NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055885

Metagenome / Metatranscriptome Family F055885

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055885
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 44 residues
Representative Sequence SFVLLSRQRDVMSGALMARLKNRRPRGPGFRARLEEGARAEDQD
Number of Associated Samples 122
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.38 %
% of genes from short scaffolds (< 2000 bps) 91.30 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.580 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.638 % of family members)
Environment Ontology (ENVO) Unclassified
(18.841 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.826 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.39%    β-sheet: 0.00%    Coil/Unstructured: 48.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF01583APS_kinase 62.32
PF01747ATP-sulfurylase 9.42
PF14306PUA_2 7.25
PF02559CarD_CdnL_TRCF 2.17
PF03551PadR 1.45
PF01850PIN 1.45
PF00722Glyco_hydro_16 1.45
PF13692Glyco_trans_1_4 0.72
PF11716MDMPI_N 0.72
PF01070FMN_dh 0.72
PF02720DUF222 0.72
PF14012DUF4229 0.72
PF01370Epimerase 0.72
PF01670Glyco_hydro_12 0.72
PF13424TPR_12 0.72
PF07704PSK_trans_fac 0.72
PF03372Exo_endo_phos 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG0529Adenylylsulfate kinase or related kinaseInorganic ion transport and metabolism [P] 62.32
COG2046ATP sulfurylase (sulfate adenylyltransferase)Inorganic ion transport and metabolism [P] 9.42
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.45
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.45
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.45
COG2273Beta-glucanase, GH16 familyCarbohydrate transport and metabolism [G] 1.45
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.72
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.72
COG4423Uncharacterized conserved proteinFunction unknown [S] 0.72

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.58 %
UnclassifiedrootN/A9.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502001|FACENC_GAMC6GA01AZYZ6All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia530Open in IMG/M
3300003505|JGIcombinedJ51221_10396707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales560Open in IMG/M
3300004092|Ga0062389_102981495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300004092|Ga0062389_103629553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300005340|Ga0070689_101261770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia665Open in IMG/M
3300005343|Ga0070687_100203348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1201Open in IMG/M
3300005435|Ga0070714_102142354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales545Open in IMG/M
3300005436|Ga0070713_101464193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia662Open in IMG/M
3300005451|Ga0066681_10595965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia681Open in IMG/M
3300005537|Ga0070730_10340418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia978Open in IMG/M
3300005545|Ga0070695_100037395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3059Open in IMG/M
3300005602|Ga0070762_10158125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1361Open in IMG/M
3300005614|Ga0068856_100943279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia881Open in IMG/M
3300005764|Ga0066903_106491367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia609Open in IMG/M
3300005921|Ga0070766_10794119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia645Open in IMG/M
3300006028|Ga0070717_11144519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales708Open in IMG/M
3300006050|Ga0075028_100903906All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300006176|Ga0070765_100451293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1205Open in IMG/M
3300006358|Ga0068871_100476963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1121Open in IMG/M
3300006804|Ga0079221_10866655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales658Open in IMG/M
3300006854|Ga0075425_100724499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1142Open in IMG/M
3300006854|Ga0075425_101917916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M
3300006871|Ga0075434_102509621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300006914|Ga0075436_100586073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia821Open in IMG/M
3300009011|Ga0105251_10541835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300009522|Ga0116218_1359458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300009525|Ga0116220_10219437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia826Open in IMG/M
3300009525|Ga0116220_10400620All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300009672|Ga0116215_1234127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia805Open in IMG/M
3300010396|Ga0134126_12452399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
3300010399|Ga0134127_11602733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia725Open in IMG/M
3300010399|Ga0134127_13334085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300010876|Ga0126361_10017598Not Available541Open in IMG/M
3300012476|Ga0157344_1006046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia771Open in IMG/M
3300012491|Ga0157329_1004030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia932Open in IMG/M
3300012503|Ga0157313_1038251Not Available577Open in IMG/M
3300012519|Ga0157352_1084939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300012685|Ga0137397_10205049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1467Open in IMG/M
3300012929|Ga0137404_10108910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2246Open in IMG/M
3300012955|Ga0164298_10037737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2228Open in IMG/M
3300012984|Ga0164309_10153856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1532Open in IMG/M
3300014201|Ga0181537_11140778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300014657|Ga0181522_10217187Not Available1126Open in IMG/M
3300014745|Ga0157377_10341885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1001Open in IMG/M
3300014968|Ga0157379_11152304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300015200|Ga0173480_10308808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia886Open in IMG/M
3300016422|Ga0182039_11881003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300017823|Ga0187818_10283026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia727Open in IMG/M
3300017926|Ga0187807_1024617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1859Open in IMG/M
3300017926|Ga0187807_1117408All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300017926|Ga0187807_1224041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300017959|Ga0187779_10512320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia795Open in IMG/M
3300017972|Ga0187781_10166079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1553Open in IMG/M
3300017999|Ga0187767_10201454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia629Open in IMG/M
3300018012|Ga0187810_10481594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300018044|Ga0187890_10719254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300018062|Ga0187784_11526847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300020582|Ga0210395_10036745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3591Open in IMG/M
3300021088|Ga0210404_10889031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300021171|Ga0210405_11115839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium589Open in IMG/M
3300021180|Ga0210396_10526042Not Available1033Open in IMG/M
3300021402|Ga0210385_11552804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300021403|Ga0210397_10058325Not Available2496Open in IMG/M
3300021404|Ga0210389_11557911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300021474|Ga0210390_11080578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300021477|Ga0210398_10430379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1076Open in IMG/M
3300021559|Ga0210409_11713286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300021560|Ga0126371_12483781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia627Open in IMG/M
3300022557|Ga0212123_10836877Not Available549Open in IMG/M
3300022714|Ga0242671_1014336Not Available1024Open in IMG/M
3300024055|Ga0247794_10202321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales641Open in IMG/M
3300024271|Ga0224564_1129555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia519Open in IMG/M
3300025910|Ga0207684_10093856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2559Open in IMG/M
3300025910|Ga0207684_11187734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300025961|Ga0207712_11259166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia661Open in IMG/M
3300026377|Ga0257171_1028397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia955Open in IMG/M
3300027676|Ga0209333_1048114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1178Open in IMG/M
3300027842|Ga0209580_10348478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia738Open in IMG/M
3300027855|Ga0209693_10172291Not Available1068Open in IMG/M
3300027857|Ga0209166_10713522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia504Open in IMG/M
3300027867|Ga0209167_10739808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300027869|Ga0209579_10156061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1218Open in IMG/M
3300027879|Ga0209169_10009670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales5427Open in IMG/M
3300027905|Ga0209415_10625995All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300027911|Ga0209698_11257619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300028379|Ga0268266_10386208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1321Open in IMG/M
3300028381|Ga0268264_10150393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2086Open in IMG/M
3300028742|Ga0302220_10115906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1040Open in IMG/M
3300028781|Ga0302223_10277464Not Available554Open in IMG/M
3300028808|Ga0302228_10170319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia998Open in IMG/M
3300028906|Ga0308309_10906364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium765Open in IMG/M
3300029920|Ga0302142_1037738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1539Open in IMG/M
3300029999|Ga0311339_10286837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1781Open in IMG/M
3300030053|Ga0302177_10062254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2230Open in IMG/M
3300030057|Ga0302176_10207277Not Available782Open in IMG/M
3300030520|Ga0311372_10770157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1324Open in IMG/M
3300030531|Ga0210274_1396582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia nigra773Open in IMG/M
3300030578|Ga0210275_10204024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales637Open in IMG/M
3300030618|Ga0311354_10161015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2439Open in IMG/M
3300030706|Ga0310039_10012415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales4412Open in IMG/M
3300030730|Ga0307482_1096927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp.801Open in IMG/M
3300031544|Ga0318534_10411560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia776Open in IMG/M
3300031544|Ga0318534_10789494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300031682|Ga0318560_10242198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia968Open in IMG/M
3300031708|Ga0310686_102786449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria889Open in IMG/M
3300031708|Ga0310686_109107077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia503Open in IMG/M
3300031708|Ga0310686_109786539All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300031708|Ga0310686_111944882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300031713|Ga0318496_10180469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1158Open in IMG/M
3300031747|Ga0318502_10743322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia594Open in IMG/M
3300031765|Ga0318554_10815524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300031778|Ga0318498_10416091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300031805|Ga0318497_10359501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia813Open in IMG/M
3300031805|Ga0318497_10631630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia601Open in IMG/M
3300031835|Ga0318517_10553359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300031890|Ga0306925_10769397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1002Open in IMG/M
3300031890|Ga0306925_12212847All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300031893|Ga0318536_10216423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia975Open in IMG/M
3300031942|Ga0310916_10215602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1610Open in IMG/M
3300031947|Ga0310909_11145507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia631Open in IMG/M
3300031962|Ga0307479_11312964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium684Open in IMG/M
3300032010|Ga0318569_10519882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300032010|Ga0318569_10550378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300032041|Ga0318549_10460243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300032054|Ga0318570_10555806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300032066|Ga0318514_10449044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia685Open in IMG/M
3300032076|Ga0306924_12388586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia533Open in IMG/M
3300032089|Ga0318525_10715604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300032091|Ga0318577_10286992Not Available788Open in IMG/M
3300032160|Ga0311301_12495164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300032261|Ga0306920_101943015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia826Open in IMG/M
3300032261|Ga0306920_102762199Not Available669Open in IMG/M
3300032770|Ga0335085_10064411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4883Open in IMG/M
3300032782|Ga0335082_10842235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia779Open in IMG/M
3300032895|Ga0335074_11228323Not Available628Open in IMG/M
3300032898|Ga0335072_10475707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1306Open in IMG/M
3300033134|Ga0335073_10728308All Organisms → cellular organisms → Bacteria → Terrabacteria group1078Open in IMG/M
3300033134|Ga0335073_10986179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia874Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.80%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.80%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.35%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.62%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.62%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.17%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.17%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.45%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.45%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.45%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.45%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.45%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.72%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.72%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.72%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.72%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.72%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502001Soil microbial communities from sample at FACE Site 2 North Carolina CO2+EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012491Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610Host-AssociatedOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029920Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030578Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCE_4482502040502001SoilGERDSQLRPASRQRDVMSGALMTRLKNRGPRTGGFRTRLEEGARAEDEE
JGIcombinedJ51221_1039670723300003505Forest SoilFVVSGIASFVLLSRQRDVMSGALLSRLKNGRSRAAGFRARLEEGARAEDED*
Ga0062389_10298149523300004092Bog Forest SoilRQRDVMSSALMSRIRTRQQRRPGLRARLEDGARAEDDDL*
Ga0062389_10362955323300004092Bog Forest SoilRQRDVMSSALMSRIRTRQQQRPGLRARLEDGARAEDEDS*
Ga0070689_10126177023300005340Switchgrass RhizosphereASFVLLSRQRDVMSGALMTRLKNRRPRGPGVRARLEEGARAEDQE*
Ga0070687_10020334823300005343Switchgrass RhizosphereSGIASFVLLSRQRDVMSGALMTRLKNRRHRGPGFRARLEEGSRAEDQD*
Ga0070714_10214235413300005435Agricultural SoilLAFLVSGIASFVLLSRQRDVMSSALMTRLKNRGPRTGGFRTRLEEGARAEDEE*
Ga0070713_10146419323300005436Corn, Switchgrass And Miscanthus RhizosphereRDVMSGALMARLKNRRPRGPGFRARLEEGARAEDQADQD*
Ga0066681_1059596513300005451SoilSFVLLSRQRDVMSGALMARLKNRRPRGPGFRARLEEGARAEDQD*
Ga0070730_1034041813300005537Surface SoilASFVLLSRQRDVMSGALMARIKNGRGRLGGFRARIEDGARAEDED*
Ga0070695_10003739513300005545Corn, Switchgrass And Miscanthus RhizosphereFVVSGIASFVLLSRQRDVMSGALMTRLKNRRHRGPGFRARLEEGTRAEDQD*
Ga0070762_1015812513300005602SoilSFVLLSRQRDVMSGVLTGRLGNRRTRTAGLRSRLEEGARSEDDD*
Ga0068856_10094327923300005614Corn RhizosphereAMSGALMARLKNRRPRSEGLRARLEEGARAEDED*
Ga0066903_10649136713300005764Tropical Forest SoilMSGALLARLKNRRAGTAGFRARLEEGVRAEDEDEG*
Ga0070766_1079411923300005921SoilRQRDVMSGALMARIRTGQRRTTGFRARLEEGARAEDED*
Ga0070717_1114451913300006028Corn, Switchgrass And Miscanthus RhizosphereFLVSGIASFVLLSRQRDAMSGALMTRLKNRGPRTGGFRARLEEGARAEDKD*
Ga0075028_10090390623300006050WatershedsVVSGIASFVLLSRQRDRMSGALMARIRTGERRAAGFRARLEEGARAEDED*
Ga0070765_10045129323300006176SoilSGIASFVLLSRQRDRMSGALMARIKSRRGRVAGFRARLDEGAQAEDDD*
Ga0068871_10047696323300006358Miscanthus RhizosphereFVLLSRQRDVMSGALMTRLKNRRPRGPGVRARLEEGARAEDQD*
Ga0079221_1086665513300006804Agricultural SoilAVSGIVSFVLLSRQRDMMSGALLARLKNRRPRGPGFRARLEEGARAEDRD*
Ga0075425_10072449923300006854Populus RhizosphereQRDAMSGALMARLKNRGPRTGGFRARLEEGARAEDED*
Ga0075425_10191791613300006854Populus RhizosphereASFVLLSRQRDVMSGALMTRLKNRRHGGPGFRARLDEGARAEDQD*
Ga0075434_10250962113300006871Populus RhizosphereRQRDVMSGALMTRLKNRRHRGPGFRARLEEGTRAEDQD*
Ga0075436_10058607313300006914Populus RhizosphereLSRQRDAMSGALMARLKNRRPRSGGFRTRLEEGARAEDED*
Ga0105251_1054183513300009011Switchgrass RhizosphereSFVLLSRQRDAMSGALMARLKNRGPRTGGFRARLEEGARAEDED*
Ga0116218_135945813300009522Peatlands SoilLSRQRDIMSGALLARLKNGRARATSFRTRLEEGARAEDED*
Ga0116220_1021943713300009525Peatlands SoilVLLSRQRDVMSSALMNRIRNGRRRAGGFRARLEEGARAEDED*
Ga0116220_1040062023300009525Peatlands SoilLLSRQRDIMSGALLTRLKNGRARATGFRTRLEEGARAEDED*
Ga0116215_123412713300009672Peatlands SoilSGIASFVLLSRQRDVMSSALMNRIRNGRRRAGGFRARLEEGARAEDDD*
Ga0134126_1245239923300010396Terrestrial SoilRQRDVMSGALMARLKNRRPRGSGFRARLEEGARAEDQD*
Ga0134127_1160273313300010399Terrestrial SoilSFVLLSRQRDVMSGALMTRLKNRRHRGPGFRARLDEGARAEDRD*
Ga0134127_1333408523300010399Terrestrial SoilVLLSRQRDVMSGALMTRLKNRRHRGPGFRARLEEGSRAEDQD*
Ga0126361_1001759823300010876Boreal Forest SoilVVSGIASFVLLSRQRDVMSSALMARIRPGQRRAGGFRARLEEGARAEDDD*
Ga0157344_100604613300012476Arabidopsis RhizosphereIASFVLLSRQRDVMSGALMTRLKNRRHRGPGFRARLDEGARAEDED*
Ga0157329_100403013300012491Arabidopsis RhizosphereVMSGALMTRLKNRRRRGPGFRARLEEGARAEDPD*
Ga0157313_103825113300012503Arabidopsis RhizosphereRDVMSGALMTRLKNRRHRGPGFRARLDEGARAEDQD*
Ga0157352_108493913300012519Unplanted SoilFVVSGIASFVLLSRQRDVMSGALMTRLKNRRHRGPGFRARLDEGARAEDQD*
Ga0137397_1020504913300012685Vadose Zone SoilRDVMSGALMARLKSRRPRGPGFRARLEEGTRAEDED*
Ga0137404_1010891023300012929Vadose Zone SoilASFVLLSRQRDVMSGALMARLKSRRPRGPGFRARLEEGARAEDRD*
Ga0164298_1003773713300012955SoilIASFVLLSRQRDAMSGALMKRLKNRRPRGPGFRARLEEGARAEDQE*
Ga0164309_1015385613300012984SoilLLSRQRDVMSGALMTRLKNRRHRGPGLRARLEEGTRAEDQD*
Ga0181537_1114077813300014201BogASFVLLSKQRDIMSGALTGRLRNGRQRVSGFRSRLDEGARAEDED*
Ga0181522_1021718723300014657BogDVMSGALTARLRNRRARTTSLRARLDEGARSEDDD*
Ga0157377_1034188523300014745Miscanthus RhizosphereGIASFVLLSRQRDVMSGALMTRLKNRRPRGPGFRARLEEGARAEDQD*
Ga0157379_1115230423300014968Switchgrass RhizosphereVSGIASFVLLSRQRDVMSGALMARLKNRRPRGSGFRARLEEGARAEDQD*
Ga0173480_1030880813300015200SoilGIASFVLLSRQRDIMSGALMTRLKNRRHRGPGFRARLDEGARAEDQD*
Ga0182039_1188100323300016422SoilVLLSRQRDVMSGALMARIRAGRRRAAGFRVRIEEGTRAEDED
Ga0187818_1028302623300017823Freshwater SedimentAFVVSGIASFVLLSRQRDIMSGALLTRLKNGRARATSFRTRLEEGARAEDED
Ga0187807_102461713300017926Freshwater SedimentFVLLSRQRDVMSSALMNRIRNGQRRAGGFRARLEEGARAEDDD
Ga0187807_111740823300017926Freshwater SedimentLSRQRDVMSSALMNRIRSGQRRAAGFRARLEEGARAEDDD
Ga0187807_122404123300017926Freshwater SedimentIASFVLLSRQRDLMSSALMNRIRNGQRRASGFRTRIEEGARAEDDD
Ga0187779_1051232023300017959Tropical PeatlandLALACVISGIASFVLLSRQRDVMSRVLVARFRTRPRRAGGFRARIEEGARAEDED
Ga0187781_1016607913300017972Tropical PeatlandASFVLLSRQRDVISRALSARIGNGRGRVAEFRARIEEGARAEDED
Ga0187767_1020145423300017999Tropical PeatlandVLLSRQRDRMSGALMTRLKSGRLRGSGLRARLEEGARAEDQD
Ga0187810_1048159423300018012Freshwater SedimentLLSRQRDVMSGALMSRIRNRQRRAAGFRARLEEGARAEDDD
Ga0187890_1071925413300018044PeatlandSFVLLSRQRDIMSGALLTRLRNGRARGTSFRARLEEGARAEDED
Ga0187784_1152684713300018062Tropical PeatlandALLSFVLLSRQRDTVAGALSARFKRTAERAGSFRARLDEGARSEDDD
Ga0210395_1003674513300020582SoilLLSRQRDVMSGALLSRLKNGRSRAAGFRARLEEGARAEDED
Ga0210404_1088903123300021088SoilIASFVLLSRQRDVMSGALMARLKNRRPRGPGFRARLEEGTRAEDQD
Ga0210405_1111583923300021171SoilSRQRDRMSGALMARIKSRRGRVAGFRARLDEGAQAEDDD
Ga0210396_1052604223300021180SoilVSGIASFVLLSRQRDKMSGALMARIRTGQRRATGFRARLEEGARAEDDD
Ga0210385_1155280423300021402SoilSGIASFVLLSRQRDVMSSALMARIRPGQRRAAGFRARLEEGARAEDDD
Ga0210397_1005832513300021403SoilSGIASFVLLSRQRDIMSGALMAHLKNGRNRVGSFRARLEEGTRAEDED
Ga0210389_1155791123300021404SoilGGGILSFVLLSRQRDVMSGALMARLKNRRPRGPGFRARLEEGARGEDED
Ga0210390_1108057823300021474SoilLLSRQRDVMSGALLSRLKNGRSRAAGFRARLEEGARAEDEE
Ga0210398_1043037913300021477SoilSGIASFVLLSKQRDVMSGALAARLRNRREATTSLRSRLDEGARAEDDD
Ga0210409_1171328623300021559SoilFVQLSRQRDVMSGALMARLKNRRPRGPGFRARLEEGTRAEDKD
Ga0126371_1248378123300021560Tropical Forest SoilVLLSRQRDVMSGALMTRLKSRRPRGPGLRARLEEGARAEDED
Ga0212123_1083687723300022557Iron-Sulfur Acid SpringVLLSRQRDMMSGALMARIKTGRGRMAGFRARLEEGARAEDDD
Ga0242671_101433623300022714SoilDVMSGALIARLMNGKRRATGFRARLEEGARAEDDD
Ga0247794_1020232123300024055SoilSFVLLSRQRDVMSGALMARLKSRRPRGPGFRARLEEGARAEDRD
Ga0224564_112955513300024271SoilVLLSGQRDVMSGALMARIKNGRRRATGLRARIEEGARAEDEDL
Ga0207684_1009385643300025910Corn, Switchgrass And Miscanthus RhizosphereVVSGIASFVLLSRQRDVMSGALMARLKNRRTRGPGFGARLEEGARAEDED
Ga0207684_1118773423300025910Corn, Switchgrass And Miscanthus RhizosphereGIASFVLLSRQRDVMSGALMARLKNRRPRGPGFRARLEEGARAEDKD
Ga0207712_1125916613300025961Switchgrass RhizosphereVLLSRQRDVMSGALMTRLKNRRPRGPGFRARLEEGARAEDQD
Ga0257171_102839713300026377SoilLLSRQRDVMSGALMARLKSRRPRGPGFRARLEEGARAEDKD
Ga0209333_104811413300027676Forest SoilIASFVLLSRQRDVMSGALAARLRNRRERTTSLGARLDEGARAEDDD
Ga0209580_1034847823300027842Surface SoilVVSGIASFVLLSRQRDVISRALAARVGRGRGRLAEFRTRIDEGARAEDDD
Ga0209693_1017229133300027855SoilRQRDKMSGQLMNRLKSGKPRANGFRARLEEGARAEDED
Ga0209166_1071352213300027857Surface SoilASFVLLSRQRDVMSGALMARIKNGRGRLGGFRARIEDGARAEDED
Ga0209167_1073980823300027867Surface SoilACLVSGIASFVLLSRQRDVMSGALMARIKTGRGRAAGFRTRLEDGARAEDDD
Ga0209579_1015606123300027869Surface SoilQRDVISRALAARIGSGRGRLGEFRARIDEGARAEDDD
Ga0209169_1000967013300027879SoilSKQRDVMSGALAARLRNRREATTSLRSRLDEGARAEDDD
Ga0209415_1062599513300027905Peatlands SoilVSGIASFVLLSRQRDIMSGALLTRLRNGRARAPSFRSRLEEGARAEDED
Ga0209698_1125761923300027911WatershedsVVSGIASFVLLSRQRDIMSGALLARLKNGRARATSFRTRLEEGARAEDED
Ga0268266_1038620823300028379Switchgrass RhizosphereSRQRDVMSGALMTRLKNRRPRGPGFRARLEEGARAEDQD
Ga0268264_1015039313300028381Switchgrass RhizosphereVSGIASFVLLSRQRDVMSGALMTRLKNRRPRGPGVRARLEEGARAEDQD
Ga0302220_1011590613300028742PalsaLSGQRDRMSGALIGRLRNGRQRASGLRARLDEGARAEDED
Ga0302223_1027746413300028781PalsaSGIASFVLLSRQRDKMSGQLMNRLKNGKQRTTGFRARLEEGARAEDDD
Ga0302228_1017031913300028808PalsaSRQRDRMSGALIGRLRNGRQRASGFRARLEEGARAEDED
Ga0308309_1090636413300028906SoilSGIASFVLLSRQRDRMSGALMARIKSRRGRVAGFRARLDEGAQAEDDD
Ga0302142_103773823300029920BogGIASFVLLSRQRDRMSGALTSRLRGVRSRTGELRTRLDEGTRAEDED
Ga0311339_1028683723300029999PalsaSKQRDVMSGALTGRLRNGRQRVSGFRSRLDEGARAEDED
Ga0302177_1006225443300030053PalsaQRDKMSGQLMNRLKNGKQRTTGFRARLEEGARAEDDD
Ga0302176_1020727723300030057PalsaRDKMSGQLMNRLKNGKQRTTGFRARLEEGARAEDDD
Ga0311372_1077015713300030520PalsaVSGIASFVLLSKQRDIMSGALTGRLRSGRQRVSGFRSRLDEGARAEDED
Ga0210274_139658213300030531SoilVVRGIASFVLLSRQRDRMSGALMARIRTGERRAAGFRARLEEGARAEDDD
Ga0210275_1020402433300030578SoilASFVLLSRPRDVMSGALAARLRNRREAATSLRARLNEGARAEDDD
Ga0311354_1016101533300030618PalsaLLSRQRDRMSGALIGRLKNGRQRASGLRARLEEGARSEDEE
Ga0310039_1001241533300030706Peatlands SoilSGVASFVLLSRQRDVMSSALMNRIRNGRRRAGGFRARLEEGARAEDED
Ga0307482_109692713300030730Hardwood Forest SoilMSGALMARIRTGQRRTTGFRARLEEGARAEDEDYVADD
Ga0318534_1041156023300031544SoilVMSGALLARLKNGRARAAGFRERLEEGTRAEDEDKDRER
Ga0318534_1078949413300031544SoilRDQMSGALLARLTNRRPRGPGFRARLEEGARSEDED
Ga0318560_1024219823300031682SoilVLLSRQRDVMSRALMARIRTGQRRVAGFRARIEEGAQAEDDD
Ga0310686_10278644933300031708SoilVLLSRQRDRMSGALMARIKTGPRRPAGFRARLEEGARAEDDD
Ga0310686_10910707713300031708SoilSGIASFVLLSRQRDVISRALAARVGSGRGRLAEFRATIDEGARAEDDE
Ga0310686_10978653913300031708SoilASFVLLSRQRDVMSGALAGRLRGGRQRAAGFRARLDEGARAEDED
Ga0310686_11194488223300031708SoilRDRMSGALMARIRPGQRRATGFRARLEEGARAEDDD
Ga0318496_1018046923300031713SoilVLLSRQRYVMSGALMARIRTGQRRMAGFRTRIEEGAQAEDDD
Ga0318502_1074332223300031747SoilSGIASFVLLSRQRDVMSGALMARIRTGQRRMAGFRTRIEEGAQAEDDD
Ga0318554_1081552423300031765SoilRDVMSSALMGRIRNGRRRAAGFRARIEEGARAEDED
Ga0318498_1041609123300031778SoilLACVVSGIASFVLLSRQRDVMSRALMARIRTGQRRVAGFRARIEEGAQAEDDD
Ga0318497_1035950123300031805SoilFVVSGIASFVLLSRQRDTMSGALMTRLKGRSPRGPGLRARLEEGARAEDQD
Ga0318497_1063163013300031805SoilVVSGIASFVLLSRQRDVMSGALMARIRAGRRRAAGFRVRIEEGARAEDED
Ga0318517_1055335913300031835SoilSRQRDVMSRALMARIRTGQRRVARFRARIEEGAQAEDDD
Ga0306925_1076939713300031890SoilSGTASFVLLSRQRDIMSGALLARLRNRRAAGFRARLDEGARAEDDED
Ga0306925_1221284713300031890SoilVLLSRQRDRMSGALLARLKNRRAGTAGFRARLEEGARAEDDDEDEG
Ga0318536_1021642323300031893SoilVSGIASFVLLSRQRDVMSGALMARIRAGRRRAAGFRVRIEEGARAEDED
Ga0310916_1021560213300031942SoilVVSGIASFVLLSRQRDVMSSALIARIRTRKQRASGFRSRIEEGARAEDDD
Ga0310909_1114550723300031947SoilASFVLLSRQRDMMSGALMTRLKIRRPRGPGLRARLEEGARAEDQEL
Ga0307479_1131296413300031962Hardwood Forest SoilFVLLSRQRDRMSGALMARIKSRRGRVAGFRARLDEGAQAEDDD
Ga0318569_1051988213300032010SoilLSRQRDVMSGALMARIRTGQRRMAGFRTRIEEGAQAEDDD
Ga0318569_1055037823300032010SoilIASFVLLSRQRDAMSSALMNRLRNGQRRAAGFRARIEEGARAEDDD
Ga0318549_1046024323300032041SoilVSGIASFVLLSRQRDTMSGALMTRLKGRSPRGPGLRARLEEGARAEDQD
Ga0318570_1055580623300032054SoilIASFVLLSRQRDVMSGALMARIRTGQRRMAGFRTRIEEGAQAEDDD
Ga0318514_1044904413300032066SoilIASFVLLSRQRDQMSGALLARLTNRRPRGPGIRARLEEGARSEDED
Ga0306924_1238858623300032076SoilLSRQRDQMSGALLARLTNRRPRGPGFRARLEEGARSEDED
Ga0318525_1071560413300032089SoilQRDVMSSALMTRMRNGQRRAARFRARIEEGARAEDEDL
Ga0318577_1028699213300032091SoilACVVSGIASFVLLSRQRDVMSSTLMNRIRNGKQRAAGFRSRIEEGARAEDDD
Ga0311301_1249516423300032160Peatlands SoilVLLSRQRDIMSGALLARLKNGRNRAASFRTRLEEGARAEDED
Ga0306920_10194301523300032261SoilCVVSGIASFVLLSRQRDVMSGALMARIRTGQRRMAGFRTRIEEGAQAEDDD
Ga0306920_10276219913300032261SoilVLLSRQRDAMSSALMARIRTGKQRAAGFRARIEEGARAEDED
Ga0335085_1006441113300032770SoilRQRDAMSGALMARLKNRGPRTGGFRARLEEGARAEDED
Ga0335082_1084223513300032782SoilLAFVVSGIASFVLLSRQRDRMSGALMTRLKSGRLRGPGLRARLEEGARAEDQD
Ga0335074_1122832333300032895SoilVLSRQRDRMSGALINRLKNGRGRVSSFRSRLDEGAAAEDED
Ga0335072_1047570713300032898SoilVSGIASFVLLSKQRDVMSGALMVRNGDGQRRATGFLAQLKEGARAEDED
Ga0335073_1072830823300033134SoilMLSRQRDRMSGALMARVRNGQRRAAGFRARIEDGARAEDED
Ga0335073_1098617913300033134SoilSRQRDAMSGALMARLKNRRPRGPGFRARLEEGARAEDQD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.