Metagenome Family F056209

Basic Information
Family ID	F056209
Family Type	Metagenome
Number of Sequences	137
Average Sequence Length	42 residues
Representative Sequence	SACSLVGFWAGLGWLVLVCCERKTLLAGWFGLAETNKRTG
Number of Associated Samples	55
Number of Associated Scaffolds	137

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	11.67 %
% of genes near scaffold ends (potentially truncated)	56.20 %
% of genes from short scaffolds (< 2000 bps)	86.86 %
Associated GOLD sequencing projects	55
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Most Common Taxonomy
Group	Unclassified (78.102 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (99.270 % of family members)
Environment Ontology (ENVO)	Unclassified (99.270 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (99.270 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 137 Family Scaffolds
PF02535	Zip	0.73
PF00036	EF-hand_1	0.73
PF00809	Pterin_bind	0.73

COG ID	Name	Functional Category	% Frequency in 137 Family Scaffolds
COG0428	Zinc transporter ZupT	Inorganic ion transport and metabolism [P]	0.73

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
All Organisms	root	All Organisms	21.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
cellular organisms	root	All Organisms → cellular organisms	21.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	21.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	21.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	21.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	21.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	21.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	19.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	19.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	19.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	19.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	19.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	19.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	19.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	19.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	19.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	19.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	10.95 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	8.03 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	2.92 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	6.57 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	2.92 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.73 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	6.57 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	2.92 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.73 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Tripsacinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae	3.65 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	2.92 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	2.92 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.73 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Zea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	3.65 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	2.92 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	2.92 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.73 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	3.65 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	2.92 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	2.92 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.73 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.73 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005459\|Ga0068867_101136120	Not Available	715	Open in IMG/M
3300015267\|Ga0182122_1050967	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	556	Open in IMG/M
3300015268\|Ga0182154_1064985	Not Available	522	Open in IMG/M
3300015269\|Ga0182113_1035920	Not Available	678	Open in IMG/M
3300015274\|Ga0182188_1060744	Not Available	506	Open in IMG/M
3300015275\|Ga0182172_1031933	Not Available	647	Open in IMG/M
3300015281\|Ga0182160_1049982	Not Available	586	Open in IMG/M
3300015282\|Ga0182124_1081679	Not Available	504	Open in IMG/M
3300015289\|Ga0182138_1062030	Not Available	561	Open in IMG/M
3300015291\|Ga0182125_1030552	Not Available	699	Open in IMG/M
3300015292\|Ga0182141_1013810	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	866	Open in IMG/M
3300015292\|Ga0182141_1025188	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	737	Open in IMG/M
3300015294\|Ga0182126_1018245	Not Available	811	Open in IMG/M
3300015298\|Ga0182106_1077055	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	550	Open in IMG/M
3300015300\|Ga0182108_1067374	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	580	Open in IMG/M
3300015302\|Ga0182143_1003035	Not Available	1350	Open in IMG/M
3300015303\|Ga0182123_1020401	Not Available	784	Open in IMG/M
3300015303\|Ga0182123_1038481	Not Available	660	Open in IMG/M
3300015303\|Ga0182123_1055814	Not Available	595	Open in IMG/M
3300015303\|Ga0182123_1083122	Not Available	530	Open in IMG/M
3300015305\|Ga0182158_1007712	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1052	Open in IMG/M
3300015305\|Ga0182158_1037400	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	682	Open in IMG/M
3300015308\|Ga0182142_1049104	Not Available	652	Open in IMG/M
3300015308\|Ga0182142_1052911	Not Available	638	Open in IMG/M
3300015314\|Ga0182140_1042639	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	682	Open in IMG/M
3300015321\|Ga0182127_1010635	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	1042	Open in IMG/M
3300015321\|Ga0182127_1049741	Not Available	670	Open in IMG/M
3300015322\|Ga0182110_1011433	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1019	Open in IMG/M
3300015322\|Ga0182110_1095246	Not Available	548	Open in IMG/M
3300015323\|Ga0182129_1026667	Not Available	778	Open in IMG/M
3300015323\|Ga0182129_1059449	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	616	Open in IMG/M
3300015341\|Ga0182187_1148827	Not Available	561	Open in IMG/M
3300015341\|Ga0182187_1163070	Not Available	542	Open in IMG/M
3300015342\|Ga0182109_1091312	Not Available	703	Open in IMG/M
3300015343\|Ga0182155_1011622	Not Available	1346	Open in IMG/M
3300015343\|Ga0182155_1012766	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1310	Open in IMG/M
3300015343\|Ga0182155_1073591	Not Available	752	Open in IMG/M
3300015343\|Ga0182155_1147974	Not Available	588	Open in IMG/M
3300015343\|Ga0182155_1167202	Not Available	562	Open in IMG/M
3300015344\|Ga0182189_1062243	Not Available	811	Open in IMG/M
3300015344\|Ga0182189_1094867	Not Available	698	Open in IMG/M
3300015344\|Ga0182189_1105284	Not Available	672	Open in IMG/M
3300015344\|Ga0182189_1222797	Not Available	507	Open in IMG/M
3300015345\|Ga0182111_1074220	Not Available	790	Open in IMG/M
3300015345\|Ga0182111_1085167	Not Available	751	Open in IMG/M
3300015345\|Ga0182111_1087837	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	743	Open in IMG/M
3300015345\|Ga0182111_1181134	Not Available	566	Open in IMG/M
3300015346\|Ga0182139_1011970	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1439	Open in IMG/M
3300015346\|Ga0182139_1039344	Not Available	990	Open in IMG/M
3300015346\|Ga0182139_1044021	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	952	Open in IMG/M
3300015346\|Ga0182139_1060123	Not Available	853	Open in IMG/M
3300015346\|Ga0182139_1075057	Not Available	788	Open in IMG/M
3300015346\|Ga0182139_1117565	Not Available	668	Open in IMG/M
3300015346\|Ga0182139_1158653	Not Available	596	Open in IMG/M
3300015347\|Ga0182177_1007566	Not Available	1726	Open in IMG/M
3300015347\|Ga0182177_1028535	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	1114	Open in IMG/M
3300015347\|Ga0182177_1049012	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	921	Open in IMG/M
3300015347\|Ga0182177_1237976	Not Available	511	Open in IMG/M
3300015351\|Ga0182161_1002625	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2344	Open in IMG/M
3300015351\|Ga0182161_1090264	Not Available	770	Open in IMG/M
3300015351\|Ga0182161_1099792	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	741	Open in IMG/M
3300015351\|Ga0182161_1130873	Not Available	668	Open in IMG/M
3300015351\|Ga0182161_1217826	Not Available	546	Open in IMG/M
3300015351\|Ga0182161_1243120	Not Available	522	Open in IMG/M
3300015351\|Ga0182161_1260609	Not Available	507	Open in IMG/M
3300015355\|Ga0182159_1065752	Not Available	1013	Open in IMG/M
3300015355\|Ga0182159_1080222	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	937	Open in IMG/M
3300015355\|Ga0182159_1138336	Not Available	751	Open in IMG/M
3300015355\|Ga0182159_1148676	Not Available	729	Open in IMG/M
3300015355\|Ga0182159_1199782	Not Available	643	Open in IMG/M
3300015355\|Ga0182159_1248892	Not Available	585	Open in IMG/M
3300015355\|Ga0182159_1353785	Not Available	500	Open in IMG/M
3300015361\|Ga0182145_1083095	Not Available	669	Open in IMG/M
3300017404\|Ga0182203_1104166	Not Available	584	Open in IMG/M
3300017407\|Ga0182220_1081692	Not Available	546	Open in IMG/M
3300017409\|Ga0182204_1026408	Not Available	788	Open in IMG/M
3300017410\|Ga0182207_1043814	Not Available	795	Open in IMG/M
3300017410\|Ga0182207_1118502	Not Available	577	Open in IMG/M
3300017410\|Ga0182207_1122491	Not Available	570	Open in IMG/M
3300017411\|Ga0182208_1057261	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	648	Open in IMG/M
3300017411\|Ga0182208_1107429	Not Available	534	Open in IMG/M
3300017411\|Ga0182208_1115690	Not Available	521	Open in IMG/M
3300017411\|Ga0182208_1126594	Not Available	506	Open in IMG/M
3300017411\|Ga0182208_1129945	Not Available	501	Open in IMG/M
3300017413\|Ga0182222_1094865	Not Available	520	Open in IMG/M
3300017415\|Ga0182202_1010871	Not Available	1091	Open in IMG/M
3300017415\|Ga0182202_1057278	Not Available	668	Open in IMG/M
3300017424\|Ga0182219_1024052	Not Available	871	Open in IMG/M
3300017424\|Ga0182219_1064817	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	639	Open in IMG/M
3300017424\|Ga0182219_1103097	Not Available	554	Open in IMG/M
3300017425\|Ga0182224_1122702	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	555	Open in IMG/M
3300017425\|Ga0182224_1137449	Not Available	534	Open in IMG/M
3300017425\|Ga0182224_1158590	Not Available	509	Open in IMG/M
3300017430\|Ga0182192_1024692	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	973	Open in IMG/M
3300017430\|Ga0182192_1139175	Not Available	543	Open in IMG/M
3300017433\|Ga0182206_1008348	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	1234	Open in IMG/M
3300017436\|Ga0182209_1073331	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	664	Open in IMG/M
3300017436\|Ga0182209_1103707	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	595	Open in IMG/M
3300017436\|Ga0182209_1109236	Not Available	585	Open in IMG/M
3300017438\|Ga0182191_1164492	Not Available	521	Open in IMG/M
3300017442\|Ga0182221_1057756	Not Available	703	Open in IMG/M
3300017442\|Ga0182221_1096429	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	601	Open in IMG/M
3300017442\|Ga0182221_1122644	Not Available	558	Open in IMG/M
3300017442\|Ga0182221_1166310	Not Available	506	Open in IMG/M
3300017443\|Ga0182193_1087938	Not Available	664	Open in IMG/M
3300017443\|Ga0182193_1114640	Not Available	607	Open in IMG/M
3300017443\|Ga0182193_1143463	Not Available	562	Open in IMG/M
3300017680\|Ga0182233_1087399	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	569	Open in IMG/M
3300017683\|Ga0182218_1015687	Not Available	990	Open in IMG/M
3300017683\|Ga0182218_1061614	Not Available	666	Open in IMG/M
3300017683\|Ga0182218_1084021	Not Available	607	Open in IMG/M
3300017684\|Ga0182225_1039759	Not Available	749	Open in IMG/M
3300017684\|Ga0182225_1056325	Not Available	673	Open in IMG/M
3300017685\|Ga0182227_1021423	Not Available	1113	Open in IMG/M
3300017685\|Ga0182227_1073947	Not Available	633	Open in IMG/M
3300017685\|Ga0182227_1132940	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	507	Open in IMG/M
3300017686\|Ga0182205_1090910	Not Available	624	Open in IMG/M
3300017690\|Ga0182223_1016103	Not Available	875	Open in IMG/M
3300017690\|Ga0182223_1067679	Not Available	596	Open in IMG/M
3300017690\|Ga0182223_1073871	Not Available	582	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	99.27%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.73%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	99.27%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.73%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	99.27%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.73%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	99.27%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.73%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068867_1011361201	3300005459	Miscanthus Rhizosphere	VLACSLVGFWAGLGWLVLVCCERKTLLAGWFGLAETNKRTG*
Ga0182122_10509672	3300015267	Miscanthus Phyllosphere	MPTRYWACSLVGAGAGLGWLVLVFYERKTLLASWFGLAETNKRTG*
Ga0182154_10649851	3300015268	Miscanthus Phyllosphere	ACSLVSFWAGLGWLVLVYCERKPLLADWFGLAETNKRTG*
Ga0182113_10359201	3300015269	Miscanthus Phyllosphere	LAYSLVGFWAGLGWLVLVFYERKTLLAGWFRLTETNKRTG*
Ga0182188_10578892	3300015274	Miscanthus Phyllosphere	MTAHFSLIYRACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTG*
Ga0182188_10607441	3300015274	Miscanthus Phyllosphere	LLVGFWASLGWLVLVYCERKTLLAGWFGLAETNKR
Ga0182172_10319331	3300015275	Miscanthus Phyllosphere	LVGVCAGLGWLVLVFCERKILLAGWFELAVTNNRTG*
Ga0182160_10499821	3300015281	Miscanthus Phyllosphere	LACSLVGFWVGLGWLVLVCCERKTLLAGWFGLAETNKRTG*
Ga0182124_10392841	3300015282	Miscanthus Phyllosphere	SLVGAGAGLDWLVLVFCERKILLAGWFGLAETNQRTG*
Ga0182124_10816792	3300015282	Miscanthus Phyllosphere	LVGFWADLGWLVLVYCERKILLAGWFGLAETNKRTD*
Ga0182138_10620301	3300015289	Miscanthus Phyllosphere	VACSLVGFWASLGWLVLVCCERKTLLAGWFELAETNKRTG*
Ga0182125_10305521	3300015291	Miscanthus Phyllosphere	LVGFWAGLGWLVLVCCESKTLLADWFGLAETNKRTG*
Ga0182141_10138102	3300015292	Miscanthus Phyllosphere	LEGIWACSLVGAGAGLGWLVLVLCERKILLVGWFGLAETNKRTG*
Ga0182141_10251881	3300015292	Miscanthus Phyllosphere	GFWAGLGWLVLVCCERKTLLAGWFGLVETNKRIG*
Ga0182126_10182451	3300015294	Miscanthus Phyllosphere	CSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTG*
Ga0182157_10794771	3300015296	Miscanthus Phyllosphere	ACSLVGFWAGLGWLVLVYCERKTLLADWFGLAETIKQTGLV*
Ga0182106_10770552	3300015298	Miscanthus Phyllosphere	SLVGAGAGLGWLVLVFCERKTLLAGRFGLAETNKRTG*
Ga0182108_10673741	3300015300	Miscanthus Phyllosphere	CSLVGFWAGLGWLVLVYCERKTLLAGWFGLAETNKRTDHLCHKC*
Ga0182143_10030353	3300015302	Miscanthus Phyllosphere	VKDKECWACSLVGVSAGLGWLVLIFCERKTLLAGWFGLAEINKRTG*
Ga0182123_10204011	3300015303	Miscanthus Phyllosphere	SACSLVGFWAGLSWLVLVCCERKTLLAGWFGLAETNKRTG*
Ga0182123_10384811	3300015303	Miscanthus Phyllosphere	ACSLVGFWAGLGWLVLVYCERKILLANWFGLAETNK*
Ga0182123_10558141	3300015303	Miscanthus Phyllosphere	EQGSPCSHSACSLVSFWADLSWLVLVYCERKTLLADWFGLTEINKRTG*
Ga0182123_10831221	3300015303	Miscanthus Phyllosphere	LVGFWAGLDWLVLVYCERKILLAGWFRLAETNKRTGCLSLLP
Ga0182112_10159023	3300015304	Miscanthus Phyllosphere	MTPLYAQWACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTV
Ga0182158_10077123	3300015305	Miscanthus Phyllosphere	MACSLVGFWVGLDWLVLVYCERKTLLTSWFGLAETNRRTIRAQQ*
Ga0182158_10374001	3300015305	Miscanthus Phyllosphere	CSLVGFWAGLDWLVLVCCERKILLTDWFGLAETNQRTG*
Ga0182142_10491042	3300015308	Miscanthus Phyllosphere	MESSACSLVGFWAGLGWLVLVYCERKTLLVGWFGLAETNKRTGCI*
Ga0182142_10529111	3300015308	Miscanthus Phyllosphere	LACSLVGFWAGLGWLVLDYYERKTQLAGWFGLAETNKRTG*
Ga0182140_10426391	3300015314	Miscanthus Phyllosphere	GFWAGLNWLMLVCCERKILLTSWFGLAETNQRTG*
Ga0182127_10106352	3300015321	Miscanthus Phyllosphere	SLVGFWAGLDWLVLVYCERKTLLAGWFGLAETNKRTGR*
Ga0182127_10497412	3300015321	Miscanthus Phyllosphere	SLVGFWAGLGWLVLVCCERKTLLAGWFRLAETNKRTG*
Ga0182127_10532322	3300015321	Miscanthus Phyllosphere	ACSLVGFWAGLGWLLLVYCERKTLLADWFGPAETNERTGCIR*
Ga0182110_10114331	3300015322	Miscanthus Phyllosphere	MACSLVGFWAGLGWLVLVCCERKTLLVGWFGLAETNERRVACSS
Ga0182110_10565622	3300015322	Miscanthus Phyllosphere	VIQKPACSLVGFWAGLGWLVLVYCERKTLLADWFGLVETNKRTG*
Ga0182110_10952461	3300015322	Miscanthus Phyllosphere	MQWVCSLVGTGAGLGWLVLVFCESKTLLAGWFGLAETNKRTG*
Ga0182129_10266671	3300015323	Miscanthus Phyllosphere	SVCSLVGFCAGLGWLVLVYCERKILLAGWFGLAETNKRTG*
Ga0182129_10536091	3300015323	Miscanthus Phyllosphere	VSQTACSLVGFWAGLGWPMLVCCERKTLLAGWFGLAETNKRTG
Ga0182129_10594492	3300015323	Miscanthus Phyllosphere	MPTRYWACSLVGAGAGLDWLVLVFYERKTLLASWFGLAETNKRTG*
Ga0182187_11488271	3300015341	Miscanthus Phyllosphere	ACSLVGAGAGLDWLVLFFCERKTLLASWFGLAETNKRTGWLY*
Ga0182187_11630701	3300015341	Miscanthus Phyllosphere	MACSLVNAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTG*
Ga0182109_10913121	3300015342	Miscanthus Phyllosphere	LVPNHQHSSACSLVGFWAGLGWLVLVYYERKTLLAGWFGLAETNKRTG*
Ga0182155_10116221	3300015343	Miscanthus Phyllosphere	VGLWASLGWLVLVCCERKTLLAGWFGLVETNKRTGCLT*
Ga0182155_10127661	3300015343	Miscanthus Phyllosphere	MLMMQSACSLIGFWAGLGWLVLIYCEKKTLLADWFELVETNERTGE*
Ga0182155_10735911	3300015343	Miscanthus Phyllosphere	LTHTAYSLVGFWAGLGWLVLVCYERKTLLADWFGLAETNKRTG*
Ga0182155_11479741	3300015343	Miscanthus Phyllosphere	LTVNIYMACSLVVFWAGLGWLVLVYCERKTLLTGWFRLTETNKRTD*
Ga0182155_11672021	3300015343	Miscanthus Phyllosphere	MKIYSACLLVGFWVGLDWLVLVYCERKTLLTSWFGLAEINKRTG*
Ga0182189_10217161	3300015344	Miscanthus Phyllosphere	VGPCTYSVCSLVGFWAGLGWLVLIYCERKTLLVGWFGLTETNKR
Ga0182189_10622431	3300015344	Miscanthus Phyllosphere	MKACSLVGAGAGLGWLVLVFCESKTLLAGWFGLAETNKRTG*
Ga0182189_10948671	3300015344	Miscanthus Phyllosphere	SACSLVGFWAGLGWLVLVCCERKTLLAGWFGLAETNKRTG*
Ga0182189_11052841	3300015344	Miscanthus Phyllosphere	GFLGRACSLVGAGAGLGWLVLVFCERKILLAGWFELAETNKRTSWIS*
Ga0182189_12227971	3300015344	Miscanthus Phyllosphere	ACSLVGFWAGLGWLVLVCCERKTLLADWFGLAEINKRTG*
Ga0182111_10742201	3300015345	Miscanthus Phyllosphere	MKACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTGWLST*
Ga0182111_10851672	3300015345	Miscanthus Phyllosphere	SACSLVGFWAGLGWLVLVCCERKILLAGWFGLTETNKRTW*
Ga0182111_10878371	3300015345	Miscanthus Phyllosphere	KIYSACLLVGFWVGLDWLVLVYCERKTLLTSCFGLAETNKRTS*
Ga0182111_11811341	3300015345	Miscanthus Phyllosphere	SACSLVGFWAGLGWLVLICCERKTLLAGWFGLAETNKRTC*
Ga0182139_10102191	3300015346	Miscanthus Phyllosphere	VLEGFWACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTG
Ga0182139_10119701	3300015346	Miscanthus Phyllosphere	MKYIYTACSLVGLGWLVLVCCERKTILAGWFRLAETNKRTDS
Ga0182139_10393441	3300015346	Miscanthus Phyllosphere	MSACSLVGFWAGLGWLVLVCCERKTLLPGWFGLAETNERTG*
Ga0182139_10440213	3300015346	Miscanthus Phyllosphere	RACSLVGAGAGLGWLVLVFCERKTLLAGWFVLAETNKRTG*
Ga0182139_10601231	3300015346	Miscanthus Phyllosphere	VSCHQFHESACSLVGAGAGLDWLVLVFCERKTLLAGWFGLAETNKRTG
Ga0182139_10750571	3300015346	Miscanthus Phyllosphere	VHLLSACSLVGLWAGLGWLVLVCCERKILLADWFELAETN
Ga0182139_11175651	3300015346	Miscanthus Phyllosphere	VCHPLLPACSLIGFWAGLDWLMLVCCERKILLAGWFGLAEINKRTG*
Ga0182139_11586531	3300015346	Miscanthus Phyllosphere	LVPKLIQLACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKR
Ga0182177_10075661	3300015347	Miscanthus Phyllosphere	VGLWAGLGWLVLVYCERKTLLAGWFGLVETNKRTG*
Ga0182177_10285352	3300015347	Miscanthus Phyllosphere	MKACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETN
Ga0182177_10490122	3300015347	Miscanthus Phyllosphere	SLVGAGTDLGWLVLVFCERKTLLAGWFGLAETNKRTCL*
Ga0182177_12379761	3300015347	Miscanthus Phyllosphere	SMWTRACSLVGAGAGLGWLVLVFCERKILLVGWFGLAETNKRTG*
Ga0182161_10026251	3300015351	Miscanthus Phyllosphere	KRSTQSACSLVGFWAGLDWLVLVLCERKILLVGWFGLVETNKRTG*
Ga0182161_10902642	3300015351	Miscanthus Phyllosphere	ACSLVGFWAGLDWLVLVLCERKTLLVGWFGLVETNKRTE*
Ga0182161_10997922	3300015351	Miscanthus Phyllosphere	WACSLVGAGAGLDWLVLVFYERKTLLASWFGLAETNKRTG*
Ga0182161_11308731	3300015351	Miscanthus Phyllosphere	MKIYSACLLVGFWVGLDWLVLVYCERKTLLAGWFGLAETNKRTS*
Ga0182161_12178261	3300015351	Miscanthus Phyllosphere	MSISSACSLVGFLAGLGWLVLVCCERKTLLAGWFGLAETNKRTG
Ga0182161_12431201	3300015351	Miscanthus Phyllosphere	GAGAGLGWLVLVFCERKTLLASWFGLAETNKRTG*
Ga0182161_12606092	3300015351	Miscanthus Phyllosphere	GFWAGLGLLVLVCCERKTLLPGWFGLAETNERTG*
Ga0182159_10657521	3300015355	Miscanthus Phyllosphere	ACSLVGFWAGLGWLVLVLCERKTLLVGWFGLVETNKRTCQISI*
Ga0182159_10802221	3300015355	Miscanthus Phyllosphere	CSLVGFWAGLGWLVLVCYERKILLTGWFGLAETNKRI*
Ga0182159_11383361	3300015355	Miscanthus Phyllosphere	TSSACSLVGFWVGLGWLVLVYCEKKTLLAGWFWLAETNKRTGRLW*
Ga0182159_11486761	3300015355	Miscanthus Phyllosphere	SLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTGWLST*
Ga0182159_11997821	3300015355	Miscanthus Phyllosphere	MACLLVGFWTDLGWLVLIYCERKILLAGWFGLAETKEDV*
Ga0182159_12488921	3300015355	Miscanthus Phyllosphere	SACSLVGFWASLGWLVLVYCERKTLLAGWFGLAETNKRTG*
Ga0182159_12831991	3300015355	Miscanthus Phyllosphere	MSILRFSYYLSCSLVGAGADLGWLVLVFYERKTLLAGWFGLAKTNTRTGL
Ga0182159_13537851	3300015355	Miscanthus Phyllosphere	CSLVGAGAGLGWLVLVFCERKTLLASWFGLAETNKRTG*
Ga0182145_10830951	3300015361	Miscanthus Phyllosphere	ACSLVGFWAGLDWLLLVCCERKTLLVGWFGLVETNKRTG*
Ga0182145_11763711	3300015361	Miscanthus Phyllosphere	LVGAGAGLSWLALVFCERKILLAGWFGLVETNKRTGCKT
Ga0182203_11041661	3300017404	Miscanthus Phyllosphere	MKIYSACLLVGFWVGLDWLVLVYCERKTLLTSWFGLAEINKRTG
Ga0182220_10816922	3300017407	Miscanthus Phyllosphere	MTRSACSLVGAGTGLGWLVLVFYERKTLFAGWFGLAEIKKRTRDM
Ga0182204_10264081	3300017409	Miscanthus Phyllosphere	QSACSLVGFWAGLNCLVLVYCEKKTLLAGWFGLAETNKRT
Ga0182207_10438143	3300017410	Miscanthus Phyllosphere	LIISLWVCSLVGVSADLGWLVLVFCERKTLLAGWFGLAETNKR
Ga0182207_11185021	3300017410	Miscanthus Phyllosphere	MKACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNK
Ga0182207_11224911	3300017410	Miscanthus Phyllosphere	CSLVGFWAGLGWPVLVYCERKTLLAGWFELAETNKRTG
Ga0182208_10572611	3300017411	Miscanthus Phyllosphere	LVGVGAGLGWLVLVFCERKTLLASWFRLAETNKRTG
Ga0182208_11074291	3300017411	Miscanthus Phyllosphere	LSQLHQQLRAYSLVGAGAGLGWLVLVFYERKTLLTGWFGLAETNK
Ga0182208_11156901	3300017411	Miscanthus Phyllosphere	ACSLVGFWAGLGWLVLVYCERKILLAGWFGLAETNKRTG
Ga0182208_11265941	3300017411	Miscanthus Phyllosphere	LACSLVGFWAGLGWLVLVCCERKTLLAGWFGLAETNKQTGTPWASAHAK
Ga0182208_11299451	3300017411	Miscanthus Phyllosphere	MKSRPRSLVGAGAGLGWLVLICCERKILLADWFGLAETNKRID
Ga0182222_10948651	3300017413	Miscanthus Phyllosphere	AFIQGACSLVGFWAGLDWLVLVYCERKTLLASWFGLVETNKRTW
Ga0182202_10108711	3300017415	Miscanthus Phyllosphere	CSLVSFWASLGWLVLICYERKIFLAGWFGLAEINKRTG
Ga0182202_10572781	3300017415	Miscanthus Phyllosphere	CSLIGFWVGLDWLVLICCERKILLTDWFRLVETNKQTG
Ga0182219_10240521	3300017424	Miscanthus Phyllosphere	LVGFWAGLVWLVLIYYERKTLFTKWFGLAETNKRTG
Ga0182219_10648172	3300017424	Miscanthus Phyllosphere	VQTLNMKIYSACLLVGFWVGLDWLVLVYCERKTLLTSWFGLAEINKRTG
Ga0182219_10890492	3300017424	Miscanthus Phyllosphere	LARSLVSFWAGLDWLVLLYCERKTLLAGWFWLAETNKRTDCFSDND
Ga0182219_11030971	3300017424	Miscanthus Phyllosphere	CSLVGAGAGLGWLMLVFCERKTPLAGWFGLAETNKGTGRMANTHF
Ga0182224_11227021	3300017425	Miscanthus Phyllosphere	MPTRYWACSLVGAGAGLGWLVLVFYERKTLLASWFGLAETNKRTD
Ga0182224_11374491	3300017425	Miscanthus Phyllosphere	MSISSACSLVGFLAGLGWLVLVCCERKTLLAGWFGLAETNKRT
Ga0182224_11585902	3300017425	Miscanthus Phyllosphere	VACSLVGFWAGLGWLVLVCCERKTLLADWFGLAETN
Ga0182192_10246923	3300017430	Miscanthus Phyllosphere	MLMMQSACSLIGFWAGLGWLVLIYCEKKTLLADWFELVETNERTGE
Ga0182192_11391751	3300017430	Miscanthus Phyllosphere	VGFWAGLGWLALVCCERKTLLAGWFGLAETNKRTG
Ga0182206_10083482	3300017433	Miscanthus Phyllosphere	LKSCSLAGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTGLHVATI
Ga0182206_11486711	3300017433	Miscanthus Phyllosphere	LGWLVLVYCERKTLLVGWFGLVETNQRTDRMMATGL
Ga0182209_10733311	3300017436	Miscanthus Phyllosphere	VLEGFWACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNK
Ga0182209_11037071	3300017436	Miscanthus Phyllosphere	MNAYTACSLVGAGAGLDWLVLVFCERKTLLAGWFGLAETNKRTGWL
Ga0182209_11092361	3300017436	Miscanthus Phyllosphere	MDHISACSLVGFWAGLSCLVLICCERKILLVGWFGLAETNKRIG
Ga0182191_11501741	3300017438	Miscanthus Phyllosphere	LRHAACSLVDFWTGLGWLVLVYCERKTLLAGWFGLAETN
Ga0182191_11644921	3300017438	Miscanthus Phyllosphere	SACSLVSFWAGLDWLVLVCCERKILLTDWFGLAETNKLTGI
Ga0182221_10557981	3300017442	Miscanthus Phyllosphere	QWACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTG
Ga0182221_10577561	3300017442	Miscanthus Phyllosphere	GFVFRPHTQSACSLVSFWAGLGWLVLVYCERKTLLAGWFGLAETMKRTG
Ga0182221_10964291	3300017442	Miscanthus Phyllosphere	TRYWACSLVGAGAGLGWLVLVFYERKTLLASWFGLAETNKRTG
Ga0182221_11226441	3300017442	Miscanthus Phyllosphere	SLVGFWAGLGWLMLVCCEKKTLLTGWFGLAETNKRTG
Ga0182221_11663101	3300017442	Miscanthus Phyllosphere	WACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTCL
Ga0182193_10879381	3300017443	Miscanthus Phyllosphere	LVGAGAGLGWLVLVFCERKTLLASWFGLAETNERTG
Ga0182193_11028942	3300017443	Miscanthus Phyllosphere	LVGIWAGLDWLVLVLCERKTLLVGWFGLVETNKRTE
Ga0182193_11146401	3300017443	Miscanthus Phyllosphere	LRFHGTQRACSLVGAGAGLGWLMLVFYERKTLLTGWFGLAETNNRTG
Ga0182193_11434631	3300017443	Miscanthus Phyllosphere	MIYPFWACSLVGTGVGLGWLVLVFCERKTLFAGWFGLAETNKETG
Ga0182233_10873992	3300017680	Miscanthus Phyllosphere	MACSLVGFWAGLGWLVLVYCERKILLAGWFGLAETNKRTGRIEPNRSD
Ga0182218_10093171	3300017683	Miscanthus Phyllosphere	MGYWACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTGCIMD
Ga0182218_10156871	3300017683	Miscanthus Phyllosphere	MKACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTG
Ga0182218_10616141	3300017683	Miscanthus Phyllosphere	LTHTAYSLVGFWAGLGWLVLVCYERKTLLADWFGLAETNKRTG
Ga0182218_10840211	3300017683	Miscanthus Phyllosphere	MNVDSACSLVGLWAGLGWLVLVYCERKTLLAGWFGLAETNKRTG
Ga0182225_10397591	3300017684	Miscanthus Phyllosphere	MACLLVGFWTDLGWLVLIYCERKILLAGWFGLAETKEDV
Ga0182225_10563251	3300017684	Miscanthus Phyllosphere	MNMACSLVGFWVGLGWLMLVYYERKTPLTGWFGLAETNKRTG
Ga0182227_10214232	3300017685	Miscanthus Phyllosphere	MSISSACSLVGFLAGLGWLVLVCCERKTLLAGWFGLAETNKRTGS
Ga0182227_10739471	3300017685	Miscanthus Phyllosphere	MAYSLVSFWAGLGWLVLVYCERKTLLTGWFGLAGTNKLTG
Ga0182227_11329402	3300017685	Miscanthus Phyllosphere	ACSLVGVGAGLGWLVLVFCERKTLLASWFRLAETNKRTG
Ga0182205_10909101	3300017686	Miscanthus Phyllosphere	YWACSLVGAGAGLGWLVLVFYERKTLLASWFGLAETNKRTG
Ga0182223_10161031	3300017690	Miscanthus Phyllosphere	LACSLVGVCAGLGWLVLVFCEKKTLLAGWFGLAETNKRTG
Ga0182223_10676791	3300017690	Miscanthus Phyllosphere	CSPCSLVGAGAGLDWLVLVFCERKTLLAGWFGLAETNKRTW
Ga0182223_10738711	3300017690	Miscanthus Phyllosphere	WACSLVGAGAGLGWLVLVFYERKTLLVGWFGLAGTNKRTGC

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F056209

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign