Basic Information | |
---|---|
Family ID | F055944 |
Family Type | Metagenome |
Number of Sequences | 138 |
Average Sequence Length | 49 residues |
Representative Sequence | MGRQLLLLLLAFAGGTAIALLVGAKNLGTAMGIGQLCFAAMLVFVLLRD |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.62 % |
% of genes near scaffold ends (potentially truncated) | 3.62 % |
% of genes from short scaffolds (< 2000 bps) | 50.72 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.71 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.507 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.565 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.232 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.84% β-sheet: 0.00% Coil/Unstructured: 44.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.71 |
Powered by PDBe Molstar |
SCOP family | SCOP domain | Representative PDB | TM-score |
---|---|---|---|
f.61.1.1: Multidrug and toxic compound extrusion (MATE) transporters | d3mkua_ | 3mku | 0.77907 |
c.1.10.2: Class II FBP aldolase | d1gvfa_ | 1gvf | 0.75748 |
c.72.1.3: ADP-specific Phosphofructokinase/Glucokinase | d3drwa1 | 3drw | 0.75714 |
a.128.1.0: automated matches | d3ipia_ | 3ipi | 0.75206 |
c.1.10.0: automated matches | d5u4na_ | 5u4n | 0.74758 |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF01128 | IspD | 44.20 |
PF02542 | YgbB | 7.97 |
PF00501 | AMP-binding | 5.80 |
PF10635 | DisA-linker | 5.07 |
PF02559 | CarD_CdnL_TRCF | 4.35 |
PF07690 | MFS_1 | 3.62 |
PF02811 | PHP | 2.17 |
PF13193 | AMP-binding_C | 2.17 |
PF14325 | DUF4383 | 1.45 |
PF09190 | DALR_2 | 1.45 |
PF08032 | SpoU_sub_bind | 0.72 |
PF08281 | Sigma70_r4_2 | 0.72 |
PF00440 | TetR_N | 0.72 |
PF13239 | 2TM | 0.72 |
PF02705 | K_trans | 0.72 |
PF13420 | Acetyltransf_4 | 0.72 |
PF00248 | Aldo_ket_red | 0.72 |
PF01336 | tRNA_anti-codon | 0.72 |
PF00990 | GGDEF | 0.72 |
PF01553 | Acyltransferase | 0.72 |
PF13417 | GST_N_3 | 0.72 |
PF01699 | Na_Ca_ex | 0.72 |
PF14015 | DUF4231 | 0.72 |
PF01545 | Cation_efflux | 0.72 |
PF01458 | SUFBD | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 44.20 |
COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 44.20 |
COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 44.20 |
COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 44.20 |
COG0245 | 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | Lipid transport and metabolism [I] | 7.97 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.45 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.72 |
COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.72 |
COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.72 |
COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.72 |
COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.72 |
COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.72 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.51 % |
Unclassified | root | N/A | 14.49 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908038|B3_all_c_ConsensusfromContig125604 | Not Available | 673 | Open in IMG/M |
2124908044|A5_c1_ConsensusfromContig58365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 611 | Open in IMG/M |
3300001405|JGI20186J14852_1000244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4250 | Open in IMG/M |
3300002568|C688J35102_119245177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 660 | Open in IMG/M |
3300002568|C688J35102_119529046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 713 | Open in IMG/M |
3300002568|C688J35102_120957878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3111 | Open in IMG/M |
3300003267|soilL1_10081756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1322 | Open in IMG/M |
3300003324|soilH2_10366653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1009 | Open in IMG/M |
3300003659|JGI25404J52841_10021159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1408 | Open in IMG/M |
3300005327|Ga0070658_10027457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4568 | Open in IMG/M |
3300005329|Ga0070683_100032379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4761 | Open in IMG/M |
3300005330|Ga0070690_101380770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 566 | Open in IMG/M |
3300005340|Ga0070689_100019926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4968 | Open in IMG/M |
3300005347|Ga0070668_100054282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3091 | Open in IMG/M |
3300005347|Ga0070668_100355404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1241 | Open in IMG/M |
3300005354|Ga0070675_100000069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 59717 | Open in IMG/M |
3300005355|Ga0070671_100052765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3381 | Open in IMG/M |
3300005435|Ga0070714_100060534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3250 | Open in IMG/M |
3300005435|Ga0070714_101055918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 791 | Open in IMG/M |
3300005436|Ga0070713_100000023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 98528 | Open in IMG/M |
3300005455|Ga0070663_100400403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1122 | Open in IMG/M |
3300005466|Ga0070685_10914319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 654 | Open in IMG/M |
3300005539|Ga0068853_101293072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 705 | Open in IMG/M |
3300005544|Ga0070686_100255595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1282 | Open in IMG/M |
3300005548|Ga0070665_100179590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2117 | Open in IMG/M |
3300005548|Ga0070665_100372182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1436 | Open in IMG/M |
3300005548|Ga0070665_101511851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 680 | Open in IMG/M |
3300005549|Ga0070704_100284208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1372 | Open in IMG/M |
3300005614|Ga0068856_100048401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4189 | Open in IMG/M |
3300005834|Ga0068851_10004156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6515 | Open in IMG/M |
3300005842|Ga0068858_100020025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6257 | Open in IMG/M |
3300005902|Ga0075273_10109860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 554 | Open in IMG/M |
3300005937|Ga0081455_10013833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 7939 | Open in IMG/M |
3300006175|Ga0070712_100003217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 10064 | Open in IMG/M |
3300006755|Ga0079222_10084260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1615 | Open in IMG/M |
3300006794|Ga0066658_10000170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 23209 | Open in IMG/M |
3300006806|Ga0079220_10232913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1089 | Open in IMG/M |
3300006806|Ga0079220_10481641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 841 | Open in IMG/M |
3300006954|Ga0079219_11277633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 644 | Open in IMG/M |
3300009094|Ga0111539_10850365 | Not Available | 1062 | Open in IMG/M |
3300009101|Ga0105247_10101772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1837 | Open in IMG/M |
3300009101|Ga0105247_10713330 | Not Available | 756 | Open in IMG/M |
3300009148|Ga0105243_10004263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 11326 | Open in IMG/M |
3300009177|Ga0105248_10115555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3026 | Open in IMG/M |
3300009551|Ga0105238_10804938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
3300009840|Ga0126313_10107082 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
3300009840|Ga0126313_10138094 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
3300009840|Ga0126313_10252901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1367 | Open in IMG/M |
3300010036|Ga0126305_10000054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 45678 | Open in IMG/M |
3300010036|Ga0126305_10728458 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300010037|Ga0126304_10805783 | Not Available | 637 | Open in IMG/M |
3300010044|Ga0126310_10615423 | Not Available | 812 | Open in IMG/M |
3300010397|Ga0134124_10046948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3622 | Open in IMG/M |
3300010399|Ga0134127_10414059 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
3300012893|Ga0157284_10000058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 15626 | Open in IMG/M |
3300012908|Ga0157286_10477282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 501 | Open in IMG/M |
3300012911|Ga0157301_10005006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2408 | Open in IMG/M |
3300012951|Ga0164300_10565672 | Not Available | 664 | Open in IMG/M |
3300012955|Ga0164298_11030969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
3300012958|Ga0164299_10720614 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300012960|Ga0164301_10000029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 35011 | Open in IMG/M |
3300012960|Ga0164301_10003462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5526 | Open in IMG/M |
3300012961|Ga0164302_10000334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 13023 | Open in IMG/M |
3300012985|Ga0164308_10193853 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
3300013102|Ga0157371_10007080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9121 | Open in IMG/M |
3300013104|Ga0157370_10165172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2059 | Open in IMG/M |
3300013296|Ga0157374_11924223 | Not Available | 617 | Open in IMG/M |
3300013297|Ga0157378_10002648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 15953 | Open in IMG/M |
3300013306|Ga0163162_11280088 | Not Available | 833 | Open in IMG/M |
3300013308|Ga0157375_12453755 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300014326|Ga0157380_12095676 | Not Available | 628 | Open in IMG/M |
3300014487|Ga0182000_10057214 | Not Available | 1188 | Open in IMG/M |
3300014487|Ga0182000_10087640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1019 | Open in IMG/M |
3300014969|Ga0157376_10049905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3469 | Open in IMG/M |
3300015201|Ga0173478_10073309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1191 | Open in IMG/M |
3300017792|Ga0163161_10007076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 7760 | Open in IMG/M |
3300018073|Ga0184624_10000125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 18620 | Open in IMG/M |
3300018431|Ga0066655_10919706 | Not Available | 599 | Open in IMG/M |
3300018465|Ga0190269_10000221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 30660 | Open in IMG/M |
3300018465|Ga0190269_11496182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 555 | Open in IMG/M |
3300018481|Ga0190271_10000005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 263448 | Open in IMG/M |
3300018481|Ga0190271_12086018 | Not Available | 675 | Open in IMG/M |
3300018920|Ga0190273_10000405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 16804 | Open in IMG/M |
3300019361|Ga0173482_10266658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 737 | Open in IMG/M |
3300019889|Ga0193743_1010250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5384 | Open in IMG/M |
3300021363|Ga0193699_10013154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2977 | Open in IMG/M |
3300023071|Ga0247752_1006385 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300023077|Ga0247802_1002458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2084 | Open in IMG/M |
3300023266|Ga0247789_1028576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 966 | Open in IMG/M |
3300023275|Ga0247776_10015764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2821 | Open in IMG/M |
3300024055|Ga0247794_10001529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4481 | Open in IMG/M |
3300024187|Ga0247672_1048014 | Not Available | 706 | Open in IMG/M |
3300025321|Ga0207656_10122635 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300025504|Ga0208356_1000002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 224121 | Open in IMG/M |
3300025900|Ga0207710_10038878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2104 | Open in IMG/M |
3300025903|Ga0207680_10064058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2252 | Open in IMG/M |
3300025909|Ga0207705_10136736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1827 | Open in IMG/M |
3300025915|Ga0207693_10002884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 14867 | Open in IMG/M |
3300025926|Ga0207659_10000126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 45034 | Open in IMG/M |
3300025928|Ga0207700_10000003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 500797 | Open in IMG/M |
3300025929|Ga0207664_10048533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3339 | Open in IMG/M |
3300025935|Ga0207709_10002204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 12424 | Open in IMG/M |
3300025936|Ga0207670_10011800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 5084 | Open in IMG/M |
3300025941|Ga0207711_10234914 | Not Available | 1680 | Open in IMG/M |
3300025944|Ga0207661_10010028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 6806 | Open in IMG/M |
3300025972|Ga0207668_10032171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3463 | Open in IMG/M |
3300025972|Ga0207668_10220306 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
3300026035|Ga0207703_10122754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2232 | Open in IMG/M |
3300026041|Ga0207639_10028270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4092 | Open in IMG/M |
3300026067|Ga0207678_10321442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1331 | Open in IMG/M |
3300026078|Ga0207702_10000534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 42535 | Open in IMG/M |
3300026088|Ga0207641_10079599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2841 | Open in IMG/M |
3300026118|Ga0207675_101548208 | Not Available | 684 | Open in IMG/M |
3300026325|Ga0209152_10000142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 38328 | Open in IMG/M |
3300026899|Ga0209326_1006796 | Not Available | 855 | Open in IMG/M |
3300027787|Ga0209074_10037340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1423 | Open in IMG/M |
3300027815|Ga0209726_10051237 | All Organisms → cellular organisms → Bacteria | 2866 | Open in IMG/M |
3300028379|Ga0268266_10026806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4903 | Open in IMG/M |
3300028379|Ga0268266_10059350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3296 | Open in IMG/M |
3300028379|Ga0268266_10851118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 881 | Open in IMG/M |
3300028380|Ga0268265_10847902 | Not Available | 894 | Open in IMG/M |
3300028707|Ga0307291_1020487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1502 | Open in IMG/M |
3300028712|Ga0307285_10000002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 261347 | Open in IMG/M |
3300028721|Ga0307315_10003337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3901 | Open in IMG/M |
3300028722|Ga0307319_10000008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 126124 | Open in IMG/M |
3300028743|Ga0302262_10338227 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300028755|Ga0307316_10018024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2235 | Open in IMG/M |
3300028768|Ga0307280_10000012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 76077 | Open in IMG/M |
3300028872|Ga0307314_10010792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1975 | Open in IMG/M |
3300030510|Ga0268243_1006996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2012 | Open in IMG/M |
3300031251|Ga0265327_10497364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 525 | Open in IMG/M |
3300031354|Ga0307446_1102286 | Not Available | 792 | Open in IMG/M |
3300031366|Ga0307506_10049533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1217 | Open in IMG/M |
3300031939|Ga0308174_10608752 | Not Available | 905 | Open in IMG/M |
3300032829|Ga0335070_10000693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 38191 | Open in IMG/M |
3300033989|Ga0334924_028834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
3300034000|Ga0334918_000588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 10771 | Open in IMG/M |
3300034173|Ga0334925_070369 | Not Available | 752 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 8.70% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.07% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.35% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.62% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.62% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.17% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.17% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.17% |
Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 2.17% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.45% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.45% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.45% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.45% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.45% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.72% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.72% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.72% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908038 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
3300001405 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
3300023275 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031354 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-20 | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033989 | Biocrust microbial communities from Mojave Desert, California, United States - 20HNC | Environmental | Open in IMG/M |
3300034000 | Biocrust microbial communities from Mojave Desert, California, United States - 14HMC | Environmental | Open in IMG/M |
3300034173 | Biocrust microbial communities from Mojave Desert, California, United States - 21HNC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B3_all_c_02101120 | 2124908038 | Soil | MRRQLLLLLLAFAGGTAVAGLLGAVSLGVAFGVGQLTFAAMLVWVLRTD |
A5_c1_00559920 | 2124908044 | Soil | MRRQLLLLLLAFAGGTAVAGLLGAVSLGVAFGVGQLTFAAMLVWVLMTD |
JGI20186J14852_10002445 | 3300001405 | Arctic Peat Soil | VSRQLLLLLFAFAAGTALAGLLGAVSLGVAFGVGQLCFAATLIWVLLRD* |
C688J35102_1192451771 | 3300002568 | Soil | MSRQLALLLLGFAAATVIALLVGAKNLGTALAVGQLGFAAVLIYVLIRD* |
C688J35102_1195290462 | 3300002568 | Soil | MSRQLTLLLLGFSAATLIALLVGAKNLGTALGVAQICFAVLLVYVLMRD* |
C688J35102_1209578782 | 3300002568 | Soil | MGRQLALLLLAFAAATVIALLLGAKNLGTALAVGQLGFTATLVWVLIRA* |
soilL1_100817562 | 3300003267 | Sugarcane Root And Bulk Soil | MRRQLLLLLLAFAASAGIALLVGAKNLGTALGVAQVAFAATLVYVLLRD* |
soilH2_103666531 | 3300003324 | Sugarcane Root And Bulk Soil | MRRQLLLLLLVFAGSAALALLAGAKNLGTAFGVAQVCFAAALVYVLVRD* |
JGI25404J52841_100211592 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MGRQLLLLALAFGGGTLIALALGAKNLGTAMGVGQLTFAAMLVFVLMTDKQRGC* |
Ga0070658_100274572 | 3300005327 | Corn Rhizosphere | MRRQLLLLLLAFAGGAALALLAGAKNLGTAMGAGQLCFAAMLVFVLLRD* |
Ga0070683_1000323796 | 3300005329 | Corn Rhizosphere | MGRQLLLLLVAFAAGTALAGALGAGLGVAFAVGQICFAATLAYVLLRY* |
Ga0070690_1013807701 | 3300005330 | Switchgrass Rhizosphere | MSRQLLLLLIAFAGGTAIALLVGAKNLGTAMGVGQLCFAATLVFVLLRD* |
Ga0070689_1000199262 | 3300005340 | Switchgrass Rhizosphere | MTRQLLLLALAFAGATAIALLVGAKNLGTAFGVGQLAFAATLVYVLMRG* |
Ga0070668_1000542823 | 3300005347 | Switchgrass Rhizosphere | MRRQLLLLLAALVAGTALALLFGAKNLGTALAIGQLCFAATLVYVLMRD* |
Ga0070668_1003554042 | 3300005347 | Switchgrass Rhizosphere | MGRQLLLLLLALAGGTALALLVGAKNLGTALAIGQICFAATLVYVLMRD* |
Ga0070675_10000006910 | 3300005354 | Miscanthus Rhizosphere | MGRQLLLLSTAFALGTAVAGLLGAGLGVAFGVGQICFAATLVYVLLRG* |
Ga0070671_1000527652 | 3300005355 | Switchgrass Rhizosphere | MGRQLPLLLLAFAAGTGIALLLGAINLGTAFGVGQLTFAATLVWLLMTA* |
Ga0070714_1000605344 | 3300005435 | Agricultural Soil | MGRQLLLLLLGFAGGTAIALALGAKNLGTAFGVGQLCFAVTLVWILMRD* |
Ga0070714_1010559181 | 3300005435 | Agricultural Soil | MGRQLLLLALAFAGATAIALLVGAKNLGTAFGVGQLAFAATLVYVLMRG* |
Ga0070713_10000002320 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLLGFAGGTVIALLLGAKNLGTAFGVAQVCFAAVVVYVLLRD* |
Ga0070663_1004004032 | 3300005455 | Corn Rhizosphere | MRRQLLLLLLAFAGGAAIALLAGAKNLGTAMGVGQLCFAAMLVFVLLRD* |
Ga0070685_109143191 | 3300005466 | Switchgrass Rhizosphere | MRRQLLLLLLAFAGGTAIALLAGAQNLGTALGIGQLCFAAMLVYVLLHD* |
Ga0068853_1012930722 | 3300005539 | Corn Rhizosphere | MSRQLALLLLGFAAATVIALLAGAKNLGTAFGVAQLCFAALLVFVLMRD* |
Ga0070686_1002555952 | 3300005544 | Switchgrass Rhizosphere | MRRQLLLLLLALAGGTAIALLLGAKNLGTALGIGQLCFAAMLVFVLLRD* |
Ga0070665_1001795903 | 3300005548 | Switchgrass Rhizosphere | MSRQLLLLLVAFAGGTALAMLVGARNLGTAMGVGQLCFAATLVFVLLRD* |
Ga0070665_1003721822 | 3300005548 | Switchgrass Rhizosphere | MGRQLLFLALAFGLGTALALLLGAKNLGTAMGIGQLCFAAVLVLVLLRD* |
Ga0070665_1015118511 | 3300005548 | Switchgrass Rhizosphere | MSRQLLLLLLAFAGGTALALLVGAKNLGTAIGVGQPCFAAMLVFVLLRD* |
Ga0070704_1002842082 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRQLLLLLLAAAGGTAIALLLGAKNLGTALGVGAVLFAAVLVYVLMRD* |
Ga0068856_1000484014 | 3300005614 | Corn Rhizosphere | MSRQLALLLLGFAAATVIALLVGAKNLGTAFGVAQVCFAVLLVVVLMRD* |
Ga0068851_100041567 | 3300005834 | Corn Rhizosphere | MRRQLLLLLLAFLGGAAIALLAGAKNLGTAMGVGQLCFAAMLVFVLLRGD* |
Ga0068858_1000200257 | 3300005842 | Switchgrass Rhizosphere | MGRRLPLLLLAFAAGTGIALLLGAINLGTAFGVGQLTFAATLVWLLMTA* |
Ga0075273_101098602 | 3300005902 | Rice Paddy Soil | MTRQLLFLGFAFAGGAAVALLAGARNLGTALTFGQLCFAATLVYALMRD* |
Ga0081455_100138337 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGRQLLILAAGFGVGTAVALLVGAKNLGTAFGVGQLTFAATLIWVLLRGD* |
Ga0070712_1000032179 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRQLLLLLVAFSIGTAVAGALGAGLGVAFAVGQICFAATLAYVLLRG* |
Ga0079222_100842602 | 3300006755 | Agricultural Soil | MLVAFAAGTGLALLLGAKNLGTAMGIGQLCFAAMLVLVLLRD* |
Ga0066658_1000017012 | 3300006794 | Soil | MSRQLLLLLAALAAGTALALLLGAKNLGTALAIGQLCFAAMLVYVLMRD* |
Ga0079220_102329132 | 3300006806 | Agricultural Soil | MGRQLLLLLLAFAGGTAIALLVGAKNLGTAMGIGQLCFAAMLVFVLLRD* |
Ga0079220_104816411 | 3300006806 | Agricultural Soil | MGRQLLLLVAAFAAATAIALLVGAKNLGTALGVAQVSFAAILVYVLMRD* |
Ga0079219_112776331 | 3300006954 | Agricultural Soil | MGRQLLFLALAFGLGTALALLLGAKNLGTAMGIGQLVFAATLVFVLLRD* |
Ga0111539_108503653 | 3300009094 | Populus Rhizosphere | MGRQLLLLLIAFAAGAAVAGILGARLGVAFGIGQLCFAATLVYVLLRY* |
Ga0105247_101017724 | 3300009101 | Switchgrass Rhizosphere | MRRQLLLLLLAFAGGAAIALLAGAKNLGTAMGIGQLCFAAMLVYVLLRD* |
Ga0105247_107133301 | 3300009101 | Switchgrass Rhizosphere | MRRQLLLLLLAFAGGTALALLAGAKNFGTAMGAGQLCFAAMLVFVLLRD* |
Ga0105243_100042636 | 3300009148 | Miscanthus Rhizosphere | MSRQLLLLLAALLAGTALALLVGAKNLGTALAIGQLCFAAMLVYVLMRD* |
Ga0105248_101155552 | 3300009177 | Switchgrass Rhizosphere | MGRQLLLLLLAFAGGIAIALLVGAKNLGTAMGIGQLCFAATLVFVLLRD* |
Ga0105238_108049382 | 3300009551 | Corn Rhizosphere | MRRQLLLLLLAFLGGAAIALLAGAKNLGTAMGIGQLCFAAMLVYVLLRD* |
Ga0126313_101070822 | 3300009840 | Serpentine Soil | MSRQLALLLLGFAAATVIALLVGAKNLGTAFGVAQGCFAALLVYVLMRD* |
Ga0126313_101380943 | 3300009840 | Serpentine Soil | MRRQLLLLLLAFAGGTAIALLVGAENLGTAAGIGQLCFAAMLVYVLLRD* |
Ga0126313_102529012 | 3300009840 | Serpentine Soil | MSRQLALLLLGFAAATVLALLVGAKNLGTAFGVAQVCFAALLVFGLMRD* |
Ga0126305_100000546 | 3300010036 | Serpentine Soil | MSRQLLFLLLALAAGTALALLAGAKNLGTALAIGQLCFAAVLVYVLMRD* |
Ga0126305_107284582 | 3300010036 | Serpentine Soil | MGRQLLLLLLAFAVGVAVAGALGAGLGAAFGVGQLCFAATLVCVLLRAD* |
Ga0126304_108057832 | 3300010037 | Serpentine Soil | MARQLLFLLLALAAGTALALLAGAKNLGTALAIGQLCFAAVLVYVLMRD* |
Ga0126310_106154232 | 3300010044 | Serpentine Soil | MGRQLLFLLIAFAVGAAVAGVLGAGLGVAFGVGQICFAATLVWTLLR* |
Ga0134124_100469483 | 3300010397 | Terrestrial Soil | MGRQLALLLFGFAAATVIALLAGAKNLGTAFGVAQVCFAGLLVYVLMRD* |
Ga0134127_104140592 | 3300010399 | Terrestrial Soil | MRRQLLLLLLAFAGGTALALLAGAKNLGTAMGVGQLCFAAILVFVLLRD* |
Ga0157284_1000005814 | 3300012893 | Soil | MGRQLLLLLVAFAAGAAVAGALGAGLGVAFGVGQICFAATLVYVLLRG* |
Ga0157286_104772822 | 3300012908 | Soil | MSRQLALLLLGSAAATGIALALGAKNLGTALGVSQLAFAALLVYVLMRD* |
Ga0157301_100050063 | 3300012911 | Soil | MIRQPAKLLLAFAAGVALAELAGAASLGVALGIGQLCFAATLVWILLRD* |
Ga0164300_105656721 | 3300012951 | Soil | MGRQLLLLLLAFTGGIAVALLVGAKNFGTAMGVGQLCFAAMLVYVLLRD* |
Ga0164298_110309691 | 3300012955 | Soil | MGRQLLFLLLAFAAGTGVALLLGAKNLGTAMGIGQLCFAAMLVYVLLRD* |
Ga0164299_107206142 | 3300012958 | Soil | MSRQLLLLLIAFAGGTALALLVGAKNLGTGMGVGQLCFAAMLVFVLLRD* |
Ga0164301_100000294 | 3300012960 | Soil | MGRQLLLPLLAFAGGIAIALLVGAKNLGTAMGIGQLCFAATLVFVLLRD* |
Ga0164301_100034625 | 3300012960 | Soil | MLVAFAAGTGLALLLGAKNLGTAMGIGQLCFAAVLVFVLLRD* |
Ga0164302_100003348 | 3300012961 | Soil | MGRQLLLLLLAFAGGAAIALLLGANNLGIALGIGQLCFAAMLVFVLLRD* |
Ga0164308_101938533 | 3300012985 | Soil | MGRQLLLMLLLGFTGGTVIALLLGAKNLGTAFGIGQVCFAAVLVYVLLRD* |
Ga0157371_1000708011 | 3300013102 | Corn Rhizosphere | MGRQLALLLLGFAAATVIALLVGAKNLGTAFGVAQACFAALLVYVLMRD* |
Ga0157370_101651722 | 3300013104 | Corn Rhizosphere | MGRQLLLLLAVFAGAAAIALLVGAKSLGTALGVAQVSFAAGLVYVLLRD* |
Ga0157374_119242232 | 3300013296 | Miscanthus Rhizosphere | MGRQLALLLFGFAAATVIALLVGAKNLGTAFGVAQVCFAALLVYVSMRE* |
Ga0157378_100026484 | 3300013297 | Miscanthus Rhizosphere | MGRQLLLLLIAFALGTAMAGLLGAGLGVAFGVGQICFAATLVYVLLRD* |
Ga0163162_112800881 | 3300013306 | Switchgrass Rhizosphere | MGRQLLILALGFGVGAAVALLLGAKNLGTAFGVGQLTFVIALAYVLVVRR* |
Ga0157375_124537552 | 3300013308 | Miscanthus Rhizosphere | MRRQLLLLLLAFLGGAAIALLAGAKNLGTAFGVGQICFAAMLVYVLLRD* |
Ga0157380_120956762 | 3300014326 | Switchgrass Rhizosphere | MSRQLLLLLLAFAGGTAIALLADAKNLGTAMGIGQLCFAATLVYVLLRD* |
Ga0182000_100572143 | 3300014487 | Soil | MGRQLLLLLVAFAIGAAGAGVLGASLGVAFGVGQLCFAAMLVYVLLRG* |
Ga0182000_100876402 | 3300014487 | Soil | MSRQLALLLLAFAAGAVIALAFGAKNLGTALGVAQLCFAAVLVYVLMRD* |
Ga0157376_100499054 | 3300014969 | Miscanthus Rhizosphere | MGHRLPQLLLLSIAFAGGAALALLAGAKNLGTALGIGQLCFAAVLVYVLMRD* |
Ga0173478_100733092 | 3300015201 | Soil | MGRQLLLLLAALVAGTALALLVGAKNLGTALAIGQLCFAAMLVYVLMRD* |
Ga0163161_100070767 | 3300017792 | Switchgrass Rhizosphere | MSRQLLLLLLAFAGGTALAAALGAVNTGVALGIGQLCFVATLLWVLLTD |
Ga0184624_100001257 | 3300018073 | Groundwater Sediment | MSRALLLLLATLVAGTALALLAGAKNLGTALAIGQLCFAATLVYVLMRD |
Ga0066655_109197061 | 3300018431 | Grasslands Soil | MSRQLALLLLGFVAATMIALLVGAKNLGTAFGVAQVCFAALLVYVLMRD |
Ga0190269_100002213 | 3300018465 | Soil | MGRQLLFLLVAFALGTAVAGLLGAGLGVAFGVGQIGFAATLVYVLLRN |
Ga0190269_114961822 | 3300018465 | Soil | MSRQLLLLFLATAAGVAIALLAGAKNLGTALGIGQVFFAVALAYVLLRD |
Ga0190271_10000005221 | 3300018481 | Soil | MLAALVVGTALAALLGAASFGIALGFGQLCFAATLVAVLLR |
Ga0190271_120860182 | 3300018481 | Soil | MSRQLLLLLLAFAGGTAIALLVGAKNLGTAMGIGQLCFIATLVFVLLRD |
Ga0190273_100004055 | 3300018920 | Soil | MSRPLALLLLGSAAATVLALLLGAKNLGTALGVAQVCFAGLLVYVLMRD |
Ga0173482_102666582 | 3300019361 | Soil | MSRQLLLLLLAFAGGTALAAALGAVNTGVALGIGQLCFVATLLWVLLRD |
Ga0193743_10102504 | 3300019889 | Soil | MGRQLLLLLLAFAGGTAIAALLGAVTLGVAFGVGQLCFAALLVWFLLKD |
Ga0193699_100131544 | 3300021363 | Soil | MRRQLLLLLIAFAGSAAIALLAGAKNLGTAMGIGQLCFAAMLVYVLLRD |
Ga0247752_10063853 | 3300023071 | Soil | MSRQLLLLLVAFAGGTAIALLVGAKNLGTAMGVGQLCFAATLVFVLLRD |
Ga0247802_10024582 | 3300023077 | Soil | MGRQLLLLLIAFTLGTAVAGLLGVGLGVAFGVGQICFAATLVYLLLRS |
Ga0247789_10285762 | 3300023266 | Soil | MRRQLLLLLLASAASAAIALLVGAKNLGTALGVAQVGFAAALVYVLLRD |
Ga0247776_100157644 | 3300023275 | Plant Litter | MGRQLLLMLVAFAAGTGLALLLGAKNLGTAMGIGQLCFAAVLVYVLLRD |
Ga0247794_100015294 | 3300024055 | Soil | MGRQLALLLLGFAAATVIALLAGAKNLGTAFGVAQVCFAGLLVYVLMRD |
Ga0247672_10480142 | 3300024187 | Soil | MSRQLALLLLGFAAATVVALLVGAQNLGTAFGVAQVCFAAL |
Ga0207656_101226352 | 3300025321 | Corn Rhizosphere | MRRQLLLLLLAFLGGAAIALLAGAKNLGTAMGVGQLCFAAMLVFVLLRGD |
Ga0208356_100000287 | 3300025504 | Arctic Peat Soil | VSRQLLLLLFAFAAGTALAGLLGAVSLGVAFGVGQLCFAATLIWVLLRD |
Ga0207710_100388783 | 3300025900 | Switchgrass Rhizosphere | MRRQLLLLLLAFAGGTALALLAGAKNFGTAMGAGQLCFAAMLVFVLLRD |
Ga0207680_100640584 | 3300025903 | Switchgrass Rhizosphere | MSRQLLLLLIAFAGGTAIALLVGAKNLGTAMGVGQLCFAATLVFVLLRD |
Ga0207705_101367363 | 3300025909 | Corn Rhizosphere | MRRQLLLLLLAFAGGAALALLAGAKNLGTAMGAGQLCFAAMLVFVLLRD |
Ga0207693_100028849 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRQLLLLLVAFSIGTAVAGALGAGLGVAFAVGQICFAATLAYVLLRG |
Ga0207659_1000012641 | 3300025926 | Miscanthus Rhizosphere | MGRQLLLLSTAFALGTAVAGLLGAGLGVAFGVGQICFAATLVYVLLRG |
Ga0207700_1000000320 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLLGFAGGTVIALLLGAKNLGTAFGVAQVCFAAVVVYVLLRD |
Ga0207664_100485334 | 3300025929 | Agricultural Soil | MGRQLLLLLLGFAGGTAIALALGAKNLGTAFGVGQLCFAVTLVWILMRD |
Ga0207709_100022047 | 3300025935 | Miscanthus Rhizosphere | MSRQLLLLLAALLAGTALALLVGAKNLGTALAIGQLCFAAMLVYVLMRD |
Ga0207670_100118002 | 3300025936 | Switchgrass Rhizosphere | MTRQLLLLALAFAGATAIALLVGAKNLGTAFGVGQLAFAATLVYVLMRG |
Ga0207711_102349142 | 3300025941 | Switchgrass Rhizosphere | MGRQLLLLLLAFAGGIAIALLVGAKNLGTAMGIGQLCFAATLVFVLLRD |
Ga0207661_100100286 | 3300025944 | Corn Rhizosphere | MGRQLLLLLVAFAAGTALAGALGAGLGVAFAVGQICFAATLAYVLLRY |
Ga0207668_100321712 | 3300025972 | Switchgrass Rhizosphere | MRRQLLLLLAALVAGTALALLFGAKNLGTALAIGQLCFAATLVYVLMRD |
Ga0207668_102203062 | 3300025972 | Switchgrass Rhizosphere | MGRQLLLLLLALAGGTALALLVGAKNLGTALAIGQICLAATLVYVLMRD |
Ga0207703_101227544 | 3300026035 | Switchgrass Rhizosphere | MGRRLPLLLLAFAAGTGIALLLGAINLGTAFGVGQLTFAATLVWLLMTA |
Ga0207639_100282704 | 3300026041 | Corn Rhizosphere | MSRQLALLLLGFAAATVIALLAGAKNLGTAFGVAQLCFAALLVFVLMRD |
Ga0207678_103214422 | 3300026067 | Corn Rhizosphere | MRRQLLLLLLAFAGGAAIALLAGAKNLGTAMGVGQLCFAAMLVFVLLRD |
Ga0207702_1000053440 | 3300026078 | Corn Rhizosphere | MSRQLALLLLGFAAATVIALLVGAKNLGTAFGVAQVCFAVLLVVVLMRD |
Ga0207641_100795992 | 3300026088 | Switchgrass Rhizosphere | MGRRLPLLLLAFAAGTGIALLLGAINLGTAFGVGQLTFAATLAWLLMTA |
Ga0207675_1015482083 | 3300026118 | Switchgrass Rhizosphere | MGRQLLLLLLALAGGTALALLVGAKNLGTALAIGQICFAATLVYVLMRD |
Ga0209152_1000014220 | 3300026325 | Soil | MSRQLLLLLAALAAGTALALLLGAKNLGTALAIGQLCFAAMLVYVLMRD |
Ga0209326_10067962 | 3300026899 | Forest Soil | MSRQLALLLLGFAGGTAIALLVGAKNLGTAMGVGQLCFAATLVYVLLRD |
Ga0209074_100373403 | 3300027787 | Agricultural Soil | MGRQLLLMLVAFAAGTGLALLLGAKNLGTAMGIGQLCFAAMLVLVLLRD |
Ga0209726_100512374 | 3300027815 | Groundwater | MGRQLLLLLFAFAAGAALAGLLGAVSLGVAFGVGQLTFAAMLVWLLMTG |
Ga0268266_100268064 | 3300028379 | Switchgrass Rhizosphere | MSRQLLLLLVAFAGGTALAMLVGARNLGTAMGVGQLCFAATLVFVLLRD |
Ga0268266_100593504 | 3300028379 | Switchgrass Rhizosphere | MGRQLLFLALAFGLGTALALLLGAKNLGTAMGIGQLCFAAVLVLVLLRD |
Ga0268266_108511182 | 3300028379 | Switchgrass Rhizosphere | MSRQLLLLLLAFAGGTALALLVGAKNLGTAIGVGQPCFAAMLVFVLLRD |
Ga0268265_108479021 | 3300028380 | Switchgrass Rhizosphere | MRRQLLLLLLAFLGGAAIALLAGAKNLGTAMGIGQLCFAAMLVYVLLRD |
Ga0307291_10204872 | 3300028707 | Soil | MSRQLALLLLGFAAATVIALLVGAKNLGTAFGVAQLCFTALLVYVLMRD |
Ga0307285_10000002122 | 3300028712 | Soil | MGRQLLFLLIAFALGTAVAGLLGAGLGVAFGVGQICFAATLVYLLLRS |
Ga0307315_100033374 | 3300028721 | Soil | MSRQLPLLLLAFAGGAAIALVFGAKNFGTAFGVGQLCFAATLVWVLMRD |
Ga0307319_1000000845 | 3300028722 | Soil | MGRQLLFLLIAFAVGAAVAGLLGAGLGVAFGVGQICFAATLVYVLLRD |
Ga0302262_103382272 | 3300028743 | Fen | MRRDLLTLLAAFAGGAAIAGILGANSLGIAFGVGQLTFAAGLMWVLLR |
Ga0307316_100180244 | 3300028755 | Soil | MSRQLLLLALAFAGGMVLALLLGAKNLGTALGVAQLSFAGMLIYVLVRSR |
Ga0307280_1000001256 | 3300028768 | Soil | MGRQLLLLLLSFAAGVAIALLVGAKNLGTAMGIGQLCFAATLVYVLLRD |
Ga0307314_100107922 | 3300028872 | Soil | MGRQLLLLALAFAGGTVVALLIGVKNFGTAIGVAQLCFAGTLVYVLLRD |
Ga0268243_10069963 | 3300030510 | Soil | MGRQLLLLLVAFAIGAAGAGVLGASLGVAFGVGQLCFAAMLVYVLLRG |
Ga0265327_104973642 | 3300031251 | Rhizosphere | MGRQLLLLLLAFAAGTALAGLLGAVSLGVAFGVGQLTFVAMLVWLLMTD |
Ga0307446_11022862 | 3300031354 | Salt Marsh | MVRQLLILAAAFAGGTLLALALGAVNLGTAFGVGQLTFVAALVWLLLSDRRGGSGDRGRH |
Ga0307506_100495332 | 3300031366 | Soil | MRRQLLLLLLAFAGGAAFALLAGAKDLGTAFGIGQLCFAAMLVYVLLRD |
Ga0308174_106087521 | 3300031939 | Soil | MGRQLLILVLGFAGGAAIALVLGAKNLGTAFGVGQLTFAATLVWVLMRSD |
Ga0335070_100006931 | 3300032829 | Soil | MARQLAILVLAFAGGTLLALALGAKNLGTALAVGQLVFAAVLVVVLLTDKRRR |
Ga0334924_028834_388_534 | 3300033989 | Hypolithic Biocrust | MARQLLVLLLAFAVGTAVAGALGAGLGTAFGIGQMFFVFALVYVLLRD |
Ga0334918_000588_5837_5983 | 3300034000 | Hypolithic Biocrust | MGRQLLFLLIAFALGAAVAGALGAGLGVAFGVGQICFAATLVYVLLRS |
Ga0334925_070369_623_751 | 3300034173 | Hypolithic Biocrust | LLLGFAAATVIALLLGAKNLGTAFGVAQVCFAALLVYVLMRD |
⦗Top⦘ |