Basic Information | |
---|---|
Family ID | F055964 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 138 |
Average Sequence Length | 40 residues |
Representative Sequence | VDRKYGHRGYRDAEKQEKKDKSHDRKPPAGGPRGADQF |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.28 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 89.13 % |
Associated GOLD sequencing projects | 125 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.203 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.362 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.043 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.73% β-sheet: 0.00% Coil/Unstructured: 77.27% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF03992 | ABM | 29.71 |
PF01593 | Amino_oxidase | 26.81 |
PF00494 | SQS_PSY | 1.45 |
PF02012 | BNR | 0.72 |
PF03459 | TOBE | 0.72 |
PF00782 | DSPc | 0.72 |
PF13751 | DDE_Tnp_1_6 | 0.72 |
PF01850 | PIN | 0.72 |
PF06253 | MTTB | 0.72 |
PF12704 | MacB_PCD | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG1562 | Phytoene/squalene synthetase | Lipid transport and metabolism [I] | 1.45 |
COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.20 % |
Unclassified | root | N/A | 5.80 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459010|GIO7OMY01EFK50 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300001159|JGI12650J13346_1005544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300001545|JGI12630J15595_10101184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100196782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1906 | Open in IMG/M |
3300002562|JGI25382J37095_10177777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10448673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300004082|Ga0062384_101313835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300004091|Ga0062387_100408459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
3300004104|Ga0058891_1504598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300004132|Ga0058902_1236507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300005187|Ga0066675_10761342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
3300005332|Ga0066388_102989117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
3300005437|Ga0070710_10683844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
3300005558|Ga0066698_10548275 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300005566|Ga0066693_10061411 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
3300005587|Ga0066654_10004497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4756 | Open in IMG/M |
3300005764|Ga0066903_103047153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
3300005993|Ga0080027_10429617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300006173|Ga0070716_101791702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300006174|Ga0075014_100005501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4065 | Open in IMG/M |
3300006800|Ga0066660_10040160 | All Organisms → cellular organisms → Bacteria | 2968 | Open in IMG/M |
3300006800|Ga0066660_10482819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
3300006806|Ga0079220_10336858 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300007265|Ga0099794_10192946 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300009038|Ga0099829_10114019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2119 | Open in IMG/M |
3300009090|Ga0099827_11826193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300009523|Ga0116221_1379029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300009615|Ga0116103_1161448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300009824|Ga0116219_10559638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300009839|Ga0116223_10493555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300010043|Ga0126380_10863812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
3300010359|Ga0126376_12811302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300010376|Ga0126381_102272192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
3300010398|Ga0126383_12244900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300011064|Ga0138525_1134989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300011269|Ga0137392_10199483 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
3300011270|Ga0137391_11448307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300012096|Ga0137389_10126511 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
3300012096|Ga0137389_10837713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
3300012189|Ga0137388_11186016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
3300012202|Ga0137363_10119069 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
3300012202|Ga0137363_10243260 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300012202|Ga0137363_10406569 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300012205|Ga0137362_10630324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
3300012205|Ga0137362_11353087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300012206|Ga0137380_10422331 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300012208|Ga0137376_10185712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1796 | Open in IMG/M |
3300012361|Ga0137360_10267766 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300012582|Ga0137358_10168843 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
3300012918|Ga0137396_10524736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
3300012923|Ga0137359_11282761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300012924|Ga0137413_10867660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
3300012977|Ga0134087_10307678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300012986|Ga0164304_10692522 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300012986|Ga0164304_11385756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300015054|Ga0137420_1094621 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300015264|Ga0137403_10327495 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
3300016445|Ga0182038_11786372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300017928|Ga0187806_1373605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300017961|Ga0187778_10996829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300017994|Ga0187822_10192963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300018015|Ga0187866_1077987 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300018086|Ga0187769_11390499 | Not Available | 531 | Open in IMG/M |
3300019890|Ga0193728_1142052 | Not Available | 1065 | Open in IMG/M |
3300020021|Ga0193726_1195223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
3300020579|Ga0210407_10481077 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300020581|Ga0210399_10051255 | All Organisms → cellular organisms → Bacteria | 3316 | Open in IMG/M |
3300020581|Ga0210399_10586329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
3300021088|Ga0210404_10289366 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300021088|Ga0210404_10534431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300021178|Ga0210408_10260620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1381 | Open in IMG/M |
3300021401|Ga0210393_10276498 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300021404|Ga0210389_10101499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2216 | Open in IMG/M |
3300021405|Ga0210387_11803457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300021407|Ga0210383_10115856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2261 | Open in IMG/M |
3300021420|Ga0210394_11358330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300021432|Ga0210384_11163064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300021474|Ga0210390_11406773 | Not Available | 555 | Open in IMG/M |
3300021478|Ga0210402_11427269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300021479|Ga0210410_10141048 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
3300021559|Ga0210409_11151564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300021560|Ga0126371_11472682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
3300021560|Ga0126371_13782132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300022506|Ga0242648_1102813 | Not Available | 500 | Open in IMG/M |
3300022507|Ga0222729_1063324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300022527|Ga0242664_1132477 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300022530|Ga0242658_1075674 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300022531|Ga0242660_1113908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300022532|Ga0242655_10063319 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300022724|Ga0242665_10211801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300025899|Ga0207642_10326854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
3300026298|Ga0209236_1055477 | All Organisms → cellular organisms → Bacteria | 1952 | Open in IMG/M |
3300026310|Ga0209239_1139536 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300026320|Ga0209131_1416311 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300026469|Ga0257169_1053784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 636 | Open in IMG/M |
3300026489|Ga0257160_1078804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300026514|Ga0257168_1003471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2483 | Open in IMG/M |
3300026551|Ga0209648_10832570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300026552|Ga0209577_10224656 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
3300026557|Ga0179587_10516395 | Not Available | 784 | Open in IMG/M |
3300026910|Ga0207840_1019130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300027502|Ga0209622_1034980 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300027548|Ga0209523_1004454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2323 | Open in IMG/M |
3300027605|Ga0209329_1088425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
3300027655|Ga0209388_1053782 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300027727|Ga0209328_10063357 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300027729|Ga0209248_10057332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1191 | Open in IMG/M |
3300027812|Ga0209656_10054290 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
3300027812|Ga0209656_10211289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
3300027826|Ga0209060_10529669 | Not Available | 534 | Open in IMG/M |
3300027855|Ga0209693_10499879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300028906|Ga0308309_10001642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13260 | Open in IMG/M |
3300028906|Ga0308309_10366736 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300029636|Ga0222749_10176359 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300030580|Ga0311355_11047755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
3300030842|Ga0075404_11341918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300030848|Ga0075388_11640799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300030939|Ga0138303_1282113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
3300031057|Ga0170834_104037461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
3300031474|Ga0170818_107369094 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300031679|Ga0318561_10295227 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300031719|Ga0306917_10520821 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300031720|Ga0307469_10860600 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300031753|Ga0307477_10107487 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
3300031820|Ga0307473_10599706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
3300031823|Ga0307478_11646749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300031890|Ga0306925_10386689 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300031890|Ga0306925_10997842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
3300031962|Ga0307479_10842758 | Not Available | 891 | Open in IMG/M |
3300032001|Ga0306922_11806367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300032063|Ga0318504_10644929 | Not Available | 509 | Open in IMG/M |
3300032090|Ga0318518_10660055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300032091|Ga0318577_10039020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2089 | Open in IMG/M |
3300032174|Ga0307470_11751340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300032261|Ga0306920_103870287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300032515|Ga0348332_14767977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 844 | Open in IMG/M |
3300032893|Ga0335069_10961523 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300033289|Ga0310914_11762497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.36% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.39% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.07% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.35% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.35% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.62% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.90% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.17% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.17% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.45% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.45% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.45% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.72% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.72% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.72% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.72% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004132 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF240 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026910 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030842 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030939 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F62_00394770 | 2170459010 | Grass Soil | VDRKYSHRGYRDSDKEKKSRPDRKPPQGGPRGQND |
JGI12650J13346_10055442 | 3300001159 | Forest Soil | VDRKYSHRGYRDAEKDDKKSKVHHDRKPPSGGPRG |
JGI12630J15595_101011841 | 3300001545 | Forest Soil | VDRKYSHRGYRDAEKDEKKSKVHHDRKPPSGGPRG |
JGIcombinedJ26739_1001967821 | 3300002245 | Forest Soil | VDRKYGHRGYRDAEKQEKHEKRDRADRKPPQGGPR |
JGI25382J37095_101777771 | 3300002562 | Grasslands Soil | VDRKYGHRGYRDAEKQDKKDKHERKPPAGGPRGADQFGPRTPR |
JGIcombinedJ51221_104486731 | 3300003505 | Forest Soil | VDRKYGHRGYRDAEKGDKKEKSHDRKPPAGGPRGADQFGPRTP |
Ga0062384_1013138351 | 3300004082 | Bog Forest Soil | VDRKYSHRGYRDAEKEKKEKPRKQPPAGGPRGADQFGPRTPRMVG |
Ga0062387_1004084592 | 3300004091 | Bog Forest Soil | VDRKYSHRGYRDAENKEKKEKPRKPPAGGPRGADQFGPRTPRMVGT |
Ga0058891_15045981 | 3300004104 | Forest Soil | VDRKYGHRGYRDAEKQDKKERSHDRKPPSGGPRADQFGPR |
Ga0058902_12365072 | 3300004132 | Forest Soil | VDRKYGHRGYRDTEKGEKREKGHDRKPPQGGPRADQFGPRTP |
Ga0066675_107613422 | 3300005187 | Soil | VDRKYGHRGYRDAEKNDKKERSHDRKPPQNGPRADQFGPRTPRM |
Ga0066388_1029891171 | 3300005332 | Tropical Forest Soil | VDRKYGHRGYRDSEKGEKREKRERKPPAGGPRGMDQFGPRTPRM |
Ga0070710_106838441 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRKYGHRGYRDAEKQEKHEKKDRHDRKPPQGGPRGATDHLGP |
Ga0066698_105482751 | 3300005558 | Soil | VDRKYGHRGYRDAEKQDKKDKSHDRKPPAGGPRGADQFG |
Ga0066693_100614113 | 3300005566 | Soil | VDRKYGHRGYRDAEKQEKKDKSHDRKPPAGGPRGADQF |
Ga0066654_100044975 | 3300005587 | Soil | VDRKYGHRGYRDSEKGEKRERSHDKKPPAGGPRGADQFGPRTPRMV |
Ga0066903_1030471531 | 3300005764 | Tropical Forest Soil | VDRKYSHRGYRENEKEERKSRPEKRPPAGGPRGQNDH |
Ga0080027_104296171 | 3300005993 | Prmafrost Soil | VDRKYSHRGYRDAEKQDKKEKVHHDRKPPSGGPRGADQF |
Ga0070716_1017917022 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRKYGHRGYRDTEKGEKREKHERKPPQGGPRADQFGPRTPRM |
Ga0075014_1000055011 | 3300006174 | Watersheds | VDRKYGHRGYRDAEKQEKRDKSHDRKPPAGGPRGADQFGPRTP |
Ga0066660_100401601 | 3300006800 | Soil | VDRKYSHRGYRDAEKTDKKDKSHDRKPPAGGPRGADQF |
Ga0066660_104828191 | 3300006800 | Soil | VDRKYGHRGYRDAEKQDKKDKHERKPPAGGPRGADQFGPRTPRMV |
Ga0079220_103368583 | 3300006806 | Agricultural Soil | VDRKYSHRGYRDAEKQDKKDKSHDRKPPAGGPRGAD |
Ga0099794_101929461 | 3300007265 | Vadose Zone Soil | VDRKYSHRGYRDAEKNEKKEKTHDRKPPSGGPRGADQFGPRTP |
Ga0099829_101140191 | 3300009038 | Vadose Zone Soil | VSPKYGHRGYKDAEKKEKKEKSHDRKPPSGGPRQDQFGPRTPRM |
Ga0099827_118261932 | 3300009090 | Vadose Zone Soil | VDRKYSHRGYRDAEKNEKKEKTHDRKPPSGGPRGADQF |
Ga0116221_13790291 | 3300009523 | Peatlands Soil | VDRKYGHRGYRDAEKQEKHEKKDRDRKPPQGGPRG |
Ga0116103_11614481 | 3300009615 | Peatland | VDRKYGHRGYRDAEKQEKHEKKDRHDRKPPQGGPRGATDHLGPRT |
Ga0116219_105596382 | 3300009824 | Peatlands Soil | VDRKYGHRGYRDAEKQEKHEKKDRHDRKPPQGGPRGATDHL |
Ga0116223_104935551 | 3300009839 | Peatlands Soil | VDRKYGHRGYREAEKQDKHEKKDRHDRKPPQGGPRGATDHLGP |
Ga0126380_108638121 | 3300010043 | Tropical Forest Soil | VDRKYSHRGYRDSEKSEKRERSHEKKPPSGGPRGADQFGPRTPRMV |
Ga0126376_128113021 | 3300010359 | Tropical Forest Soil | VDRKYSHRGYRENEKEERKSRPEKRPPAGGPRGQNDHLGP |
Ga0126381_1022721923 | 3300010376 | Tropical Forest Soil | VDRKYGHRGYRDAEKREKKERPERKPPQGGPRGATDHLGPR |
Ga0126383_122449002 | 3300010398 | Tropical Forest Soil | VDRKYSHRGYRDAEKNEKKEKSHDRKPPQGGPRADQFGPR |
Ga0138525_11349892 | 3300011064 | Peatlands Soil | VDRKYGHRGYREAEKQDKHEKKDRHDRKPPQGGPRGATVHLGPRTPRMVG |
Ga0137392_101994833 | 3300011269 | Vadose Zone Soil | VDRKYSHRGYRDAEKSEKKDKSHDRKPPAGGPRGADQFGPR |
Ga0137391_114483072 | 3300011270 | Vadose Zone Soil | VDRKYGHRGYRDAEKQDKKDKSHDRKPPAGGPRGAD |
Ga0137389_101265111 | 3300012096 | Vadose Zone Soil | VDQKNSHRGYRDAEKSEKKEKTHDRKPPSGGPRGADQFGPRTPR |
Ga0137389_108377132 | 3300012096 | Vadose Zone Soil | VDRKYGQRGYRDAEKNDKKDKSHERKPPAGGPPGAD |
Ga0137388_111860162 | 3300012189 | Vadose Zone Soil | VDRKYSHRGYRDAEKDDKKNKSHDRSHDRKPPQGGPRADQFGPRTPRM |
Ga0137363_101190693 | 3300012202 | Vadose Zone Soil | VDRKYSHRGYRDAEKSEKKEKTHDRKPPSGGPRGAD |
Ga0137363_102432603 | 3300012202 | Vadose Zone Soil | VDRKYSHRGYRDAEKSEKKEKTHDRKSPSGGPRGADQFGPRTPRMVG |
Ga0137363_104065693 | 3300012202 | Vadose Zone Soil | VDRKYSHRGYRDAEKQEKKEKSHDRKPPQSGPRGD |
Ga0137362_106303242 | 3300012205 | Vadose Zone Soil | VDRKYNHRGYRDAEKQEKKDRSHDRKPPQGGPRADQFGPRT |
Ga0137362_113530872 | 3300012205 | Vadose Zone Soil | VDRKYGHRGYRDTEKGEKREKHDRKPPQGGPRADQFGPRTPRMVG |
Ga0137380_104223313 | 3300012206 | Vadose Zone Soil | VDRKYGHRGYRDSEKGEKRERSHEKKPPAGGPRGADQF |
Ga0137376_101857121 | 3300012208 | Vadose Zone Soil | VDRKYSHRGYRDAEKTDKKDTSHDRKPPAGGPRGADQFGPRTPRM |
Ga0137360_102677661 | 3300012361 | Vadose Zone Soil | VDRKYSHRGYRDAEKSEKKEKTHDRKSPSGGPRGADQFGP |
Ga0137358_101688431 | 3300012582 | Vadose Zone Soil | MEAFVDRKYGHRGYRDAEKQEKKDKSHDRKPPAGGPRGADQFGPRTPRM |
Ga0137396_105247361 | 3300012918 | Vadose Zone Soil | VDRKYSHRGYRDAEKQEKKERSHDRKPPQGGPRADQFGPRTPRM |
Ga0137359_112827611 | 3300012923 | Vadose Zone Soil | VDRKYNHRGYRDAEKQEKKDRSHDRKPPQGGPRADQFGPR |
Ga0137413_108676601 | 3300012924 | Vadose Zone Soil | VDRKYSHRGYRDAEQNEKKDKSRNGNHGHDRKPLQNGPRADQFGPRTPRMVGTV |
Ga0134087_103076781 | 3300012977 | Grasslands Soil | VFVSRKYSHRGYRDAEKNEKKDKSHDRKPPAGGPRGADQFGP |
Ga0164304_106925223 | 3300012986 | Soil | VDRKYSHRGYRDAEKDDKKQRSHERKPPQGGPRGADQFGPRTPR |
Ga0164304_113857562 | 3300012986 | Soil | VDRKYSHRGYRDAEKNEKKEKTHDRKPPSGGPRGADQFGTRTP |
Ga0137420_10946213 | 3300015054 | Vadose Zone Soil | VDRKYGHRGYRDAEKQDKKDKSHDRKPPAGGPRGADQFGPR |
Ga0137403_103274953 | 3300015264 | Vadose Zone Soil | VDRKYSHRGYRDSDKEKKSRPERKPPQGGPRGQNDHLGPR |
Ga0182038_117863721 | 3300016445 | Soil | VDRKYGHRGYRDAEKREKKERPERKPPQGGPRGATDHLGPRTPRM |
Ga0187806_13736051 | 3300017928 | Freshwater Sediment | VDRKYGHRGYREAEKQDRHEKKDRDRKPPQGGPRGATDHLG |
Ga0187778_109968292 | 3300017961 | Tropical Peatland | VDRKYGHRGYRDAEKQEKHEKRDRERKPPQGGPRGA |
Ga0187822_101929631 | 3300017994 | Freshwater Sediment | VDRKYSHRGYRDSEKEDKKHRPEKRPPSGGPRGQNDH |
Ga0187866_10779873 | 3300018015 | Peatland | VDRKYRQRGYMDSDKADKKDRPRERKPPQGPPHQEQFGPRTPRMV |
Ga0187769_113904991 | 3300018086 | Tropical Peatland | VDRKYGHRGYREAEKQDKREKRERGERKPPQGGPRGASDHLGPRTP |
Ga0193728_11420523 | 3300019890 | Soil | VDRKYSHRGYRDSDKEKKARPERKPPQGGPRGQNDHLG |
Ga0193726_11952232 | 3300020021 | Soil | VDRKYSHRGYRDAENNEKKDKNRNGHHQDRRPPSGGPRNA |
Ga0210407_104810771 | 3300020579 | Soil | VDRKYSHRGYRDAEKQDKKERSHDRKPPRGGPRADQFGPRTPRM |
Ga0210399_100512551 | 3300020581 | Soil | MEAFVERKYGHRGYRDAEKQDKKDKSHDRKPPAGGPR |
Ga0210399_105863293 | 3300020581 | Soil | VDRKYGHRGYRDAEKGEKKDKSRERKPPSGGPRGMDQFGP |
Ga0210404_102893663 | 3300021088 | Soil | VDRKYSHRGYRDAEKDEKKSKIHHDRKPPSGGPRG |
Ga0210404_105344311 | 3300021088 | Soil | VDRKYGHRGYRDAEKQEKHEKKDRHDRKPPQGGPRGATDH |
Ga0210408_102606201 | 3300021178 | Soil | VDRKYGHRGYRDAEKQDKKDKSHDRKPPAGGPRGADQFGPRTP |
Ga0210393_102764983 | 3300021401 | Soil | VDRKYGHRGYRDTEKGEKKEKHERKPPQGGPRADQF |
Ga0210389_101014993 | 3300021404 | Soil | VDRKYSHRGYRDAEKDDKKKSHSNGHNHDRRPPQGGPR |
Ga0210387_118034571 | 3300021405 | Soil | VDRKYSHRGYRDAEKDDKKKSHSNGHNHDRRSPQGGPRADQFGPR |
Ga0210383_101158561 | 3300021407 | Soil | VDRKYSHRGYRDAEKDDKKKSHSNGHNHDRRPPQGGPRADQ |
Ga0210394_113583302 | 3300021420 | Soil | VDRKYGHRGYRDAEKHEKKERPDRKPPQGGPRGATDHLGRGRRAW |
Ga0210384_111630641 | 3300021432 | Soil | VDRKYNHRGYRDAEKQDKKDRSHDRKPPQGGPRADQFGPRTPRM |
Ga0210390_114067731 | 3300021474 | Soil | VDRKYSHRGYRDAERDEKKDKNRNGNGHHHDRRPPSGGPRNADQF |
Ga0210402_114272692 | 3300021478 | Soil | VDRKYSHRGYRDAEKQDKKERSHDRKPPQGGPRADQFGPR |
Ga0210410_101410483 | 3300021479 | Soil | VDRKYGHRGYRDTEKGEKREKGHDRKPPQGGPRAD |
Ga0210409_111515642 | 3300021559 | Soil | VDRKYGHRGYRDAEKQERREKKDRERKPPQGGPRGAT |
Ga0126371_114726822 | 3300021560 | Tropical Forest Soil | VDRKYSHRGYRDAENNDKKDKNRNGHHQDRRPPSGGPRNADQFGPRT |
Ga0126371_137821322 | 3300021560 | Tropical Forest Soil | VDRKYSHRGYRENEKEERKSRPEKRPPAGGPRGQN |
Ga0242648_11028131 | 3300022506 | Soil | VDRKYSHRGYRDAERDEKKDKNRNGNGHHHDRRPPSGGPRNADQFG |
Ga0222729_10633242 | 3300022507 | Soil | VDRKYGHRGYRDAEKHEKKERPDRKPPQGGPRGATDHLGPRTPRMVG |
Ga0242664_11324771 | 3300022527 | Soil | VDRKYSHRGYRDAEKQDKKERSHDRKPPQGGPRADQFGP |
Ga0242658_10756743 | 3300022530 | Soil | VDRKYGHRGYRDAEKQEKHEKKDRHDRKPPQGGPRGATDHLGPRTPR |
Ga0242660_11139082 | 3300022531 | Soil | VDRKYNHRGYRDAEKQDKKDRSHDRKPPQGGPRADQFG |
Ga0242655_100633191 | 3300022532 | Soil | VDRKYNHRGYRDAEKQDKKDRSHDRKPPQGGPRADQ |
Ga0242665_102118012 | 3300022724 | Soil | VDRKYNHRGYRDAEKQDKKDRSHDRKPPQGGPRADQFGPR |
Ga0207642_103268541 | 3300025899 | Miscanthus Rhizosphere | VDRKYSHRGYRDNEKEDRKARPEKRPPAGGPRGQND |
Ga0209236_10554771 | 3300026298 | Grasslands Soil | VDRKYSHRGYRDAEKSEKKEKTHDRKPPSGGPRGADQF |
Ga0209239_11395363 | 3300026310 | Grasslands Soil | VSRKYSHRGYRDAEKNEKKDKSHDRKPPAGGPRGADQF |
Ga0209131_14163112 | 3300026320 | Grasslands Soil | VDRKYGHRGYRDAEKQDKKEHRHDKKPPQGGPRGQND |
Ga0257169_10537842 | 3300026469 | Soil | VDRKYSHRGYRDGDKEKKSRPERKPPQGGPRGQNDHLG |
Ga0257160_10788041 | 3300026489 | Soil | VDRKYSHRGYRDAEKDEKKSKVHHDRAKPPAGGPRGADQFGPR |
Ga0257168_10034711 | 3300026514 | Soil | VDRKYSHRGYRDSDKEKKSRPERKPPQGGPRGQND |
Ga0209648_108325701 | 3300026551 | Grasslands Soil | VDRKYGHRGYRDSEKGEKRERSHEKKPPSGGPRGADQF |
Ga0209577_102246561 | 3300026552 | Soil | VDRKYSHRGYRDSEKSEKRERSHEKKPPAGGPRGADQFGPPT |
Ga0179587_105163952 | 3300026557 | Vadose Zone Soil | VDRKYSHRGYRDSDKEKKSRPERKPPQGGPRGQNDHL |
Ga0207840_10191301 | 3300026910 | Tropical Forest Soil | VDRKYGHRGYRDAERQEKQQKKDKPDRKPPQGGPRGATDHLGPRTP |
Ga0209622_10349803 | 3300027502 | Forest Soil | VDRKYGHRGYRDAEKQEKHEKRDRQDRKPPQGGPRGATD |
Ga0209523_10044545 | 3300027548 | Forest Soil | VDRKYSHRGYRDAEKQEKKDRSHDRKPPQGGPRGDQ |
Ga0209329_10884251 | 3300027605 | Forest Soil | VDRKYGHRGYRDAEKHEKKERPDRKPPQGGPRGVTDHL |
Ga0209388_10537823 | 3300027655 | Vadose Zone Soil | VDRKYSHRGYRDAEKQDKKERSHDRKPPQGGPRADQ |
Ga0209328_100633571 | 3300027727 | Forest Soil | VDRKYGHRGYRDAEKQDKKERSHDRKPPAGGPRADQFGPRT |
Ga0209248_100573321 | 3300027729 | Bog Forest Soil | VDRKYSHRGYRDAENKEKKEKPRKPPAGGPRGADQFGPR |
Ga0209656_100542904 | 3300027812 | Bog Forest Soil | VDRKYGHRGYRDAEKHEKKERPDRKPPQGGPRGATDHLGPR |
Ga0209656_102112891 | 3300027812 | Bog Forest Soil | VDRKYGHRGYRDAEKQEKHEKKDRERKPPQGGPRGA |
Ga0209060_105296691 | 3300027826 | Surface Soil | VDRKYSHRGYRDAERNEKKDKNHNGHHHDRKPPSGGPRNA |
Ga0209693_104998791 | 3300027855 | Soil | VDRKYGHRGYRDAEKGDKKEKSHDRKPPAGGPRGADQ |
Ga0308309_1000164213 | 3300028906 | Soil | VDRKYGHRGYRDTEKGDKKEKHERKPPQGGPRADQF |
Ga0308309_103667363 | 3300028906 | Soil | VDRKYSHRGYRDAEKNDKKDKSHSNGHDRRPPQGGPRADQF |
Ga0222749_101763591 | 3300029636 | Soil | VDRKYSHRGYRDAEKNDKKDKSHSNGHDRRPPQGGPRADQFGPRTPRMV |
Ga0311355_110477551 | 3300030580 | Palsa | VDRKYSHRGYRDAENKERKEKRPKAPPSGGPRGADQFGPRTPR |
Ga0075404_113419182 | 3300030842 | Soil | VDRKYSHRGYRDAEKDEKKSKVHHDRSKPPSGGPRGADQFGPRTPRMV |
Ga0075388_116407991 | 3300030848 | Soil | VDRKYSHRGYRDAEKEKKSRPERKPPQGGPRGQND |
Ga0138303_12821132 | 3300030939 | Soil | VDRKYGHRGYRDTEKGEKKDKSRGERKPPSGGPRGMDQFGPRTP |
Ga0170834_1040374611 | 3300031057 | Forest Soil | VDRKYSHRGYRDAEKDDKKKSHSNGHNHDRRPPQGGPRADQF |
Ga0170818_1073690943 | 3300031474 | Forest Soil | VDRKYSHRGYRDAEKDDKKKSHSNGHGHDRKPPQGGP |
Ga0318561_102952271 | 3300031679 | Soil | LHGGVVDRKYSHRGYRDSEKEDRKSRPEKRPPAGG |
Ga0306917_105208211 | 3300031719 | Soil | VDRKYGHRGYRDAEKQERREKKDRERKPPQGGPRGA |
Ga0307469_108606003 | 3300031720 | Hardwood Forest Soil | VDRKYGHRGYRDAEKQEKHEKKDRHDRKPPQGGPRG |
Ga0307477_101074873 | 3300031753 | Hardwood Forest Soil | VDRKYSHRGYRDSEKDDKKHRPEKRPPSGGPRGQNDHLGPRTPRM |
Ga0307473_105997061 | 3300031820 | Hardwood Forest Soil | VDRKYGHRGYRDSEKEKKSRPERKPPQGGPRGQNDHL |
Ga0307478_116467491 | 3300031823 | Hardwood Forest Soil | VDRKYGHRGYRDAEKGDKKEKSHDRKPPAGGPRGADQFGPR |
Ga0306925_103866891 | 3300031890 | Soil | VDRKYGHRGYRDAEKHEKREIPDRKPPQGGPRGATDNLG |
Ga0306925_109978421 | 3300031890 | Soil | VDRKYGHRGYRDAEKQERHEKKDRDRKPPQGGPRGATDHLGPR |
Ga0307479_108427582 | 3300031962 | Hardwood Forest Soil | VDRKYSHRGYRDSDKEKKSRPERKPPQGGPRGQNDHLGPRTP |
Ga0306922_118063671 | 3300032001 | Soil | VDRKYGHRGYRDAEKQEKHEKKDRHDRKPPQGGPRGATD |
Ga0318504_106449291 | 3300032063 | Soil | VDRKYGHRGYREAEKQERHEKKDRERRPPQGGPRGATDHLG |
Ga0318518_106600551 | 3300032090 | Soil | VDRKYSHRGYRDSEKSEKRERSHEKKPPAGGPRGADQFGPR |
Ga0318577_100390201 | 3300032091 | Soil | VDRKYSHRGYRDSEKSEKRERSHEKKPPAGGPRGAD |
Ga0307470_117513401 | 3300032174 | Hardwood Forest Soil | VDRKYGHRGYRDAEKHEKKERPDRKPPQGGPRGATDHLGPRTP |
Ga0306920_1038702872 | 3300032261 | Soil | VDRKYGHRGYRDAEKHEKRERPERKPPQGGPRGATDHLGP |
Ga0348332_147679773 | 3300032515 | Plant Litter | VDRKYGHRGYRDTEKGEKREKHERKPPQGGPRSDQFG |
Ga0335069_109615231 | 3300032893 | Soil | VDRKYGHRGYRDAEKHEKRERPDRKPPQGGPRGATDHLGPRTPRMV |
Ga0310914_117624972 | 3300033289 | Soil | VDRKYGHRGYRDAEKHEKRERPERKPPQGGPRGAT |
⦗Top⦘ |