NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F056122

Metagenome Family F056122

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056122
Family Type Metagenome
Number of Sequences 138
Average Sequence Length 39 residues
Representative Sequence MATNIADAVPRLKRLIPRLRGKRIGVLGDLMLDRYLWGT
Number of Associated Samples 115
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 60.14 %
% of genes near scaffold ends (potentially truncated) 97.83 %
% of genes from short scaffolds (< 2000 bps) 91.30 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.275 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(23.913 % of family members)
Environment Ontology (ENVO) Unclassified
(29.710 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.203 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.28%    β-sheet: 0.00%    Coil/Unstructured: 56.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF03966Trm112p 81.16
PF04069OpuAC 3.62
PF07978NIPSNAP 2.17
PF00571CBS 2.17
PF00561Abhydrolase_1 1.45
PF02518HATPase_c 1.45
PF13435Cytochrome_C554 0.72
PF13231PMT_2 0.72
PF13426PAS_9 0.72
PF12760Zn_Tnp_IS1595 0.72
PF00528BPD_transp_1 0.72
PF05649Peptidase_M13_N 0.72
PF00294PfkB 0.72
PF05231MASE1 0.72
PF07730HisKA_3 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 1.45
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.72
COG3447Integral membrane sensor domain MASE1Signal transduction mechanisms [T] 0.72
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.72
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.72
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.72
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.72

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.28 %
UnclassifiedrootN/A0.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_109267707All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300001356|JGI12269J14319_10264291All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300001661|JGI12053J15887_10434882All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300002908|JGI25382J43887_10365578All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300002917|JGI25616J43925_10199362All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300004091|Ga0062387_100054005All Organisms → cellular organisms → Bacteria1943Open in IMG/M
3300004091|Ga0062387_101666132All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005167|Ga0066672_10426144All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300005177|Ga0066690_10044773All Organisms → cellular organisms → Bacteria → Acidobacteria2669Open in IMG/M
3300005338|Ga0068868_102311786All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005439|Ga0070711_101047342All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300005447|Ga0066689_10954276All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005556|Ga0066707_10284454All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300005587|Ga0066654_10632812All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300005598|Ga0066706_10459127All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300005602|Ga0070762_10571629All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300005610|Ga0070763_10261409All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300005610|Ga0070763_10995666All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005881|Ga0075294_1014607All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300006034|Ga0066656_10525779All Organisms → cellular organisms → Bacteria → Acidobacteria770Open in IMG/M
3300006046|Ga0066652_100318609All Organisms → cellular organisms → Bacteria → Acidobacteria1388Open in IMG/M
3300006047|Ga0075024_100296602All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae791Open in IMG/M
3300006052|Ga0075029_101341024All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300006163|Ga0070715_10113850All Organisms → cellular organisms → Bacteria1280Open in IMG/M
3300006163|Ga0070715_10376991All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300006163|Ga0070715_10914535All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300006173|Ga0070716_101567662All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300006174|Ga0075014_100341242All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300006871|Ga0075434_100389923All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300006904|Ga0075424_102080989All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300006954|Ga0079219_10269860All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300007265|Ga0099794_10514939All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300009177|Ga0105248_11646388All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300010048|Ga0126373_10236647All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1790Open in IMG/M
3300010303|Ga0134082_10325854All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300010339|Ga0074046_10881988All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300010343|Ga0074044_10177841All Organisms → cellular organisms → Bacteria → Acidobacteria1418Open in IMG/M
3300010359|Ga0126376_10551744All Organisms → cellular organisms → Bacteria → Acidobacteria1079Open in IMG/M
3300010362|Ga0126377_10462471All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300010376|Ga0126381_103425538All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300010398|Ga0126383_11574876All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300010398|Ga0126383_12973450All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300011269|Ga0137392_10386986All Organisms → cellular organisms → Bacteria → Acidobacteria1160Open in IMG/M
3300011269|Ga0137392_10570856All Organisms → cellular organisms → Bacteria → Acidobacteria939Open in IMG/M
3300011270|Ga0137391_10551385All Organisms → cellular organisms → Bacteria → Acidobacteria971Open in IMG/M
3300012202|Ga0137363_10003561All Organisms → cellular organisms → Bacteria9484Open in IMG/M
3300012202|Ga0137363_10149395All Organisms → cellular organisms → Bacteria → Acidobacteria1834Open in IMG/M
3300012202|Ga0137363_10330911All Organisms → cellular organisms → Bacteria → Acidobacteria1257Open in IMG/M
3300012202|Ga0137363_11689587All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300012203|Ga0137399_11086679All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300012203|Ga0137399_11539571All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300012205|Ga0137362_10892518All Organisms → cellular organisms → Bacteria → Acidobacteria759Open in IMG/M
3300012205|Ga0137362_11601303All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300012206|Ga0137380_11213977All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300012206|Ga0137380_11314737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae608Open in IMG/M
3300012210|Ga0137378_10399827All Organisms → cellular organisms → Bacteria → Acidobacteria1274Open in IMG/M
3300012362|Ga0137361_10493757All Organisms → cellular organisms → Bacteria → Acidobacteria1124Open in IMG/M
3300012363|Ga0137390_11541764All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300012582|Ga0137358_10016777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4657Open in IMG/M
3300012922|Ga0137394_10655989All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300012923|Ga0137359_10043346All Organisms → cellular organisms → Bacteria3900Open in IMG/M
3300012923|Ga0137359_10048851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3677Open in IMG/M
3300012923|Ga0137359_10543081All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300012925|Ga0137419_10314399All Organisms → cellular organisms → Bacteria → Acidobacteria1201Open in IMG/M
3300012931|Ga0153915_10696323All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300012948|Ga0126375_11041284All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300012957|Ga0164303_10139104All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300012960|Ga0164301_11389766All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300014201|Ga0181537_10829356All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300014325|Ga0163163_12891556All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300014968|Ga0157379_10928702Not Available827Open in IMG/M
3300014969|Ga0157376_12235846All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300015241|Ga0137418_10326130All Organisms → cellular organisms → Bacteria1275Open in IMG/M
3300015264|Ga0137403_10527276All Organisms → cellular organisms → Bacteria → Acidobacteria1050Open in IMG/M
3300016294|Ga0182041_10092321All Organisms → cellular organisms → Bacteria2198Open in IMG/M
3300016294|Ga0182041_11241921All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300017930|Ga0187825_10361731All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300017936|Ga0187821_10032946All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1833Open in IMG/M
3300017972|Ga0187781_11457872All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300017975|Ga0187782_10938748All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300018006|Ga0187804_10234967All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300018012|Ga0187810_10260653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae712Open in IMG/M
3300018013|Ga0187873_1185277All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300018060|Ga0187765_10569639All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300018433|Ga0066667_11715814All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300018433|Ga0066667_11935048All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300018482|Ga0066669_10190654All Organisms → cellular organisms → Bacteria → Acidobacteria1558Open in IMG/M
3300019362|Ga0173479_10544152All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300020583|Ga0210401_10918291All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300021171|Ga0210405_10085464All Organisms → cellular organisms → Bacteria2487Open in IMG/M
3300021171|Ga0210405_10859237All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300021171|Ga0210405_11101699All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300021181|Ga0210388_11391837All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300021403|Ga0210397_10096801All Organisms → cellular organisms → Bacteria1986Open in IMG/M
3300021405|Ga0210387_10501745All Organisms → cellular organisms → Bacteria → Acidobacteria1078Open in IMG/M
3300021559|Ga0210409_11462999All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300022516|Ga0224542_1054808All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300023030|Ga0224561_1007005All Organisms → cellular organisms → Bacteria → Acidobacteria839Open in IMG/M
3300025898|Ga0207692_11107371All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300025905|Ga0207685_10127814All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300026095|Ga0207676_10923522All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300026317|Ga0209154_1037624All Organisms → cellular organisms → Bacteria → Acidobacteria2200Open in IMG/M
3300026320|Ga0209131_1095214All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300026334|Ga0209377_1254024All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300026514|Ga0257168_1152169All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300026557|Ga0179587_10273194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1085Open in IMG/M
3300027545|Ga0209008_1097735All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300027587|Ga0209220_1097647All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300027643|Ga0209076_1026386All Organisms → cellular organisms → Bacteria → Acidobacteria1602Open in IMG/M
3300027660|Ga0209736_1089966All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300027855|Ga0209693_10029560All Organisms → cellular organisms → Bacteria2665Open in IMG/M
3300027862|Ga0209701_10088667All Organisms → cellular organisms → Bacteria → Acidobacteria1943Open in IMG/M
3300027875|Ga0209283_10419088All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300027882|Ga0209590_10347852All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium955Open in IMG/M
3300027903|Ga0209488_10041677All Organisms → cellular organisms → Bacteria → Acidobacteria3365Open in IMG/M
3300027903|Ga0209488_10235281All Organisms → cellular organisms → Bacteria → Acidobacteria1375Open in IMG/M
3300027908|Ga0209006_10056038All Organisms → cellular organisms → Bacteria3535Open in IMG/M
3300027911|Ga0209698_10860506All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300028016|Ga0265354_1002005All Organisms → cellular organisms → Bacteria → Acidobacteria2664Open in IMG/M
3300028536|Ga0137415_11247386All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300031231|Ga0170824_114590913All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031474|Ga0170818_109326854All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031564|Ga0318573_10753708All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300031715|Ga0307476_10154845All Organisms → cellular organisms → Bacteria → Acidobacteria1648Open in IMG/M
3300031720|Ga0307469_10573801All Organisms → cellular organisms → Bacteria → Acidobacteria1003Open in IMG/M
3300031720|Ga0307469_12130754All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300031720|Ga0307469_12233058All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300031720|Ga0307469_12478502All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031736|Ga0318501_10493326All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300031820|Ga0307473_10295444All Organisms → cellular organisms → Bacteria → Acidobacteria1017Open in IMG/M
3300031835|Ga0318517_10288964All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300031945|Ga0310913_10170159All Organisms → cellular organisms → Bacteria1513Open in IMG/M
3300032076|Ga0306924_11829936All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300032180|Ga0307471_103034461All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300032205|Ga0307472_100318525All Organisms → cellular organisms → Bacteria → Acidobacteria1260Open in IMG/M
3300032205|Ga0307472_102427829All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300032954|Ga0335083_11391154All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300032955|Ga0335076_11698222All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil23.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.97%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.07%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.07%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.35%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.62%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.90%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.17%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.17%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.45%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.45%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.45%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.45%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.45%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.72%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.72%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.72%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.72%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005881Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022516Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 30-34EnvironmentalOpen in IMG/M
3300023030Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028016Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10926770723300000955SoilMSDPVQESLPRLKRLLPKLKRRRIGVLGDLMLDRYL
JGI12269J14319_1026429133300001356Peatlands SoilMIFATEKRQMPKDLANSIPRLTRLLPRFRKMHIGVLGDLMLDRYLW
JGI12053J15887_1043488213300001661Forest SoilMPANIADAVPRLKRWIPRLRGKRIGVLGDLMLDRYLW
JGI25382J43887_1036557823300002908Grasslands SoilMARMSSNISHSVPRLKRWLPRLRGKRIGVLGDLMLDRYLWGT
JGI25616J43925_1019936213300002917Grasslands SoilMPLNLAESIPRLKRLIPRLRGKRIAVLGDLMLDHYLWGTAS
Ga0062387_10005400533300004091Bog Forest SoilMPTNISEFIPRLKRLIPKLRGKRIGVLGDLMLDRYLWGTAT
Ga0062387_10166613213300004091Bog Forest SoilMAAKTNESVVRLRRVIPRMRGKRIGVLGDLMLDRYMWGTA
Ga0066672_1042614413300005167SoilMPANIADAVPRLKRLIPRLRGKRIGVLGDLMLDRYLWGTA
Ga0066690_1004477313300005177SoilMVTNIADAVPRLKRLIPRLRGKRIGMLGDLMLDRYLWGTAS
Ga0068868_10231178613300005338Miscanthus RhizosphereMPSSSTDSIAKLKRLVPRLRGRHIGVVGDLMLDRYLWGTAS
Ga0070711_10104734223300005439Corn, Switchgrass And Miscanthus RhizosphereMPKSGSDTSSSPLAKLKRLVPRLKGQRIGVVGDLMLDRYLWGTASR
Ga0066689_1095427633300005447SoilMARSNSASIANLKRLIPRIAGKRIGVLGDLMLDRYLWGTAS
Ga0066707_1028445433300005556SoilMSTNIADSVARLKRLIPRLRGKRMGVLGDLMLDRYLWGTAS
Ga0066654_1063281213300005587SoilMPTNIADALPRLKRLIPRLRGKRIGVLGDPMLDRYL
Ga0066706_1045912733300005598SoilMATNIADAVPRLKRLIPRLRGKRIGMLGDLMLDRYLWGT
Ga0070762_1057162913300005602SoilMPTNISESISRLKRLIPKLRGKRMGVLGDLMLDRYLWGTA
Ga0070763_1026140933300005610SoilMPTNTPEYLPRLKKLIPRLRGKRIGVLGDLMLDRYLWGTA
Ga0070763_1099566623300005610SoilMPIQIAEYLPRLKKLIPKLRGKHIGVLGDLMLDRYLWGT
Ga0075294_101460713300005881Rice Paddy SoilMSFAIADSVPRLKRLLPRLRGLRAGVFGDLMLDRYLWGTATR
Ga0066656_1052577933300006034SoilMSTNIADSVARLKRLIPRLRGKRMGVLGDLMLDRY
Ga0066652_10031860933300006046SoilMTTHFAHSVPRLKRLLPRLRGKRIGVLGDLMLDRY
Ga0075024_10029660233300006047WatershedsMPTKTVDAMARLKRLIPRLRGKRVGVLGDLMLDRYL
Ga0075029_10134102433300006052WatershedsMQNPVAESLPRLKRLLPRLKGHRIGVLGDLMLDRYL
Ga0070715_1011385013300006163Corn, Switchgrass And Miscanthus RhizosphereMPTAVADSLPRLKRLLPRLKGRRIGVLGDLMLDRYLW
Ga0070715_1037699143300006163Corn, Switchgrass And Miscanthus RhizosphereMNLEYASLVPRLKRLLPRFRKIHIAVLGDLMLDRYL
Ga0070715_1091453513300006163Corn, Switchgrass And Miscanthus RhizosphereMLNPVAESLPRLRRLLPRLKGRRIGVLGDLMLDRYLWG
Ga0070716_10156766223300006173Corn, Switchgrass And Miscanthus RhizosphereMNLEYASLVPRLKRLLPRFRKIHIAVLGDLMLDRYLWGTA
Ga0075014_10034124213300006174WatershedsMPTQLHDSVPRLKRLIPRLSGHRIGVLGDLMLDRYLWGTAS
Ga0075434_10038992313300006871Populus RhizosphereMSDPVQESLPRLKRLLPKLKSRRIGVLGDLMLDRY
Ga0075424_10208098913300006904Populus RhizosphereMPNPAESLPRLKRLLPRLKGKRIGVVGDLMLDRYLWGTA
Ga0079219_1026986013300006954Agricultural SoilMPTTDIAESIPRLKKLISKLRGKRMGVLGDLMLDRYLWGT
Ga0099794_1051493933300007265Vadose Zone SoilMPANIADAVPRLKRWLPRLRAKRIGVLGDLMLDRYLWGTASRLS
Ga0105248_1164638813300009177Switchgrass RhizosphereMLNLVKESMSRLKRFLPKLKGHHFGILGDLMLDRYLWGDASKL
Ga0126373_1023664733300010048Tropical Forest SoilMRSELAKSIPRLKRLLPRFRKLRLGVLGDLMLDRYVWGNA
Ga0134082_1032585423300010303Grasslands SoilMATNIADAVPRLKRLISRLRGKRVGVLGDVMLDRYLWG
Ga0074046_1088198833300010339Bog Forest SoilMSPDFANSIPRIKRLLPRFRKIRIGVLGDLMLDRYLWGTA
Ga0074044_1017784113300010343Bog Forest SoilMPTNLSEYLPRLKKLIPKLHGKRMGVLGDLMLDRYLWGTATRL
Ga0126376_1055174413300010359Tropical Forest SoilMTPPIVDSVPRLKRLLPRLRGKRIGVLGDLMLDRYL
Ga0126377_1046247113300010362Tropical Forest SoilMARLPRFSVRNLKRIVPHIKGKRIGVLGDLMLDRYLWGTAS
Ga0126381_10342553833300010376Tropical Forest SoilVPIHTIQMSKASRESISKLKRLLPRLQGRRIGVLGDVMLDRYLWGT
Ga0126383_1157487613300010398Tropical Forest SoilMNPEYASLVPGLKRLLPRFRKIHIGVLGDLMLDRYLWG
Ga0126383_1297345033300010398Tropical Forest SoilMTPLIADSVPRLKRLLPRLRGKRIDVLGDLMLDRYL*
Ga0137392_1038698613300011269Vadose Zone SoilMVTNIADAVPRLKRLIPRLRGKRIGVLGDLMLDRYRWGTASRL
Ga0137392_1057085613300011269Vadose Zone SoilMPTNIDDAVPRLKRWIPRLRGKRIGVLGDLMLDRYLW
Ga0137391_1055138533300011270Vadose Zone SoilMFANIADAVPRLKRWIPRLRGKRIGVLGDVMLDRYLWGT
Ga0137363_1000356113300012202Vadose Zone SoilMTANIADAVPRLKRLIPRLRGKRIGVLGDLMLDRYLW
Ga0137363_1014939543300012202Vadose Zone SoilMATNIADAVPRLKRLIPRLCGKRIGVLGDLMLDRY
Ga0137363_1033091133300012202Vadose Zone SoilMSTNIADSVARLKRLIPRLRGKRMGVLGDFMLDRY
Ga0137363_1168958723300012202Vadose Zone SoilMARMSNNISDSVPRLKRWLPRLRGKRIGVLGDLMLDRYLWGTASR
Ga0137399_1108667913300012203Vadose Zone SoilMSTNIADAVPRLKRWIPRLRGKRIGVLGDLMLDRYLWGTA
Ga0137399_1153957123300012203Vadose Zone SoilMTTNIAEAVPRLKRLIPRLRGKRIGVLGDMMLDRYLWG
Ga0137362_1089251813300012205Vadose Zone SoilMTNNIGESVPRLKRLIPRLRGKRIGVLGDLMLDRYLWGTAS
Ga0137362_1160130313300012205Vadose Zone SoilMSTNIADSVARLKRLIPRLRGKRMGVLGDLMLDRYLWGTA
Ga0137380_1121397713300012206Vadose Zone SoilMSSNIATAVPRLKRLIPRLRGKRIGVLGDLMLDRYLWGTAS
Ga0137380_1131473713300012206Vadose Zone SoilMASPPADPMPRLKRLLPRLKGKRIGVLGDLMLDRYLWGTAT
Ga0137378_1039982713300012210Vadose Zone SoilMSTSIADAVPRLKRLIPRLRGKPIGVLGDLMLDRYLWGTASR
Ga0137361_1049375733300012362Vadose Zone SoilMARMSSNISDSVPRLKRWLPRLRGKRIGVLGDLML
Ga0137390_1154176433300012363Vadose Zone SoilMPLNLAECIPRLKRLVPRLRGKRIAVLGDLMLDRYL
Ga0137358_1001677773300012582Vadose Zone SoilLTPPLLAGSLPRLKRLLPRLKGRRIGVLGDLMLDRYLWGTATRL
Ga0137394_1065598933300012922Vadose Zone SoilMARSIPYSILNLKRLIPRISGKRIGVLGDLMLDRYLW
Ga0137359_1004334663300012923Vadose Zone SoilMPPKRDAHIPRLKGLIPRLRGKRIGVLGDLMLDRYLWGT
Ga0137359_1004885173300012923Vadose Zone SoilLTPPLLADSLPRLKRILPRLKARRIGVLGDLMLDRYLWG
Ga0137359_1054308133300012923Vadose Zone SoilMATNIADAVPRLKRLIPRLCGKRIGVLGDLMLDRYLWG
Ga0137419_1031439933300012925Vadose Zone SoilMPANIADAVPRLKRLIPRLRGKRIGVLGDLMLDRYLWGT
Ga0153915_1069632333300012931Freshwater WetlandsMSFVLADSVPRLKRLLPRLRGLRAGVFGDLMLDRYLWGTATRLSP
Ga0126375_1104128413300012948Tropical Forest SoilMTISSSSSPARLKRLIARFRGHRIGVVGDLMLDRYLW
Ga0164303_1013910413300012957SoilMPSSSTDSIAKLKRLVPRLRGRHIGVVGDLMLDRYLWGTASRL
Ga0164301_1138976613300012960SoilMQNPVAESLPRLKRLLSRLKGHRIGVLGDMMLDRYLW
Ga0181537_1082935613300014201BogMPTNLSEFVPRLKRLVPRLRGKRVGVVGDVMLDRYLW
Ga0163163_1289155623300014325Switchgrass RhizosphereMPSSSTDSIAKLKRLVPRLRGRHIGVVGDLMLDRYLWGTASR
Ga0157379_1092870223300014968Switchgrass RhizosphereMSNLPAHLAQSTARLKRLVPRLRGKRIGVVGDLMLDR
Ga0157376_1223584613300014969Miscanthus RhizosphereMPNFPAESLPRLKRLLPRLKGRRIGVLGDLMLDRYLWGTASR
Ga0137418_1032613043300015241Vadose Zone SoilMARSNPASIANLKRLIPRIAGKRIGVLGDLMLDRYLWGTASRL
Ga0137403_1052727633300015264Vadose Zone SoilMARMSNNISDSVPRLKRWLPRLRGKRIGVLGDLMLDRYLWGT
Ga0182041_1009232113300016294SoilMSQPVRESLPRLKRLLGRLPGRRLGVLGDLMLDRY
Ga0182041_1124192133300016294SoilMKAEFRSSIPRLRRLLPRFRKTRIAVLGDLMLDRYLWGMA
Ga0187825_1036173123300017930Freshwater SedimentLAKTTSLAKLDRLVQRLSGRRAGVVGDLMLDRYVW
Ga0187821_1003294613300017936Freshwater SedimentMSTNIVESIPRLKRLIPKLRGKRMGVLGDLMLDRYLWGT
Ga0187781_1145787223300017972Tropical PeatlandMKSERPQITQQLKRLIPRFRKLRIGVLGDVMLDRYVWG
Ga0187782_1093874823300017975Tropical PeatlandMTNLLTEAVPRLKRLIPRLRGKRIGVVGDLMLDRYLWG
Ga0187804_1023496733300018006Freshwater SedimentMKSHSPSNLPRLKRLLPRFRKARVAVLGDLMLDHYLWG
Ga0187810_1026065313300018012Freshwater SedimentMNPDFASSILRLKRLLPRFRKLRIGVLGDAMLDRYVWGHANRL
Ga0187873_118527713300018013PeatlandMSTNLSEFVPRLKRLVPRLRGNRVGVVGDVMLDRYLWGT
Ga0187765_1056963913300018060Tropical PeatlandMTFDPASSVPRLKRLLPRFRRLRMAVLGDAMLDRYVWGHAN
Ga0066667_1171581433300018433Grasslands SoilMPNLVADSLPRLKRLLPRLKGHRLGVLGDLMLDRYLWGTA
Ga0066667_1193504813300018433Grasslands SoilMSNPVAESLPRLKRLLPRLKGHRIGVIGDLMLYRYMWV
Ga0066669_1019065433300018482Grasslands SoilMSTNIADAVPRLKRLIPRLRGKPIGVLGDLMLDRYLWGTASRLS
Ga0173479_1054415213300019362SoilMTNLIRESLPRLKRLVPKLKGQRIGVLGDLMLDRYLWG
Ga0210401_1091829133300020583SoilMTGRPLRENPMSATLAESVPRLKRIVPRMRGKRVGVVGDLMLDRYLWGTASR
Ga0210405_1008546413300021171SoilMNLEYASLVPRLKRLLPRFRKIHIAVLGDLMLDRYLWGTANRL
Ga0210405_1085923713300021171SoilMTTSHTDLASSVARLKRLVPRLRGKRVGVVGDLMLDRYL
Ga0210405_1110169933300021171SoilMNPDYASFIPRLKRLLPRFRNIHIGVLGDLMLDRYLW
Ga0210388_1139183713300021181SoilMTPLPTDLAQSVARLKRLVPRLRGKRIGVVGDLMLDRYLWG
Ga0210397_1009680143300021403SoilMNLEYASLVPRLKRLLPRFRKIHIAVLGDLMLDRYLW
Ga0210387_1050174513300021405SoilMTHNLPADMKTQIANSGPRLKRLLPRFRKLRIGVLGDLMLDRYVWG
Ga0210409_1146299923300021559SoilMSASTPAARLKRLIRRLRGKRLAVLGDLMLDRYLW
Ga0224542_105480823300022516SoilMSTDFANSIPRLKRLLPRFRKMHIGVLGDLMLDRYLWGTADRLSAD
Ga0224561_100700533300023030SoilMPTNISESIPRLKRLIPKLRGKRIGVLGDLMLDRYLWG
Ga0207692_1110737133300025898Corn, Switchgrass And Miscanthus RhizosphereMPTAVADSLPRLKRLLPRLKGRRIGVLGDLMLDRYLWGTA
Ga0207685_1012781433300025905Corn, Switchgrass And Miscanthus RhizosphereMSTNIAESIPRLKRQIPKLRGKRMGVLGDLMLDRYLWGTATRLS
Ga0207676_1092352233300026095Switchgrass RhizosphereMPDPVQESPPRLKRLLPKLKSRRIGVLGDLMLDRYLWGTAS
Ga0209154_103762413300026317SoilMATNIADAVPRLKRLIPRLRDKRIGVLGDLMLDRY
Ga0209131_109521433300026320Grasslands SoilMKSELANVVPRLKRLLPRFRKLRIGVLGDLMVDRYVWG
Ga0209377_125402423300026334SoilMSTNIADSVARLKRLIPRLRGKRMGVLGDLMLDRYLWG
Ga0257168_115216913300026514SoilLSSLPVTESLPRLKRLLPRLKGRWIGVLGDLMLDRYLWGT
Ga0179587_1027319413300026557Vadose Zone SoilLSTLPLAESLPRLKRLLPRLKGRWIGVLGDLMLDRYLW
Ga0209008_109773533300027545Forest SoilMTTSHTDLASSVARLKRLVPRLRGKRIGVVGDLMLDRYLW
Ga0209220_109764733300027587Forest SoilMSTNIADAVPRLKRWIPRLRGKRIGVLGDLMLDRYLWG
Ga0209076_102638633300027643Vadose Zone SoilMSTNIADAVPRLKRWIPRLRGKRIGVLGDLMLDRYLWGTASR
Ga0209736_108996633300027660Forest SoilMPTSTSEFIPRLKRMIPKLRGKRMGVLGDLMLDRYLWGTATRLS
Ga0209693_1002956053300027855SoilMPTNIADSVPRLKRLVPRLRGKRLGVLGDLMLDRYLWGTASRLK
Ga0209701_1008866743300027862Vadose Zone SoilMSINIADAVPRLKRLIARLRGKRIGVLGDLMLDRYLW
Ga0209283_1041908813300027875Vadose Zone SoilMPLNLAECIPRLKRLVPRLRGKRIAVLGDLMLDRYLW
Ga0209590_1034785213300027882Vadose Zone SoilMATNIADAVPRLKRLIPRLRGKRIGVLGDLMLDRYLWGT
Ga0209488_1004167713300027903Vadose Zone SoilMVTNIADAIPRLKRLIPRLRGKRIGVLGDLMLDRYLWGTAS
Ga0209488_1023528133300027903Vadose Zone SoilMVTNIADAVPRLKRLIPRLRGKRIGVLGDLMLDRYLWGTAS
Ga0209006_1005603813300027908Forest SoilMSTSPTDLAQSAARLKRLVPRLHGKRIGVVGDLMLDRYLWG
Ga0209698_1086050633300027911WatershedsMTINLADSVPRLKRLIPRLRGKRIGVLGDLMLDRYLW
Ga0265354_100200543300028016RhizosphereMPTNISESIPRLKRLIPKLRGKRIGVLGDLMLDRYLW
Ga0137415_1124738613300028536Vadose Zone SoilMPNPVADSLPRLKRLLPRLKGRRIGVLGDLMLDRYLW
Ga0170824_11459091323300031231Forest SoilMPTNLAEYLPRLKKLIPKLRGKRMGVLGDLMLDRYL
Ga0170818_10932685423300031474Forest SoilMKSQLSGSVPRLLRLIPRFRKIRIGVLGDLMLDRYLWG
Ga0318573_1075370833300031564SoilMTHLVKESLPRLKRLLPRLKGRRIGVLGDLMLDRYLWGD
Ga0307476_1015484533300031715Hardwood Forest SoilMPTNISESIPRLKKLIPKLRGKRIGVLGDLMLDRYLWGE
Ga0307469_1057380133300031720Hardwood Forest SoilMPTAVSDSVPRLKRWLPRLRGKRIGVLGDLMLDRYLWGTA
Ga0307469_1213075413300031720Hardwood Forest SoilMPRSDSSPISNLKRLIPRIKGKRIGVLGDLMLDRYLWGKDTK
Ga0307469_1223305813300031720Hardwood Forest SoilMARSNPASIANLKRLIPRIAGKRIGVLGDLMLDRYLW
Ga0307469_1247850223300031720Hardwood Forest SoilMSINIADAVPRLKRLIPRLRGKRIGVLGDLMLDRYLWGTAS
Ga0318501_1049332633300031736SoilMSQPLRESLPRLKRLLERLPRRRIGVLGDLMLDRYLWGTASR
Ga0307473_1029544413300031820Hardwood Forest SoilMSANLSESVPRLKRLVPRMRGKRIAVVGDLMLDRYLW
Ga0318517_1028896413300031835SoilMTTPFAHSVPRLKRLLPRLRGKQMGVLGDLMLDRYLWGT
Ga0310913_1017015943300031945SoilMKADFRSSIPRLKRLLPRFRKIRIAVLGDLMLDRYLWGVA
Ga0306924_1182993613300032076SoilMFPSVGESLPRLKRLLRRLESRRIGVLGDLMLDRYLWG
Ga0307471_10303446113300032180Hardwood Forest SoilMSINIADAVPRLKRLIPRLRGKRIGVLGDLMLDRY
Ga0307472_10031852513300032205Hardwood Forest SoilMTTANPAPRLKRLIPRFRGRRMGVVGDLMLDRYVWGHASR
Ga0307472_10242782913300032205Hardwood Forest SoilVTIYGKSLMKSQLSDSVPRLLRLIPRFRKIRIGVLGDLMLDRYL
Ga0335083_1139115413300032954SoilMTTDITESIPRLKRLIPKLRGKRMGVLGDLMLDRY
Ga0335076_1169822233300032955SoilMDILIREAIPKLKRALPRLKGRRIGVLGDAMLDRYW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.