNVWRVVSEGIKNNGQQEKQYDVTAKCIILSSLSDNVFNRVYSCENAK
Ga0214493_105554713300032465Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKILMQDHLQATGLNIWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNVFNHVYSCENAKELWKTIIENHEGTDDT
Ga0214503_110718513300032466Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKILMQAHLQATGLNIWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNVFNHVYSCENAKELWKTIIENHEGTDDT
Ga0214488_105416313300032467Switchgrass PhyllosphereMDYLGPPSRFDDTAFQRWKILMQSHLQVKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGESVFNRVFAC
Ga0214491_108868323300032469Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKILIQAHLQATCLNIWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNMFNRVYSCENAKELWKTIIENHEGTDDT
Ga0214490_111996413300032502Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKILMQAHLQATSLNIWRVVSDGMKKNGGQQEKQHDVTA
Ga0321340_105615213300032550Switchgrass PhyllosphereFRPAPRFDGTGFQHWKILMQAHLQATGLNIWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNVFNHVYSCENAKELWKTIIENHEGTDDT
Ga0214489_102845723300032590Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKILMQAHLQATGLNIWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNVFNHVYSCENAKELCKTIIENHDGTNDT
Ga0214484_108189713300032591Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKVLMQAHIQATGLNIWRVVSEGVKNNGQQEKQHDVTAKFIILSSLSDNVFNHVYSCENAKELWMTIIENHEGTEDVA
Ga0214484_112361313300032591Switchgrass PhyllosphereMDLFRPASRFDSTGFQRWKVLMQTHLQATGLNVWRVVSEDIKNNGHQEKQHDVTAKCLILSSLSDNVFNRVYSCENAKEL
Ga0214501_121881213300032625Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSEGVKNNGQQEKQYDVTAKCIILSSLSDNVFN
Ga0214497_111686713300032689Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKILMQAHLQATGLNIWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNVFN
Ga0214485_108813613300032698Switchgrass PhyllosphereMDSLGPPSRFDDTAFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGESVFNRVFACKNANVL
Ga0314733_106924413300032761Switchgrass PhyllosphereMDHFRSAPRFDGTGFQRWKILMQAHLQAMVLNVWRVVSEGVKNNDLQEKQHDVTAKCIILSSLSDNVFNHVYSCENAKELWKTIIENHEGTDDT
Ga0314733_110326013300032761Switchgrass PhyllosphereMDPFRPAPRFDGTGFQLWKILMQAHLQAMGLNIXRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNVFN
Ga0314742_108883213300032781Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKILMQAHLQATGLNVWRVVSEGIKNNGHQEKQHDITAKCIILSSLSDNVFNRVYSCENAKKLWKMLQNERYLVLID
Ga0314725_101703313300032789Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNMFNRVYSCENAKELWKTIIENHEGTDDT
Ga0314731_105353213300032790Switchgrass PhyllosphereMDSLGPPSRFDDTAFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGESVFNRVFACKN
Ga0314731_108021113300032790Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKILMQAHLQATGLNIWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNMFNRVYSCENAKELWKTIIENHEGTDDT
Ga0314748_108906213300032791Switchgrass PhyllosphereMDSLGPPSRFDDTAFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNS
Ga0314723_109779413300032823Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKVLMQAHLQAILLNVWRVVSEGVNNNGQQEKQHDVTAKCIILSSFSDNVFNRVFSCENAK
Ga0314749_107945813300032915Switchgrass PhyllosphereMDSLGPPSRFDDTVFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGESVFNRV
Ga0314741_109460613300032934Switchgrass PhyllosphereMDYLGPPSRFDDTAFQRWKILMQSHLQVKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGESVFNRVFACKN
Ga0314760_108079823300033530Switchgrass PhyllosphereMDSLGTPPRFDGTGFQRWKILMQSRLQAKGLNVWRVTSEGMKSKSQQERQYDAIAKCTILSSLGDIVFNRVFSCENAKDL
Ga0314760_111812813300033530Switchgrass PhyllosphereMDPFRPAPWFDGTGFQRSKILMQAHLQATGLNVWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDN
Ga0314760_117212813300033530Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKILMQAHLQATGLNIWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNVFNRVY
Ga0314767_120008813300033532Switchgrass PhyllosphereMDPFRNVLRFDGIGVQRWKVLMQAHLQATGLDVWRVVSEGIKNNGQQEKQYDVTAKCIILSSLSDIVFNRVYS
Ga0314770_118301013300033533Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSEGVKNNSQQEKQNDVTAKCIILSSLSDNVFNHVYSCENAK
Ga0314757_111164523300033534Switchgrass PhyllosphereMDSLGPPSRFDDTAFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLG
Ga0314759_105376823300033535Switchgrass PhyllosphereMDPFRPAPRFDGTGFQHWKILMQAHLQATSLNIWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNVFNHVYSCENAKELCKTIIENHDGTNDT
Ga0314762_103664933300033539Switchgrass PhyllosphereMDPFRPAPRFDGTGFHWKILMQAHLQATGLNIWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNVFNHVYSCENAKELWKTIIENHEGTDDT
Ga0314764_104889113300033540Switchgrass PhyllosphereMDYLGPPSRFDDTAFQRWKILMQSHLQAKGLNVWRVTSEGMKGKSQQEKQYDAIAKCAILSSLGDNVFNR
Ga0314769_102849413300033542Switchgrass PhyllosphereMDPFRPAPWFDGTGFQRSKILMQAHLQATGLNVWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNVFNHVYSCENAKELCKTIIENHDGTNDT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.