Metagenome / Metatranscriptome Family F056001

Basic Information
Family ID	F056001
Family Type	Metagenome / Metatranscriptome
Number of Sequences	138
Average Sequence Length	39 residues
Representative Sequence	GKPFPFRSPEGRVALVIEVEKARYTKLPFEHTPPK
Number of Associated Samples	133
Number of Associated Scaffolds	138

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	5.11 %
% of genes near scaffold ends (potentially truncated)	92.03 %
% of genes from short scaffolds (< 2000 bps)	86.23 %
Associated GOLD sequencing projects	125
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.17

Most Common Taxonomy
Group	Bacteria (94.928 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.043 % of family members)
Environment Ontology (ENVO)	Unclassified (18.116 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (52.174 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 4.76% β-sheet: 0.00% Coil/Unstructured: 95.24%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 138 Family Scaffolds
PF04972	BON	21.74
PF00574	CLP_protease	7.97
PF00583	Acetyltransf_1	2.17
PF01904	DUF72	2.17
PF00072	Response_reg	1.45
PF00501	AMP-binding	1.45
PF05685	Uma2	1.45
PF01964	ThiC_Rad_SAM	0.72
PF00106	adh_short	0.72
PF01925	TauE	0.72
PF01063	Aminotran_4	0.72
PF13458	Peripla_BP_6	0.72
PF13426	PAS_9	0.72
PF00581	Rhodanese	0.72
PF01734	Patatin	0.72
PF12695	Abhydrolase_5	0.72
PF06649	DUF1161	0.72
PF14581	SseB_C	0.72
PF00892	EamA	0.72
PF01243	Putative_PNPOx	0.72
PF02900	LigB	0.72
PF13620	CarboxypepD_reg	0.72
PF00117	GATase	0.72
PF04349	MdoG	0.72
PF02826	2-Hacid_dh_C	0.72
PF00211	Guanylate_cyc	0.72
PF04389	Peptidase_M28	0.72
PF02668	TauD	0.72
PF07110	EthD	0.72
PF00248	Aldo_ket_red	0.72
PF13145	Rotamase_2	0.72
PF02096	60KD_IMP	0.72
PF08338	DUF1731	0.72
PF13650	Asp_protease_2	0.72
PF10523	BEN	0.72
PF13511	DUF4124	0.72
PF00753	Lactamase_B	0.72
PF05569	Peptidase_M56	0.72
PF12172	DUF35_N	0.72
PF01810	LysE	0.72
PF08240	ADH_N	0.72
PF07311	Dodecin	0.72
PF04366	Ysc84	0.72
PF14667	Polysacc_synt_C	0.72
PF01527	HTH_Tnp_1	0.72
PF00326	Peptidase_S9	0.72
PF01425	Amidase	0.72
PF02515	CoA_transf_3	0.72
PF06026	Rib_5-P_isom_A	0.72

COG ID	Name	Functional Category	% Frequency in 138 Family Scaffolds
COG0616	Periplasmic serine protease, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	15.94
COG0740	ATP-dependent protease ClpP, protease subunit	Posttranslational modification, protein turnover, chaperones [O]	15.94
COG1030	Membrane-bound serine protease NfeD, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	7.97
COG1801	Sugar isomerase-related protein YecE, UPF0759/DUF72 family	General function prediction only [R]	2.17
COG0115	Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase	Amino acid transport and metabolism [E]	1.45
COG4636	Endonuclease, Uma2 family (restriction endonuclease fold)	General function prediction only [R]	1.45
COG0120	Ribose 5-phosphate isomerase	Carbohydrate transport and metabolism [G]	0.72
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.72
COG0422	4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC	Coenzyme transport and metabolism [H]	0.72
COG0706	Membrane protein insertase Oxa1/YidC/SpoIIIJ	Cell wall/membrane/envelope biogenesis [M]	0.72
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	0.72
COG1090	NAD dependent epimerase/dehydratase family enzyme	General function prediction only [R]	0.72
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	0.72
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	0.72
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.72
COG2175	Taurine dioxygenase, alpha-ketoglutarate-dependent	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.72
COG2930	Lipid-binding SYLF domain, Ysc84/FYVE family	Lipid transport and metabolism [I]	0.72
COG3131	Periplasmic glucan biosynthesis protein OpgG	Cell wall/membrane/envelope biogenesis [M]	0.72
COG3360	Flavin-binding protein dodecin	General function prediction only [R]	0.72
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	0.72
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	0.72

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	94.93 %
Unclassified	root	N/A	5.07 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	94.93 %
Unclassified	root	N/A	5.07 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	94.93 %
Unclassified	root	N/A	5.07 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	22.46 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	10.87 %
Unclassified	root	N/A	5.07 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.62 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.72 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	0.72 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	10.87 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	10.87 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	6.52 %
Unclassified	root	N/A	5.07 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.45 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.72 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.72 %
Spirochaetia	class	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia	0.72 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.87 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	10.87 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	5.80 %
Unclassified	root	N/A	5.07 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.45 %
Spirochaetales	order	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales	0.72 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.72 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.72 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.87 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	9.42 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5.80 %
Unclassified	root	N/A	5.07 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.72 %
Spirochaetaceae	family	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae	0.72 %
unclassified Planctomycetia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia	0.72 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.72 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.87 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.42 %
Unclassified	root	N/A	5.07 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	3.62 %
Planctomycetia bacterium 21-64-5	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5	0.72 %
Alkalispirochaeta	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta	0.72 %
Candidatus Sulfotelmatobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter	0.72 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.72 %
Acidipila	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila	0.72 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.72 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.87 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.42 %
Unclassified	root	N/A	5.07 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	3.62 %
unclassified Acidipila	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila	0.72 %
Candidatus Sulfotelmatobacter kueseliae	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	0.72 %
unclassified Burkholderia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia	0.72 %
Alkalispirochaeta odontotermitis	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	0.72 %
Planctomycetia bacterium 21-64-5	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5	0.72 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.72 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10.87 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.42 %
Unclassified	root	N/A	5.07 %
Candidatus Koribacter versatilis Ellin345	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345	2.17 %
Acidipila sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp.	0.72 %
Burkholderia sp. D7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7	0.72 %
Candidatus Sulfotelmatobacter kueseliae	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	0.72 %
Alkalispirochaeta odontotermitis	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	0.72 %
Planctomycetia bacterium 21-64-5	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5	0.72 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.72 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459020\|G1P06HT01AZMGC	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp.	618	Open in IMG/M
3300001084\|JGI12648J13191_1012578	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	818	Open in IMG/M
3300001166\|JGI12694J13545_1007591	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1273	Open in IMG/M
3300002245\|JGIcombinedJ26739_100381486	All Organisms → cellular organisms → Bacteria	1289	Open in IMG/M
3300003218\|JGI26339J46600_10134245	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345	585	Open in IMG/M
3300004152\|Ga0062386_101431242	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	576	Open in IMG/M
3300004633\|Ga0066395_10129326	All Organisms → cellular organisms → Bacteria	1256	Open in IMG/M
3300005289\|Ga0065704_10762869	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	538	Open in IMG/M
3300005353\|Ga0070669_101775538	Not Available	538	Open in IMG/M
3300005406\|Ga0070703_10538609	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300005446\|Ga0066686_10892089	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	584	Open in IMG/M
3300005569\|Ga0066705_10033437	All Organisms → cellular organisms → Bacteria	2784	Open in IMG/M
3300005575\|Ga0066702_10962039	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300005576\|Ga0066708_10097232	All Organisms → cellular organisms → Bacteria	1743	Open in IMG/M
3300005617\|Ga0068859_102558246	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	562	Open in IMG/M
3300005719\|Ga0068861_101696205	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300005764\|Ga0066903_108793371	All Organisms → cellular organisms → Bacteria	513	Open in IMG/M
3300005843\|Ga0068860_100998936	All Organisms → cellular organisms → Bacteria	855	Open in IMG/M
3300006028\|Ga0070717_10921375	All Organisms → cellular organisms → Bacteria	796	Open in IMG/M
3300006173\|Ga0070716_100245160	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1217	Open in IMG/M
3300006174\|Ga0075014_100541888	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	657	Open in IMG/M
3300006354\|Ga0075021_10156918	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1377	Open in IMG/M
3300006796\|Ga0066665_10730970	All Organisms → cellular organisms → Bacteria	783	Open in IMG/M
3300006804\|Ga0079221_10225192	All Organisms → cellular organisms → Bacteria → Proteobacteria	1046	Open in IMG/M
3300006844\|Ga0075428_101823505	All Organisms → cellular organisms → Bacteria → Proteobacteria	633	Open in IMG/M
3300006871\|Ga0075434_100139114	All Organisms → cellular organisms → Bacteria	2447	Open in IMG/M
3300006918\|Ga0079216_10387156	All Organisms → cellular organisms → Bacteria	872	Open in IMG/M
3300007255\|Ga0099791_10260773	All Organisms → cellular organisms → Bacteria	823	Open in IMG/M
3300007265\|Ga0099794_10762972	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300009012\|Ga0066710_100313825	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2302	Open in IMG/M
3300009093\|Ga0105240_12644311	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300009147\|Ga0114129_10462039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7	1663	Open in IMG/M
3300009148\|Ga0105243_11995166	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	614	Open in IMG/M
3300009156\|Ga0111538_12594939	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5	635	Open in IMG/M
3300009165\|Ga0105102_10296508	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	836	Open in IMG/M
3300009634\|Ga0116124_1143609	Not Available	668	Open in IMG/M
3300009792\|Ga0126374_11699880	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300010048\|Ga0126373_10475534	All Organisms → cellular organisms → Bacteria	1288	Open in IMG/M
3300010326\|Ga0134065_10155976	All Organisms → cellular organisms → Bacteria	800	Open in IMG/M
3300010341\|Ga0074045_10005328	All Organisms → cellular organisms → Bacteria	11261	Open in IMG/M
3300010379\|Ga0136449_102148347	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	817	Open in IMG/M
3300010397\|Ga0134124_10479433	Not Available	1200	Open in IMG/M
3300011088\|Ga0138576_1170633	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300011120\|Ga0150983_10661313	All Organisms → cellular organisms → Bacteria	1015	Open in IMG/M
3300011270\|Ga0137391_10616783	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	908	Open in IMG/M
3300012189\|Ga0137388_10546784	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1076	Open in IMG/M
3300012198\|Ga0137364_10994775	Not Available	634	Open in IMG/M
3300012203\|Ga0137399_11376863	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300012207\|Ga0137381_11432312	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	583	Open in IMG/M
3300012208\|Ga0137376_11369098	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300012211\|Ga0137377_10042642	All Organisms → cellular organisms → Bacteria → Acidobacteria	4164	Open in IMG/M
3300012211\|Ga0137377_11750402	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300012354\|Ga0137366_11029086	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300012358\|Ga0137368_10583203	All Organisms → cellular organisms → Bacteria	712	Open in IMG/M
3300012360\|Ga0137375_10917831	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	694	Open in IMG/M
3300012469\|Ga0150984_113821759	All Organisms → cellular organisms → Bacteria	716	Open in IMG/M
3300012922\|Ga0137394_11280410	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	596	Open in IMG/M
3300012925\|Ga0137419_10019344	All Organisms → cellular organisms → Bacteria	3937	Open in IMG/M
3300012927\|Ga0137416_10796627	All Organisms → cellular organisms → Bacteria	835	Open in IMG/M
3300012972\|Ga0134077_10032154	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1867	Open in IMG/M
3300013100\|Ga0157373_11273201	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	556	Open in IMG/M
3300014159\|Ga0181530_10072116	All Organisms → cellular organisms → Bacteria	2152	Open in IMG/M
3300015241\|Ga0137418_10003362	All Organisms → cellular organisms → Bacteria	14715	Open in IMG/M
3300015357\|Ga0134072_10145615	All Organisms → cellular organisms → Bacteria	775	Open in IMG/M
3300015359\|Ga0134085_10462518	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	576	Open in IMG/M
3300015373\|Ga0132257_102395796	All Organisms → cellular organisms → Bacteria	685	Open in IMG/M
3300016294\|Ga0182041_10330116	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1275	Open in IMG/M
3300016404\|Ga0182037_11234310	All Organisms → cellular organisms → Bacteria	657	Open in IMG/M
3300017656\|Ga0134112_10120609	All Organisms → cellular organisms → Bacteria	995	Open in IMG/M
3300017959\|Ga0187779_11159275	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300017970\|Ga0187783_10029407	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	4072	Open in IMG/M
3300017995\|Ga0187816_10371626	All Organisms → cellular organisms → Bacteria	633	Open in IMG/M
3300018074\|Ga0184640_10084828	All Organisms → cellular organisms → Bacteria	1360	Open in IMG/M
3300018090\|Ga0187770_10021016	All Organisms → cellular organisms → Bacteria → Acidobacteria	4424	Open in IMG/M
3300018090\|Ga0187770_10364880	All Organisms → cellular organisms → Bacteria → Acidobacteria	1131	Open in IMG/M
3300018468\|Ga0066662_12375723	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300018469\|Ga0190270_11847867	All Organisms → cellular organisms → Bacteria	660	Open in IMG/M
3300018482\|Ga0066669_10512335	All Organisms → cellular organisms → Bacteria	1040	Open in IMG/M
3300019268\|Ga0181514_1400446	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300020583\|Ga0210401_10001091	All Organisms → cellular organisms → Bacteria	32265	Open in IMG/M
3300021073\|Ga0210378_10107384	All Organisms → cellular organisms → Bacteria	1086	Open in IMG/M
3300021401\|Ga0210393_10939049	All Organisms → cellular organisms → Bacteria	701	Open in IMG/M
3300021402\|Ga0210385_10245468	All Organisms → cellular organisms → Bacteria	1314	Open in IMG/M
3300021403\|Ga0210397_10717977	All Organisms → cellular organisms → Bacteria	769	Open in IMG/M
3300021407\|Ga0210383_10013377	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	6940	Open in IMG/M
3300021475\|Ga0210392_10694023	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300021479\|Ga0210410_11344666	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300021560\|Ga0126371_10291806	All Organisms → cellular organisms → Bacteria	1755	Open in IMG/M
3300021560\|Ga0126371_10515358	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	1344	Open in IMG/M
3300022523\|Ga0242663_1131450	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300022534\|Ga0224452_1217773	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300024251\|Ga0247679_1067143	All Organisms → cellular organisms → Bacteria	601	Open in IMG/M
3300025313\|Ga0209431_10926962	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	622	Open in IMG/M
3300025460\|Ga0208562_1074357	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	695	Open in IMG/M
3300025506\|Ga0208937_1003564	All Organisms → cellular organisms → Bacteria → Acidobacteria	4640	Open in IMG/M
3300025581\|Ga0208355_1079960	All Organisms → cellular organisms → Bacteria	725	Open in IMG/M
3300025922\|Ga0207646_10445533	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1168	Open in IMG/M
3300026294\|Ga0209839_10018938	All Organisms → cellular organisms → Bacteria	2729	Open in IMG/M
3300026298\|Ga0209236_1162097	All Organisms → cellular organisms → Bacteria → Acidobacteria	925	Open in IMG/M
3300026312\|Ga0209153_1185053	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300026325\|Ga0209152_10397490	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	540	Open in IMG/M
3300026333\|Ga0209158_1357815	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300026360\|Ga0257173_1017208	All Organisms → cellular organisms → Bacteria	881	Open in IMG/M
3300026537\|Ga0209157_1146172	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1067	Open in IMG/M
3300026538\|Ga0209056_10050278	All Organisms → cellular organisms → Bacteria	3737	Open in IMG/M
3300027334\|Ga0209529_1077671	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300027619\|Ga0209330_1001879	All Organisms → cellular organisms → Bacteria → Acidobacteria	5800	Open in IMG/M
3300027812\|Ga0209656_10172776	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345	1066	Open in IMG/M
3300027825\|Ga0209039_10343565	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345	581	Open in IMG/M
3300027867\|Ga0209167_10664895	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300027895\|Ga0209624_10657548	All Organisms → cellular organisms → Bacteria	693	Open in IMG/M
3300028536\|Ga0137415_10389235	All Organisms → cellular organisms → Bacteria	1198	Open in IMG/M
3300028748\|Ga0302156_10047698	All Organisms → cellular organisms → Bacteria	2335	Open in IMG/M
3300028759\|Ga0302224_10392717	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300029636\|Ga0222749_10199823	All Organisms → cellular organisms → Bacteria	999	Open in IMG/M
3300029999\|Ga0311339_10913922	Not Available	832	Open in IMG/M
3300030006\|Ga0299907_10612899	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	845	Open in IMG/M
3300030011\|Ga0302270_10501094	All Organisms → cellular organisms → Bacteria	634	Open in IMG/M
3300030738\|Ga0265462_10306065	All Organisms → cellular organisms → Bacteria	997	Open in IMG/M
3300031231\|Ga0170824_114201331	All Organisms → cellular organisms → Bacteria	657	Open in IMG/M
3300031474\|Ga0170818_102159557	All Organisms → cellular organisms → Bacteria → Acidobacteria	604	Open in IMG/M
3300031573\|Ga0310915_10249763	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1248	Open in IMG/M
3300031708\|Ga0310686_109577110	All Organisms → cellular organisms → Bacteria	610	Open in IMG/M
3300031744\|Ga0306918_11156326	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	598	Open in IMG/M
3300031778\|Ga0318498_10221098	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	857	Open in IMG/M
3300031835\|Ga0318517_10575365	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	506	Open in IMG/M
3300031879\|Ga0306919_10845947	All Organisms → cellular organisms → Bacteria	702	Open in IMG/M
3300031912\|Ga0306921_10061917	All Organisms → cellular organisms → Bacteria	4272	Open in IMG/M
3300031942\|Ga0310916_11005082	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	696	Open in IMG/M
3300031962\|Ga0307479_10853066	All Organisms → cellular organisms → Bacteria	885	Open in IMG/M
3300032060\|Ga0318505_10585736	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	524	Open in IMG/M
3300032076\|Ga0306924_10418473	All Organisms → cellular organisms → Bacteria	1533	Open in IMG/M
3300032122\|Ga0310895_10336521	Not Available	723	Open in IMG/M
3300032180\|Ga0307471_101501262	All Organisms → cellular organisms → Bacteria	832	Open in IMG/M
3300032180\|Ga0307471_103793613	All Organisms → cellular organisms → Bacteria	534	Open in IMG/M
3300032893\|Ga0335069_12461783	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	539	Open in IMG/M
3300034894\|Ga0373916_0084462	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	88.41%
Host-Associated	Host-Associated	10.14%
Engineered	Engineered	1.45%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	76.81%
Aquatic	Environmental → Aquatic	11.59%
Plants	Host-Associated → Plants	10.14%
Solid Waste	Engineered → Solid Waste	0.72%
Bioremediation	Engineered → Bioremediation	0.72%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	73.91%
Freshwater	Environmental → Aquatic → Freshwater	8.70%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.52%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.62%
Sediment	Environmental → Aquatic → Sediment	2.90%
Peat	Environmental → Terrestrial → Peat	2.90%
Grass	Engineered → Solid Waste → Grass	0.72%
Metal	Engineered → Bioremediation → Metal	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	58.70%
Loam	Environmental → Terrestrial → Soil → Loam	10.14%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	7.25%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.07%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.07%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.90%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.90%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.17%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.45%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.45%
Composting	Engineered → Solid Waste → Grass → Composting	0.72%
Unclassified	Engineered → Bioremediation → Metal → Unclassified	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	24.64%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	21.01%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.14%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	6.52%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.07%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	4.35%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.35%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.90%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.90%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.90%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	2.17%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.17%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.45%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.45%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.72%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.72%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.72%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.72%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.72%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.72%
Unclassified	Engineered → Bioremediation → Metal → Unclassified → Unclassified	0.72%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	13.04%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	13.04%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.25%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	5.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.35%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.62%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	2.90%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.90%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.90%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.90%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.90%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.90%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	2.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.17%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.17%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.17%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.45%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.45%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.45%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.45%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.45%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	1.45%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	1.45%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.72%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.72%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.72%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.72%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.72%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.72%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.72%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.72%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.72%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.72%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.72%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.72%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.72%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.72%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.72%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.72%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.72%
Sediment Slurry	Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry	0.72%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459020	Litter degradation NP2	Engineered	Open in IMG/M
3300001084	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1	Environmental	Open in IMG/M
3300001166	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300003218	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1	Environmental	Open in IMG/M
3300004152	Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009634	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010341	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300011088	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300014159	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015357	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG	Environmental	Open in IMG/M
3300015359	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015	Environmental	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017995	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018090	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019268	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo	Environmental	Open in IMG/M
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental	Open in IMG/M
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021479	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022523	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022534	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1	Environmental	Open in IMG/M
3300024251	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20	Environmental	Open in IMG/M
3300025313	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)	Environmental	Open in IMG/M
3300025460	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)	Environmental	Open in IMG/M
3300025506	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)	Environmental	Open in IMG/M
3300025581	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026294	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)	Environmental	Open in IMG/M
3300026298	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026312	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)	Environmental	Open in IMG/M
3300026325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)	Environmental	Open in IMG/M
3300026333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)	Environmental	Open in IMG/M
3300026360	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B	Environmental	Open in IMG/M
3300026537	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300027334	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes)	Environmental	Open in IMG/M
3300027619	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)	Environmental	Open in IMG/M
3300027812	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027825	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)	Environmental	Open in IMG/M
3300027867	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027895	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028748	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2	Environmental	Open in IMG/M
3300028759	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1	Environmental	Open in IMG/M
3300029636	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300029999	I_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300030011	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3	Environmental	Open in IMG/M
3300030738	Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031778	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24	Environmental	Open in IMG/M
3300031835	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300032060	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300034894	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2	Engineered	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.17
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.17
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F056001

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
2NP_01642180	2170459020	Switchgrass, Maize And Mischanthus Litter	FCHREEGAKYTGKPFPFRSLEERVALAVEIEKARYTRLPFQHTPPE
JGI12648J13191_10125782	3300001084	Forest Soil	LDAISYKYTGKPFPFRSTEGRVALVIEIEKVRYAKLPFEHAPPK*
JGI12694J13545_10075913	3300001166	Forest Soil	ISYKYTGKPFPFRSTEGRVALVIEIEKVRYAKLPFEHAPPK*
JGIcombinedJ26739_1003814861	3300002245	Forest Soil	RYVGKPFPMRGYEDRIALIIEALKVRYTKLPFEHTPPK*
JGI26339J46600_101342452	3300003218	Bog Forest Soil	SHKYIGKDFPLRNPVGRVALVIEVDKARYTKLPFQHTPPK*
Ga0062386_1014312422	3300004152	Bog Forest Soil	RKYTGKEFPFRDPAGRVALFIEVEKARYMKLPFQHTPPE*
Ga0066395_101293263	3300004633	Tropical Forest Soil	PNLKVMDPISVKYTGKPFPFREPEGRVALIIEIDKARHVKLPFQHTPPEQ*
Ga0065704_107628691	3300005289	Switchgrass Rhizosphere	AAGKYTGQPFPWRNPDGRVALVIEVDKARYTKLPFTHTPLR*
Ga0070669_1017755381	3300005353	Switchgrass Rhizosphere	HKYTGKPFPMRGGEGRVALVIEVDKARYTKLPFAHTPPG*
Ga0070703_105386091	3300005406	Corn, Switchgrass And Miscanthus Rhizosphere	DAAAGKYTGQPFPWRNPDGRVAIVIEVHKARYTKLPFTHTPSR*
Ga0066686_108920891	3300005446	Soil	VSHKYIGKSFPMRNHEGRVALVIEVDKARYTKLPFAHTPPRH*
Ga0066705_100334371	3300005569	Soil	SHKYIGKPFPMRSPEGRVALVIEVDRARYTKLPFAHTPPRQ*
Ga0066702_109620392	3300005575	Soil	PFPFRSPEGRVALMIGVEKARYTKLPFEHTPPSK*
Ga0066708_100972325	3300005576	Soil	YIGKPFPMRSPEGRVALVIEVDKARYTKLPFAHTPPRQ*
Ga0068859_1025582461	3300005617	Switchgrass Rhizosphere	KYTGQPFPWRNPDGRVALVIEVDKARYTKLPFAHTPLR*
Ga0068861_1016962052	3300005719	Switchgrass Rhizosphere	AAAGKYTGQPFPWRNPDGRVAIVIEVHKARYTKLPFTHTPSR*
Ga0066903_1087933712	3300005764	Tropical Forest Soil	VSRKYTGKPFPMRSPEGRVALIIEIEKARHLKIPFKHEPPK*
Ga0068860_1009989363	3300005843	Switchgrass Rhizosphere	AADKYTGQPFPWRNPDGRVALVIEVDRARYTKLPFTPTPPR*
Ga0070717_109213752	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	GKPFPMRSYEGRVALIIEVEKERYTKLPFRHTPPIG*
Ga0070716_1002451601	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	GQMQFRSPEGRVALVIDVEKVRYTQLPFEHTTPK*
Ga0075014_1005418881	3300006174	Watersheds	GKPFPLRDYEGRVALIIEIDKAKYTKLPFAHTPGK*
Ga0075021_101569183	3300006354	Watersheds	GKPFPMRSPEGRVALVIEIEKARYTKLPFEHTPAA*
Ga0066665_107309702	3300006796	Soil	MATSKYIDPISLKYTGKPFPFRSPEGGVALVIEVEKARYTKLAFEHTPPK*
Ga0079221_102251921	3300006804	Agricultural Soil	PFPFRNPQGRVTLVIEIDKARYTKLPFEHTPPAV*
Ga0075428_1018235051	3300006844	Populus Rhizosphere	AQYIGKPFPMRSYEGRVALVIEVDRLRYTKLPFAHTPPRK*
Ga0075434_1001391141	3300006871	Populus Rhizosphere	KPFPMRSYEGRVALVVQVEKAKYTKLPFEHTPPKR*
Ga0079216_103871562	3300006918	Agricultural Soil	VDAVSQKYTGKPFPMRRPEGRVALVIKADKARYVKIPFEHWLAPAR*
Ga0099791_102607732	3300007255	Vadose Zone Soil	GKPFPMRSHEGRVALVIEVDKARYTKLPFAHTPPRQ*
Ga0099794_107629721	3300007265	Vadose Zone Soil	GKPFPMRKPEGRVALIIEVEKERYTKLPFQHTPPK*
Ga0066710_1003138254	3300009012	Grasslands Soil	KPFPMRSHEGRVALVIEVDKARYTKLPFAHTPPRQ
Ga0105240_126443112	3300009093	Corn Rhizosphere	AADAAAGKYTGQPFPWRNPDGRVALVIEVDKARYTKLPFTHTPLR*
Ga0114129_104620392	3300009147	Populus Rhizosphere	LKAADLVSRKYTGKPFPMRSPEGRVALIIEIDKARHLKIPFKHEPPK*
Ga0105243_119951661	3300009148	Miscanthus Rhizosphere	QPFPWRNPDGRVALVIEVDKARYTKLPFTHTPLR*
Ga0111538_125949391	3300009156	Populus Rhizosphere	HKYTGKPFPMRGREGRVALVIELDKVRYTKLPFAHTPPSS*
Ga0105102_102965082	3300009165	Freshwater Sediment	PFRKPEGRVALVIEVERARFTKLPFEHTPPGGEFFG*
Ga0116124_11436092	3300009634	Peatland	TGKPFPFRSPEGRVALVIEIEKARYTKLPFEHTPHQ*
Ga0126374_116998801	3300009792	Tropical Forest Soil	YVGQPFPMRSPAGRVALVIGVDKVRYTKLPFAHTPPAQ*
Ga0126373_104755341	3300010048	Tropical Forest Soil	KYVDAISRKYTGKAFPFRSPEGRIALVIEADKVRYTKLPFQHTPPK*
Ga0134065_101559762	3300010326	Grasslands Soil	SHKYIGKPFPMRSPEGRVALVIEVDKARYTKLPFAHTPPRQ*
Ga0074045_1000532812	3300010341	Bog Forest Soil	MDAISRKYIGKEFPLRNPAGRVALVIEVDKARYTKLPFQHTPPK*
Ga0136449_1021483471	3300010379	Peatlands Soil	DFKIMDAVSYKYTGKPFPFRNPEGRVALIVEVEKVRYTKLPFEHSPPK*
Ga0134124_104794332	3300010397	Terrestrial Soil	GKPFPFRSPEGRVALVIEVEKERYAKLPFEHTPPK*
Ga0138576_11706332	3300011088	Peatlands Soil	GKPFPMRGPEGRVALIIEVEKARYTKLPFQHTPPK*
Ga0150983_106613131	3300011120	Forest Soil	IGKPFPMRSYEGRVALIIEVEKERYTKLPFQHRPPR*
Ga0137391_106167833	3300011270	Vadose Zone Soil	TGKAFPLRSYEGRVALVIEVDKARYTKLPFAHTPPRH*
Ga0137388_105467843	3300012189	Vadose Zone Soil	GKPFPLRSPEGRVALVIEVDKARYTKLPFAHTPPRH*
Ga0137364_109947751	3300012198	Vadose Zone Soil	TGKPFPMREPEDRIALVIEPDKVRYIKLPFEHTPAGK*
Ga0137399_113768631	3300012203	Vadose Zone Soil	PFPMRSHEGRVALVIEVDKARYTKLPFAHTPARQ*
Ga0137381_114323121	3300012207	Vadose Zone Soil	WIPISRKYVGKPFPFRSPEGRVALVIEVEKARFAKLPLEHTPTA*
Ga0137376_113690982	3300012208	Vadose Zone Soil	YIGKAFPMRSYEGRVALIIEVEKERYTKLPFQHRPPRSV*
Ga0137377_100426425	3300012211	Vadose Zone Soil	RSPEGRVALIIEIDKARHLKIPFKHEPPTQLGNP*
Ga0137377_117504021	3300012211	Vadose Zone Soil	TGKPFPFRQPEGKVALVVEIEKARFTKLPFEHTPPK*
Ga0137366_110290862	3300012354	Vadose Zone Soil	SHKYTGKPFPLRNPEGRVALIIEAEKARYTKLPFDHTPPGK*
Ga0137368_105832031	3300012358	Vadose Zone Soil	TGKPFPFRNPEGRVTLVIEIDKARYTKLPFENTPGK*
Ga0137375_109178312	3300012360	Vadose Zone Soil	YTGKPFPMRNPEGRVVLVIEVEKARYHKLPFTHTPGK*
Ga0150984_1138217591	3300012469	Avena Fatua Rhizosphere	RKYIGKEFPMRNPAGRVALVIEVEKAKYTKLPFQHTPSAS*
Ga0137394_112804101	3300012922	Vadose Zone Soil	PFPMRSHAGRVALVIEVDKARYTKLPFAHTPPPQ*
Ga0137419_100193441	3300012925	Vadose Zone Soil	CKYIDPISLKYTGKPFPFRSPEGRVALVIEIEKARYTKLPFEHMPPK*
Ga0137416_107966271	3300012927	Vadose Zone Soil	KPFPMRSHEGRVALVIEVDKARYTKLPFAHTPPRQ*
Ga0134077_100321541	3300012972	Grasslands Soil	MMDPISHKYVGKSFPFRNPEGRVALVIEVEEKARYTKLPFEHTPAA*
Ga0157373_112732012	3300013100	Corn Rhizosphere	EYMDPISQKYTGKPFPFRSPEERVVLVVEIEKAPYTRLPFQHTPAN*
Ga0181530_100721164	3300014159	Bog	RKYIGTEFPFRNPAGRVALVIEVDKARYTKLPFQHTPPK*
Ga0137418_100033628	3300015241	Vadose Zone Soil	LKSTDLVSRKYTGKPFSMRSPEGRVALIIEIDKARHLKIPFKHEPPK*
Ga0134072_101456151	3300015357	Grasslands Soil	KYVGKSFPFRNPEGRVALVIEVEEKARYTKLPFEHTPAA*
Ga0134085_104625181	3300015359	Grasslands Soil	PISRKYTGKPFPMRDPEGRVALLIDVEKARYAKLPFQHTPPK*
Ga0132257_1023957962	3300015373	Arabidopsis Rhizosphere	EISHKYIGKESPFRNPEGRVAMVIEVEKARYTKLPFEHTPPS*
Ga0182041_103301163	3300016294	Soil	KYTGKQFPMRNPAGRVALVIEVEKARYTKLPFQHTPPA
Ga0182037_112343102	3300016404	Soil	DFHFMDRISHKYTGSPFPFRSPEGRVALVIEIEKAKYTKLPFQHTPPG
Ga0134112_101206091	3300017656	Grasslands Soil	IGKPFPLRSPEGRVALVVEADKVRYTKLPFVHTPPRH
Ga0187779_111592752	3300017959	Tropical Peatland	MDAVSDKYAGTPFLSPEGRVALIIEVEKGRHTQLPFEHTPPKIKRGAVQH
Ga0187783_100294074	3300017970	Tropical Peatland	MPTPLCRSPEGRVALIIEVEKVRTAQLPSEPTPPQK
Ga0187816_103716262	3300017995	Freshwater Sediment	GKPFPMRTYEDRVALIIEADKVRYLKLPFEHTPAA
Ga0184640_100848282	3300018074	Groundwater Sediment	VREEPFRNPEGRVALVIEVEMARYAKLPFEHTPPPSA
Ga0187770_100210161	3300018090	Tropical Peatland	YTGKPFPFRNPEGRVALLIEIEKVRYTRLPFEHTPPK
Ga0187770_103648802	3300018090	Tropical Peatland	FSMRYTGKPFPFRHPDQIALVIEVEKERYEKLPFEHTPQ
Ga0066662_123757231	3300018468	Grasslands Soil	TGKPFPFRNPEGRVTLVIEIDKARYAKLPFQHTPPA
Ga0190270_118478672	3300018469	Soil	YTGKPFPMRSPEGRVALVIEVEKARYVKLPFEHTPPRSA
Ga0066669_105123351	3300018482	Grasslands Soil	KYIAKPFPFRKPEGRIALIIEAEKARYTKLPFEHTPAA
Ga0181514_14004461	3300019268	Peatland	KPFPMRQPEGRVALVIEVEKARYTKLPFEHTPPAK
Ga0210401_100010911	3300020583	Soil	GKPFPMRTYEVRMALIIEADKVRYMKLPFEHTPAA
Ga0210378_101073841	3300021073	Groundwater Sediment	MDPVSHKYIGKSFPMRSHEGRVALVIEVDKARYTKLPFAHTPPLQ
Ga0210393_109390492	3300021401	Soil	ISHKYTGNPFPFRAPEGRVVLIIEVEKVRYTKLPFAHTPPK
Ga0210385_102454682	3300021402	Soil	TGNPFPLRAPEGRVVLLIEVEKVRYTKLPFAHTPPK
Ga0210397_107179772	3300021403	Soil	KYTGKPFPMREHLNQVALVIAVDKERYLKLPFQHTPKK
Ga0210383_100133777	3300021407	Soil	HKYIGKPFPMRSPEGRVALIIEVEKARYTKLPFEHAPQ
Ga0210392_106940231	3300021475	Soil	HKYTGKPFPMREHLNQVALVIAVDKERYLKLPFQHTPKK
Ga0210410_108554341	3300021479	Soil	MDPISLKYTGKPFQFRSPEGRVVLVIELEKARYSK
Ga0210410_113446663	3300021479	Soil	MDPISHKYTGKPFPMRSPEGHVALIIEVEKERHTKLPF
Ga0126371_102918064	3300021560	Tropical Forest Soil	ISRKYTGKAFPFRSPEGRIALVIEADKVRYTKLPFQHTPPK
Ga0126371_105153583	3300021560	Tropical Forest Soil	DEDFKTMDAISNKYTQQSLPFRNRAGRVVLVVEVDKARYTKLPFKHTPA
Ga0242663_11314501	3300022523	Soil	GYAQKYTGKPFPFRNPGQIALVIEIENARYEKLPFQHAPGK
Ga0224452_12177731	3300022534	Groundwater Sediment	YIGKPFPMRSDEGRVALVIEVDKARYLKLPFEHTPPRA
Ga0247679_10671432	3300024251	Soil	MMDAISQKYTGKPFPFRSPEGRVALIIEVEKERYTKLPFAHSPGN
Ga0209431_109269623	3300025313	Soil	KYTGKEFPWRNPEGRVILVIEVDRARYTKLPFSHTPA
Ga0208562_10743572	3300025460	Peatland	TGKPFPFRKPEGRVALVVEFEKARYTKLPFQHTPPKV
Ga0208937_10035641	3300025506	Peatland	KPFPFRKPEGRVALVVEFEKARYTKLPFQHTPPKV
Ga0208355_10799602	3300025581	Arctic Peat Soil	EISQKYIGKEFPFRNPEGRVALIIEVEKARYTKLPFEHTPPA
Ga0207646_104455333	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	TGKPFPFRSPEGRVALVIEVEKARFTKLPFEHTPPA
Ga0209839_100189383	3300026294	Soil	GKPFPFRNPEGRVALIIEVEKVRYTKLPFEHTPLK
Ga0209236_11620971	3300026298	Grasslands Soil	GKPFPFRSPEGRVALVIEVEKARYTKLPFEHTPPK
Ga0209153_11850532	3300026312	Soil	ISRKYVGKPFPFRNPEARVALIIEVEKARYTKLPFEHTPAA
Ga0209152_103974902	3300026325	Soil	PLSHKYIGKPFPMRSPEGRVALVIEVDRARYTKLPFAHTPPRQ
Ga0209158_13578151	3300026333	Soil	SHKYTGKAFPMRSHEGRVALLIEIDKARYTKLPFAHTPPRH
Ga0257173_10172081	3300026360	Soil	TGQPFPFRNPEGRVALVIEVEKARYAKLPFEHTPPRSA
Ga0209157_11461722	3300026537	Soil	VSHKYIGKSFPMRNHEGRVALVIEVDKARYTKLPFAHTPPRH
Ga0209056_100502783	3300026538	Soil	MATSKYIDPISLKYTGKPFPFRSPEGGVALVIEVEKARYTKLAFEHTPPK
Ga0209529_10776711	3300027334	Forest Soil	YTGKPYPMRSPEGRVALIIEVEKARYTKLPFQHTPPK
Ga0209330_10018795	3300027619	Forest Soil	LDAISYKYTGKPFPFRSTEGRVALVIEIEKVRYAKLPFEHAPPK
Ga0209656_101727761	3300027812	Bog Forest Soil	GKEFPFRNPVGRVVLVIEVDKARYTKLPFQHTPPK
Ga0209039_103435651	3300027825	Bog Forest Soil	HKYIGKDFPLRNPVGRVALVIEVDKARYTKLPFQHTPPK
Ga0209167_106648952	3300027867	Surface Soil	TGKPFPMRQPEGRVALVIEVEKARYTKLPFEHTPPEK
Ga0209624_106575482	3300027895	Forest Soil	KILDPISHKYVGKPFPMRGPEGRVALIVEVDKERYMKLPFQHTPPK
Ga0137415_103892353	3300028536	Vadose Zone Soil	GKPFPYRNPQGRVALYIELEKARYEKLPFEYTPAA
Ga0302156_100476981	3300028748	Bog	KYAGKPFPFRSPEGRVALVIEIEKARYTKLPFEHTPPQ
Ga0302224_103927171	3300028759	Palsa	YTGKPFPMRSPEGRVALVVEVEKERYTKLPFDHTPPK
Ga0222749_101998232	3300029636	Soil	SHKHIAKPFPMRSYEGRGALIIEVEKERYTKLPFQHTPP
Ga0311339_109139223	3300029999	Palsa	KYIGKPFPMRGDAQVTLVVEPEKVRYLKLPFTHTPPS
Ga0299907_106128991	3300030006	Soil	PFPLRDPAGRVALVIEVEKARYVKLPFEHAPPRSA
Ga0302270_105010941	3300030011	Bog	PISHKYTGKPFPFRAPEGRVALIVEVEKERYTKLPFERPPSK
Ga0265462_103060652	3300030738	Soil	SISHKYIGKPFPMRSPEGRVALIIEVEKARYTKLPFEHAPK
Ga0170824_1142013311	3300031231	Forest Soil	LSHKYTGNPFPMRDHAGAIALIIEAEKVRYLKLPFPHTPPK
Ga0170818_1021595573	3300031474	Forest Soil	GKEFPFRNPEGRVALIIEVEKARYTKLPFQHTPPA
Ga0310915_102497632	3300031573	Soil	KYTGKPFPMRNPEGRVALVIEVEKVRYTKLPFQHTPPA
Ga0310686_1095771101	3300031708	Soil	GYAKKYTGKPFPFRNPGQIALVIEIENARYERLPFQHAPAK
Ga0306918_111563261	3300031744	Soil	YTGKPFPFRSPKGRVALVIEIEKQRYTKLAFEHTPPK
Ga0318498_102210982	3300031778	Soil	AHPFPFRKPEGRVALVIEVETVRYTQLPFTHTPGAKT
Ga0318517_105753652	3300031835	Soil	KYTAHPFPFRKPEGRVALVIEVETVRYTQLPFTHTPGAKT
Ga0306919_108459471	3300031879	Soil	SHKYTGKPFPFRSPEGRVALIIEVEKARYTKLPFQHTPPI
Ga0306921_100619171	3300031912	Soil	PISNKYTAHPFPFRKPEGRVALVIEVETVRYTQLPFTHTPGAKT
Ga0310916_110050821	3300031942	Soil	YTGKPFPFRNPEGRVAVIIEVEKARYTKLPFQHTPPA
Ga0307479_108530662	3300031962	Hardwood Forest Soil	TIMDPISHKYTGNPFPFRTPEGRVALNIEVEKVRYTKLPFQHTPPK
Ga0318505_105857362	3300032060	Soil	IPHKYTGKPFPFRSPKGRVALVIEIEKQRYTKLAFEHTPPK
Ga0306924_104184733	3300032076	Soil	TGKQFPMRNPAGRVALVIEVEKARYTKLPFQHTPPA
Ga0310895_103365211	3300032122	Soil	YTGKPFPMRGGEGRVALVIEVDKARYTKLPFAHTLPG
Ga0307471_1015012621	3300032180	Hardwood Forest Soil	FPMRSHEGRVALVIEVDKARYTKLPFAHTPPPPRH
Ga0307471_1037936131	3300032180	Hardwood Forest Soil	GKPFPFRTPEGRVALIIDAEKVRYTKLPFQHTPPK
Ga0335069_124617831	3300032893	Soil	GKPFPWRDPKGRIALVIEVESARYTKLPFKHTPPQLEPV
Ga0373916_0084462_1_108	3300034894	Sediment Slurry	TGKEFPWRNPQGRVILVIEVDRARYTKLPFRHTPA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign