NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055946

Metagenome / Metatranscriptome Family F055946

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055946
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 41 residues
Representative Sequence VLTERLEFVPERDAEIFATVPAAPAVFLLRGEDARAEPYVSKT
Number of Associated Samples 131
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 10.14 %
% of genes near scaffold ends (potentially truncated) 97.83 %
% of genes from short scaffolds (< 2000 bps) 88.41 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (57.971 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(7.971 % of family members)
Environment Ontology (ENVO) Unclassified
(21.014 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.130 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.68%    β-sheet: 0.00%    Coil/Unstructured: 87.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF01695IstB_IS21 36.23
PF01541GIY-YIG 7.97
PF00216Bac_DNA_binding 5.07
PF11918Peptidase_S41_N 2.17
PF09965DUF2199 1.45
PF13456RVT_3 1.45
PF14520HHH_5 0.72
PF02567PhzC-PhzF 0.72
PF01520Amidase_3 0.72
PF04055Radical_SAM 0.72
PF01641SelR 0.72
PF13620CarboxypepD_reg 0.72
PF12631MnmE_helical 0.72
PF14559TPR_19 0.72
PF12681Glyoxalase_2 0.72
PF12704MacB_PCD 0.72
PF12850Metallophos_2 0.72
PF01207Dus 0.72
PF01370Epimerase 0.72
PF03466LysR_substrate 0.72
PF01197Ribosomal_L31 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 36.23
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 5.07
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.72
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.72
COG0254Ribosomal protein L31Translation, ribosomal structure and biogenesis [J] 0.72
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 0.72
COG0860N-acetylmuramoyl-L-alanine amidaseCell wall/membrane/envelope biogenesis [M] 0.72

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms57.97 %
UnclassifiedrootN/A42.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002914|JGI25617J43924_10144122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis824Open in IMG/M
3300004091|Ga0062387_100529455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae829Open in IMG/M
3300004091|Ga0062387_100600412All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter789Open in IMG/M
3300005445|Ga0070708_101441818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae642Open in IMG/M
3300005459|Ga0068867_100181936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1672Open in IMG/M
3300005518|Ga0070699_101179118Not Available703Open in IMG/M
3300005538|Ga0070731_11118650All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter520Open in IMG/M
3300005559|Ga0066700_11016297All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005563|Ga0068855_100119445All Organisms → cellular organisms → Bacteria → Acidobacteria3018Open in IMG/M
3300005575|Ga0066702_10790335Not Available565Open in IMG/M
3300005591|Ga0070761_10112111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1579Open in IMG/M
3300005591|Ga0070761_11050862All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae518Open in IMG/M
3300005598|Ga0066706_11328152All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300005617|Ga0068859_101352274Not Available785Open in IMG/M
3300005905|Ga0075269_10001886Not Available3084Open in IMG/M
3300006032|Ga0066696_10278416Not Available1084Open in IMG/M
3300006041|Ga0075023_100565413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae523Open in IMG/M
3300006050|Ga0075028_100647759All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae631Open in IMG/M
3300006102|Ga0075015_100051263All Organisms → cellular organisms → Bacteria1954Open in IMG/M
3300006102|Ga0075015_100891245All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300006162|Ga0075030_100213910All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300006174|Ga0075014_100983897All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis510Open in IMG/M
3300006175|Ga0070712_100691036All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae869Open in IMG/M
3300006176|Ga0070765_100037166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3860Open in IMG/M
3300006755|Ga0079222_11226358All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae675Open in IMG/M
3300006893|Ga0073928_10131646All Organisms → cellular organisms → Bacteria2045Open in IMG/M
3300006893|Ga0073928_10650064Not Available740Open in IMG/M
3300006903|Ga0075426_10270059Not Available1240Open in IMG/M
3300009088|Ga0099830_10595702Not Available906Open in IMG/M
3300009092|Ga0105250_10381576Not Available622Open in IMG/M
3300009162|Ga0075423_12726924Not Available541Open in IMG/M
3300009520|Ga0116214_1380720Not Available549Open in IMG/M
3300009522|Ga0116218_1480274Not Available554Open in IMG/M
3300009551|Ga0105238_10760928Not Available983Open in IMG/M
3300009624|Ga0116105_1125508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300009634|Ga0116124_1043811Not Available1337Open in IMG/M
3300009644|Ga0116121_1027410All Organisms → cellular organisms → Bacteria1808Open in IMG/M
3300009644|Ga0116121_1169769All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300009645|Ga0116106_1059223Not Available1269Open in IMG/M
3300009665|Ga0116135_1184807Not Available791Open in IMG/M
3300009839|Ga0116223_10309695Not Available941Open in IMG/M
3300010339|Ga0074046_10362702All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium880Open in IMG/M
3300010341|Ga0074045_10672858Not Available658Open in IMG/M
3300011270|Ga0137391_11080677All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300012201|Ga0137365_10176965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1598Open in IMG/M
3300012212|Ga0150985_104273411Not Available648Open in IMG/M
3300012351|Ga0137386_10291765All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1174Open in IMG/M
3300012362|Ga0137361_10773729Not Available874Open in IMG/M
3300012923|Ga0137359_10301819All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1426Open in IMG/M
3300012925|Ga0137419_11418146Not Available587Open in IMG/M
3300012989|Ga0164305_10094058Not Available1905Open in IMG/M
3300014156|Ga0181518_10010044All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7367Open in IMG/M
3300014165|Ga0181523_10227140Not Available1073Open in IMG/M
3300014169|Ga0181531_10189313All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300014325|Ga0163163_10239610All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1864Open in IMG/M
3300014490|Ga0182010_10075417All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1652Open in IMG/M
3300014501|Ga0182024_12429236Not Available567Open in IMG/M
3300014654|Ga0181525_10847968All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium517Open in IMG/M
3300014657|Ga0181522_10085890Not Available1806Open in IMG/M
3300015356|Ga0134073_10381440All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300016422|Ga0182039_11838973Not Available555Open in IMG/M
3300016750|Ga0181505_10044886Not Available947Open in IMG/M
3300017822|Ga0187802_10177027All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300017823|Ga0187818_10247340All Organisms → cellular organisms → Bacteria → Acidobacteria779Open in IMG/M
3300017924|Ga0187820_1068043Not Available986Open in IMG/M
3300017955|Ga0187817_10739414All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300017996|Ga0187891_1045900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1860Open in IMG/M
3300018008|Ga0187888_1064646All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1636Open in IMG/M
3300018030|Ga0187869_10369863All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300018034|Ga0187863_10499523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae681Open in IMG/M
3300018038|Ga0187855_10507130Not Available703Open in IMG/M
3300018043|Ga0187887_10633742Not Available631Open in IMG/M
3300018043|Ga0187887_10911946All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300018044|Ga0187890_10496919All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300018089|Ga0187774_11099993All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300020001|Ga0193731_1084926Not Available823Open in IMG/M
3300020580|Ga0210403_11297125Not Available556Open in IMG/M
3300021088|Ga0210404_10751883Not Available556Open in IMG/M
3300021420|Ga0210394_10272204All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300021479|Ga0210410_10151888All Organisms → cellular organisms → Bacteria2064Open in IMG/M
3300021858|Ga0213852_1226688Not Available739Open in IMG/M
3300024049|Ga0233359_1029390Not Available630Open in IMG/M
3300025320|Ga0209171_10567811Not Available551Open in IMG/M
3300025432|Ga0208821_1003842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4908Open in IMG/M
3300025500|Ga0208686_1000035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae97399Open in IMG/M
3300025906|Ga0207699_10256438Not Available1207Open in IMG/M
3300025910|Ga0207684_10502268Not Available1039Open in IMG/M
3300025922|Ga0207646_10775180All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300025923|Ga0207681_10896249All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300025982|Ga0208139_1001729All Organisms → cellular organisms → Bacteria → Acidobacteria2249Open in IMG/M
3300026309|Ga0209055_1092898Not Available1224Open in IMG/M
3300026324|Ga0209470_1067278All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1675Open in IMG/M
3300026537|Ga0209157_1052076All Organisms → cellular organisms → Bacteria2165Open in IMG/M
3300027073|Ga0208366_1033174Not Available578Open in IMG/M
3300027528|Ga0208985_1050795Not Available805Open in IMG/M
3300027559|Ga0209222_1023065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1216Open in IMG/M
3300027616|Ga0209106_1108892All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300027671|Ga0209588_1260133All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300027676|Ga0209333_1164964Not Available593Open in IMG/M
3300027783|Ga0209448_10030414All Organisms → cellular organisms → Bacteria1804Open in IMG/M
3300027812|Ga0209656_10282785Not Available773Open in IMG/M
3300027824|Ga0209040_10194310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1058Open in IMG/M
3300027842|Ga0209580_10162956Not Available1100Open in IMG/M
3300027882|Ga0209590_10056448All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2211Open in IMG/M
3300027889|Ga0209380_10489264All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300028047|Ga0209526_10026043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4103Open in IMG/M
3300028560|Ga0302144_10185712All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300028740|Ga0302294_10083049Not Available768Open in IMG/M
3300028748|Ga0302156_10140001All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1186Open in IMG/M
3300028748|Ga0302156_10200197All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300028759|Ga0302224_10203109All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300028866|Ga0302278_10250923All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300028874|Ga0302155_10068756All Organisms → cellular organisms → Bacteria1602Open in IMG/M
3300029943|Ga0311340_10752652Not Available828Open in IMG/M
3300029944|Ga0311352_10017943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6986Open in IMG/M
3300029954|Ga0311331_10992269All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300030020|Ga0311344_11018328All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300030054|Ga0302182_10229320Not Available790Open in IMG/M
3300030058|Ga0302179_10278191Not Available737Open in IMG/M
3300030506|Ga0302194_10351199All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300030518|Ga0302275_10644437All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium505Open in IMG/M
3300030519|Ga0302193_10210669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1079Open in IMG/M
3300030677|Ga0302317_10094760All Organisms → cellular organisms → Bacteria1435Open in IMG/M
3300030688|Ga0311345_10115257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3001Open in IMG/M
3300030706|Ga0310039_10058566Not Available1687Open in IMG/M
3300030879|Ga0265765_1000051All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5894Open in IMG/M
3300031234|Ga0302325_10280777All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2729Open in IMG/M
3300031344|Ga0265316_11237155Not Available516Open in IMG/M
3300031525|Ga0302326_12294203All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300031716|Ga0310813_11862390Not Available566Open in IMG/M
3300031718|Ga0307474_10632234Not Available844Open in IMG/M
3300031720|Ga0307469_10772192Not Available879Open in IMG/M
3300032515|Ga0348332_12690131Not Available783Open in IMG/M
3300032782|Ga0335082_10985260Not Available707Open in IMG/M
3300032783|Ga0335079_10360809Not Available1574Open in IMG/M
3300032805|Ga0335078_12070018All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300033158|Ga0335077_11345857Not Available691Open in IMG/M
3300033433|Ga0326726_12375274Not Available515Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog7.97%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland6.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.80%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.07%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.35%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.35%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.35%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.62%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.62%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.90%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.90%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.17%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.45%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.45%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.45%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.45%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.72%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.72%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.72%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.72%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.72%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.72%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.72%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005905Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024049Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025982Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027073Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes)EnvironmentalOpen in IMG/M
3300027528Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028740Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25617J43924_1014412223300002914Grasslands SoilVLSERLEFRPERDSDIFSVVAAAPAVFLLRGADTNSEPYV
Ga0062387_10052945513300004091Bog Forest SoilVLTERVEFIPERDTEVFAAVPAAPAVFLLRGEDAQAEPYV
Ga0062387_10060041223300004091Bog Forest SoilVLSLEFLPERDAEFFAAIPAAPAVFLLRAGDPQAEPYVSRP*
Ga0070708_10144181823300005445Corn, Switchgrass And Miscanthus RhizosphereVLTERIEFRPEADAEVFSALAAAPAVFLLRGEDANSEPYISKTANL
Ga0068867_10018193623300005459Miscanthus RhizosphereVLAERLEFVPQREAEIFAATPAAPAVFSLRGADERADPYISKTANLRRR
Ga0070699_10117911813300005518Corn, Switchgrass And Miscanthus RhizosphereVLTNRAEFVAAADAEIFLTIPATPAVFLLRGDDPQSEPYVSKTA
Ga0070731_1111865013300005538Surface SoilMERIEFLPERDAKVFAAAPAAPAVFLLRGADPASEPYV
Ga0066700_1101629733300005559SoilVLTERIEFQPDRDCDIFSAVAAAPAVFLLRGEDANSEPYVS
Ga0068855_10011944553300005563Corn RhizosphereVLRISLPFESERDEAIFASVPAAPAVFLLRSDDPQAEP
Ga0066702_1079033513300005575SoilLLTERLEFVPERDAETFASVPAAPAVFLLRGSDAQA
Ga0070761_1011211113300005591SoilVLTERLEFAAERDAGVFAAVPAAPAVFLLRGEDAQAEPYV
Ga0070761_1105086213300005591SoilVLSRRLEFVPASEADAFALVPSAPAVFLLRGDDPQSEPY
Ga0066706_1132815223300005598SoilVLTQHLEFVPVRDAEIFGSVPAAPAVFLIRGNDPQSEPYVSKTANLR
Ga0068859_10135227413300005617Switchgrass RhizosphereLVVLRHRLEFRPKADSEQFGSVPAAPAVFLLRGEDEKAEPYVSKT
Ga0075269_1000188613300005905Rice Paddy SoilMLAQRLEFVPERDAEIFAAVPGAAAVFLLGGPEAGSE
Ga0066696_1027841613300006032SoilVLSERIEFTPERDAEIFAAVPAGPAVFVLRGDESHAEPYV
Ga0075023_10056541323300006041WatershedsMVLTERVEFAPDHDAEVFASAPAAPAVFLLRASDPQAEPYVSRTA
Ga0075028_10064775913300006050WatershedsVLTNRLEFVPVRDAELWATVPAAPAVFLLRGDDPKSEPYVSKTAN
Ga0075015_10005126343300006102WatershedsVLTERIEFHPEADAEVFAAVAAAPAVFLLRGEHANSEPYVSKTAN
Ga0075015_10089124523300006102WatershedsVLTERLEFVPERDLEVFAAVPTAAGVFLLRGENAGAE
Ga0075030_10021391013300006162WatershedsVLTERIEFHPEADAEVFAAVAAAPAVFLLRGEHANSEP
Ga0075014_10098389713300006174WatershedsVLTERIEFRPEADAEVFSAAAAAPAVFLLRGEDANSEPYVSKTAN
Ga0070712_10069103613300006175Corn, Switchgrass And Miscanthus RhizosphereMLTQRLEFAPQRDTEIFAAVPAAPAVFLLRGESAESEPYVSKTA
Ga0070765_10003716613300006176SoilMEFHPEADSKVFSSVADAPAVFLLRAEDADSEPYVSKTANLRRRLQRL
Ga0079222_1122635823300006755Agricultural SoilVLTERLEFTPERDAELFAAVPAGPAVFLLQGKDQGAEPYVSKTA
Ga0073928_1013164643300006893Iron-Sulfur Acid SpringVLTERLEFAPERDFEIFATVPVAPAVFLLRGADLQSEPYVSKT
Ga0073928_1065006423300006893Iron-Sulfur Acid SpringVLTERLEFAHERDAEIFSAIPAAPAVFLLRGEDAEAEP
Ga0075426_1027005933300006903Populus RhizosphereMLAERLEFAPERDAGIFASVPARPAVFLLRGPEAGA
Ga0099830_1059570223300009088Vadose Zone SoilVLTERLEFVPDRDAEAFAAVPDAPAVFVLRSADPQAEP
Ga0105250_1038157623300009092Switchgrass RhizosphereVLTERLDFIPDRDAEVFAAAPSAPAVFMLRRDDPQA
Ga0075423_1272692413300009162Populus RhizosphereVLTERLEFAPDRDTEAFAAVPAGPAVFLLRGNDPQ
Ga0116214_138072013300009520Peatlands SoilVLTERIEFRPERDAQVFSTAAAAPAVFLLRGEDVNSEPYVSKT
Ga0116218_148027413300009522Peatlands SoilVLTERLEFVPERDAEIFATVPAAPAVFLLRGEDARAEPYVSKT
Ga0105238_1076092813300009551Corn RhizosphereVLTEQIEFTPERDLEIFAAVPAGPAIFALRGDESHAEPYVSKTANL
Ga0116105_112550813300009624PeatlandVLTESLEFAPERDAEIFSAVPAAPAVFSLRGEDAQAEPYVSKTA
Ga0116124_104381123300009634PeatlandVLTERIEFQPERDIDIFSTVAAAPAVFLLRGEDANSEPYVSKTANLR
Ga0116121_102741013300009644PeatlandVLTERLEFAPERDALVFATVPAAPAVFLLRGEDPQAEPYVSKTA
Ga0116121_116976913300009644PeatlandVLTESLEFAPERDAEIFSAVPAAPAVFSLRGEDAQAEPYVSKT
Ga0116106_105922323300009645PeatlandLVLTERLEFAPERDGQVFSAVPAAPAVFLLRGEDPR
Ga0116135_118480723300009665PeatlandVLTERLEFAPERDSEIFASVPAAPAVFLLRASDPQSEPYVSKTANL
Ga0116223_1030969513300009839Peatlands SoilVLTERLEFRPEADAEVFSTVAAAPAVFLLRGADAN
Ga0074046_1036270213300010339Bog Forest SoilVLTRCIEFIPARDVEPWATVPPAPAVFLLRGDDPQSEPYVSKTANL
Ga0074045_1067285823300010341Bog Forest SoilMVLTERIEFHPERDREIFSAVAPAPAVFLLRGEDANSEPYASKTA
Ga0137391_1108067723300011270Vadose Zone SoilVLTERIEFRPEADTEIFSTAAAAPAVFLLRGEDANSEPYV
Ga0137365_1017696513300012201Vadose Zone SoilVATVLTNQLEFLPSKDTEVFAEACAAPAVFSLRGDDPHSEPYISKTANLRRRLQ
Ga0150985_10427341123300012212Avena Fatua RhizosphereVLTERLDFIPDRDAEVFAAAPSAPAVFMLRGGDPQAE
Ga0137386_1029176533300012351Vadose Zone SoilVLTERIEFHPEADAEVFSAAAAAPAVFLLRGEDANSEPY
Ga0137361_1077372913300012362Vadose Zone SoilVLTERLEFVPERDSEIFAAVPAASAVFLLRGEDAQSEPYVSK
Ga0137359_1030181933300012923Vadose Zone SoilVLTERIEFRPEADAEVFSAVAAAPAVFLLRGEDANS
Ga0137419_1141814623300012925Vadose Zone SoilVLTERLEFVPERDAEIFSAVPSAPAVFLLRGEDAQGEPYVSK
Ga0164305_1009405813300012989SoilMLSTRLDFTPEFDFAALPAAPAVFLLRGDEASEPYVSKTA
Ga0181518_10010044123300014156BogVLSLEFTPERDAEFFAAIPAAPTVFLLRADDPQAEPYV
Ga0181523_1022714023300014165BogVLSERIEFRPEADAEVFSAVAAAPAVFLLRGQDANSEPYVSK
Ga0181531_1018931333300014169BogVLTERVEFVTERDAEILAAIPAASAVFLLRGEDAQAEPYVS
Ga0163163_1023961033300014325Switchgrass RhizosphereVLTERLEFAPDRDVEAFAAAPAGPAVFLLRGNDAQAEPYVSKTA
Ga0182010_1007541713300014490FenVLSERIEFRPEIDAEVFSAVAAAPAVFLLRGEDANSEP
Ga0182024_1242923613300014501PermafrostVLSSGLEFVPTQDAEIFAAVPAAAAVFLLRGDDIHAEPYV
Ga0181525_1084796823300014654BogVLTERLEFAPERDAGVFAAVPAAPAVFLLRGEDARAE
Ga0181522_1008589043300014657BogVLTERIEFRAEADAEVFAAVAAAPAVFALRGADANA
Ga0134073_1038144013300015356Grasslands SoilVLSERIEFTPERDAEIFAAVPAGPAVFVLRGDESHAEPYVSKTANL
Ga0182039_1183897313300016422SoilVLTDRIEFTPDRDAEVFASVPAGPAVFLLRGEDAQAEPYVSK
Ga0181505_1004488623300016750PeatlandVLTERIEFRPEADAEVFSAAAAAPAVFLLRGEDLNS
Ga0187802_1017702723300017822Freshwater SedimentMEHRLLSHCIEFVPASDADALSMAPATPAVFHLRGQDPQSEPYVSKTAN
Ga0187818_1024734023300017823Freshwater SedimentVLSLEFLPERDAEFFAAIPAAPAVFLLRADDPQAEPYVSRP
Ga0187820_106804323300017924Freshwater SedimentVLNERLEFAPERDTDVFSAVPAAPAVFLRRGEDPQSEPYVSK
Ga0187817_1073941413300017955Freshwater SedimentMEHRLLSHCIEFVPASDADALSMAPAAPAVFLLRGQDPQSEPYVSKTANLR
Ga0187891_104590033300017996PeatlandVLTERIEFQPERDSDIFSAAAAAPAVFLLRGEDANS
Ga0187888_106464633300018008PeatlandVLTERIEFRPEAVAEVFSAVAAAPAVFLLRGEDAHSEPY
Ga0187869_1036986313300018030PeatlandVLTESLEFAPERDAEIFSAVPAAPAVFSLRGEDAQAEPYV
Ga0187863_1049952313300018034PeatlandVLTERIEFVPEKDSQILSAFPAVPAVFLLLGENAQAEPYVSKTANLRRRL
Ga0187855_1050713013300018038PeatlandVLADRIEFRPEAEAEVFSAAPAAPAVFLLRGEDANSQP
Ga0187887_1063374223300018043PeatlandVLTERIEFCPEADAEVFSAAAPAPAVFLLRGEDANSEPYVS
Ga0187887_1091194623300018043PeatlandVLSERIEFHPEADAEIFSAMAAAPAVFLLRGEDANSEPYVS
Ga0187890_1049691913300018044PeatlandVLATRIEFAPDHDREIFSAIPARASVFLLRASDPVSEPYVSKTANLRRRLER
Ga0187774_1109999313300018089Tropical PeatlandVLSLEFTPERDVEVFAAIPAVPAVFLLRADDPQAEPYVSKTTN
Ga0193731_108492623300020001SoilVLSERLEFVSAQDSELFSAVPLAPAVFSLRGDDPQSEPYVSKTA
Ga0210403_1129712523300020580SoilVLTHLDFVPTRDAEMFASVPAAPAVFLLRSDDPHSE
Ga0210404_1075188313300021088SoilVLTERIEFTPVRDADIFSSVPTGPAVFLLRGEDATAEPYVSK
Ga0210394_1027220433300021420SoilVLTERIEFAPERDAEVFTSVPGSPAVFLLRGDDPQAEPYVSK
Ga0210410_1015188813300021479SoilVLSHHLEFVPARDGEILAAIPAAPAVFLLRADDPQSEPYVSKTAN
Ga0213852_122668823300021858WatershedsVLTEQLEFTPERGAEVLGAIPAAPAVFLLRGQDAQAEPYVS
Ga0233359_102939023300024049SoilVLTERLEFAAERDAAIFAGVPAAPAVFLLRGNEISAEPYVSKTAN
Ga0209171_1056781123300025320Iron-Sulfur Acid SpringVLTERLEFVAERDSETFAAVPASPAVFLLRGSEQHSEPY
Ga0208821_100384213300025432PeatlandVLTERLEFAPERDAEIFSAVPAAPAVFLLRADDSQAEPYVSKT
Ga0208686_1000035903300025500PeatlandVLTERLEFAPERDAEIFSAVPAAPAVFLLRADDSQAE
Ga0207699_1025643823300025906Corn, Switchgrass And Miscanthus RhizosphereVLSERIEFTPERDAEIFAAVPAGPAVFVLRGDESHAEPYVS
Ga0207684_1050226813300025910Corn, Switchgrass And Miscanthus RhizosphereVLAQRLEFAPERDAEVFAAVPAAPAVFLLRGEDAQA
Ga0207646_1077518013300025922Corn, Switchgrass And Miscanthus RhizosphereVLTERIEFRPEADAEVFSALAAAPAVFLLRGEDANSEP
Ga0207681_1089624923300025923Switchgrass RhizosphereVLQISLPFEPERDEAIFASVPAAPAVFLLRSDDPQAEPY
Ga0208139_100172933300025982Rice Paddy SoilMLAQRLEFVPERDAEIFAAVPGAAAVFLLGGPEAGSEPYV
Ga0209055_109289823300026309SoilVLTERIEFTPDRDADIFSSVPAGPAVFLLRGEDATAEPYVS
Ga0209470_106727833300026324SoilVLSERLEFVPARDAEIFAAIPTTPAVFLLRADDPQSEPYVSK
Ga0209157_105207643300026537SoilVVLSERLEFVPAQDAEIFAATPATPAVFLLRADDPQS
Ga0208366_103317413300027073Forest SoilVLTERIEFTPDRDADIFSSVPASPAVFHLRGEDATAEPYV
Ga0208985_105079513300027528Forest SoilVLTERLEFSPEQDTEVLAAIPAAPAVFLLRGEDAQADPYV
Ga0209222_102306513300027559Forest SoilVLTECIEFHPEADVEIFSSIAAAPAVFLLRGEDAHSEPYVSK
Ga0209106_110889213300027616Forest SoilVLTERIEFRPEADAEVFSTVAAAPAVFLLRGEDTSS
Ga0209588_126013313300027671Vadose Zone SoilVLTERIEFRPEADAEVFSAVATASAVFLLRGEDANS
Ga0209333_116496423300027676Forest SoilVLTERIEFRPEADAEVFSAVAAAPAVFLLRGADANSEPYVSK
Ga0209448_1003041413300027783Bog Forest SoilVLSLEFLPERDAEFFAAIPAAPAVFLLRAGDPQAEPYVSRP
Ga0209656_1028278523300027812Bog Forest SoilVLTERLEFSPERDAETLAAVPAAPAVFLLRGEDAYAEPY
Ga0209040_1019431033300027824Bog Forest SoilVLSERIEFHPEADAEVFAAVAAAPAVFLLRGEDPNTEPYVSK
Ga0209580_1016295623300027842Surface SoilMLAQRLEFVPERDAEIFASVPAAAAVFLLQGPEAGSEPYVSKTAN
Ga0209590_1005644813300027882Vadose Zone SoilVLTERLEFASERVAEVFAIAPAAPAVFLLRGEDAQAEPYVSKTAN
Ga0209380_1048926423300027889SoilMEFHPEADSKVFSSVADAPAVFLLRAEDADSEPYV
Ga0209526_1002604313300028047Forest SoilVLTERLEFVAERDSETLAAVPASPAVFLLRGGEQHSEPYI
Ga0302144_1018571213300028560BogVLTERVEFAAERDAEIFAAIPATPAVFLLCGEDAQ
Ga0302294_1008304913300028740FenMTHYNRLVLSERIEFRPEADNEIFASVPPAPAIFLLRGADP
Ga0302156_1014000133300028748BogVLTERLEFAPERDASVFATVPAEPAVFLLRGADPQGEPYVSKT
Ga0302156_1020019733300028748BogVLTERVEFAAERDAEIFAAIPATPAVFLLCGEDAQAEPYVSKTANLR
Ga0302224_1020310913300028759PalsaVLTDRLEFAPERDAEVFGAVPAAPAVFLLRGDDPHAEPYVSKTA
Ga0302278_1025092333300028866BogVLTERLEFAPECDAEVFAAVAAAPAVFMLRGQDVQAE
Ga0302155_1006875633300028874BogVLTERLEFAPECDAEVFAAVAAAPAVFMLRGQDAQAEPYVSKTANLR
Ga0311340_1075265223300029943PalsaVLTERLEFAPERDSEIFAAVSAAPAVFLLRGADPQSEPYVSKT
Ga0311352_1001794383300029944PalsaVLSERLEFRPEADNEIFFAVPAAPAVFVLRGEVANSEPYVGKTANLR
Ga0311331_1099226913300029954BogVLTERIEFHPEADAEIFSTLGTAPAVFLLRGADANSEPYVSKTAN
Ga0311344_1101832813300030020BogVLTERIEFHPEADAEIFSTLGTAPAVFLLRGADANSEPYVSK
Ga0302182_1022932013300030054PalsaVLTEHLEFAPEQDAEIFSAVPAAPAVFLLRGEDTHAE
Ga0302179_1027819123300030058PalsaVLTERIEFRPEVDAEVFAAVAAAPAVFLLRAADAN
Ga0302194_1035119913300030506BogVLTERIEFHPEADAEIFSTLGTAPAVFLLRGADANSE
Ga0302275_1064443723300030518BogVLTERLEFAPECDAEVFAAVAAAPAVFMLRGQDAQAEPYVSKTAN
Ga0302193_1021066913300030519BogVLTERIEFRPEADGEIFSAVAAAPAVFLLRGTDAGAEPYVSKT
Ga0302317_1009476013300030677PalsaVLTERLEFVPERDAEVFAAVPSAPAVFLLRGHDSQA
Ga0311345_1011525753300030688BogVLTERVEFAAERDAEIFAAIPATPAVFLLCGEDAQAEPYVSKTAN
Ga0310039_1005856633300030706Peatlands SoilVLSLEFLPERDAEFFAAIPAAPAVFLLRAGDPQAEPYVSKT
Ga0265765_100005183300030879SoilVLTERLEFAPERDAEIFSAVPAAPAVFSLRGEDTQ
Ga0302325_1028077713300031234PalsaVLTERVEFVPENDSQILSAFPAAPGVFLLRGENTEAEPYVS
Ga0265316_1123715513300031344RhizosphereVLSERIEFRPEADAEVFSSVAAAPAVFLLRGEDEHSEPYVSKT
Ga0302326_1229420333300031525PalsaVLTERVEFAAERDAEIFAAIPATPAVFLLCGEDAQAEP
Ga0310813_1186239013300031716SoilMLAERLEFAPERDAEVFASVPARPAVFLLRGPEAGA
Ga0307474_1063223413300031718Hardwood Forest SoilVLTERIEFRPERDNDIFSAVAAAPAVFLLRGDDANSEPYVSKT
Ga0307469_1077219223300031720Hardwood Forest SoilVLTERLEFAAERDTEIFAAVPAAPAVFLLRGDDAHAEPYVSKTANL
Ga0348332_1269013123300032515Plant LitterVLTERLEFAPERDAEIFSAVPAEPAVFSLRGEDTQAEPYVSKTAN
Ga0335082_1098526033300032782SoilVLNERIEFHPERDGEVFSAVPTAPAVFLLRGGDPASEPYVS
Ga0335079_1036080933300032783SoilVLSLEFLPERDVEFFDAIPAAPAVFLLRADDPQAEP
Ga0335078_1207001813300032805SoilVLANRLEFEPDRDRETFALIPAAPAVFLLHGPDPAAQ
Ga0335077_1134585713300033158SoilMVLARQLEFVPANDDDIFVSVPPAPAVFLLRPDDPASEPYVSKTA
Ga0326726_1237527413300033433Peat SoilVLAERIEFIPERDAELFATVPSGPAVFLLRGEHAL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.