NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F056315

Metagenome / Metatranscriptome Family F056315

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056315
Family Type Metagenome / Metatranscriptome
Number of Sequences 137
Average Sequence Length 80 residues
Representative Sequence MEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRE
Number of Associated Samples 92
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 91.18 %
% of genes near scaffold ends (potentially truncated) 90.51 %
% of genes from short scaffolds (< 2000 bps) 91.24 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (49.635 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater
(32.847 % of family members)
Environment Ontology (ENVO) Unclassified
(75.182 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(86.861 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 30.67%    β-sheet: 9.33%    Coil/Unstructured: 60.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF00077RVP 11.68
PF00078RVT_1 2.19
PF00665rve 1.46

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 137 Family Scaffolds
COG3577Predicted aspartyl proteaseGeneral function prediction only [R] 11.68
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 1.46
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 1.46
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 1.46
COG4584TransposaseMobilome: prophages, transposons [X] 1.46

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms50.36 %
UnclassifiedrootN/A49.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000176|TB03JUN2009E_c014059All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1336Open in IMG/M
3300003797|Ga0007846_1007652Not Available1123Open in IMG/M
3300004687|Ga0065174_1039521Not Available894Open in IMG/M
3300004770|Ga0007804_1172315Not Available540Open in IMG/M
3300004777|Ga0007827_10068799Not Available809Open in IMG/M
3300004806|Ga0007854_10094219All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1379Open in IMG/M
3300004806|Ga0007854_10103313All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1300Open in IMG/M
3300004806|Ga0007854_10103669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1298Open in IMG/M
3300004807|Ga0007809_10035273Not Available1683Open in IMG/M
3300005069|Ga0071350_1005509All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex2783Open in IMG/M
3300005069|Ga0071350_1032085Not Available1399Open in IMG/M
3300005069|Ga0071350_1042285All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1258Open in IMG/M
3300005069|Ga0071350_1044882All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1229Open in IMG/M
3300005069|Ga0071350_1076804All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex998Open in IMG/M
3300005419|Ga0068883_1646646Not Available736Open in IMG/M
3300005421|Ga0068882_1776545All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1172Open in IMG/M
3300005525|Ga0068877_10301551All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex926Open in IMG/M
3300005525|Ga0068877_10542153Not Available638Open in IMG/M
3300005527|Ga0068876_10286132Not Available938Open in IMG/M
3300006100|Ga0007806_1017687Not Available1528Open in IMG/M
3300006101|Ga0007810_1071966All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex686Open in IMG/M
3300006107|Ga0007836_1052389All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex898Open in IMG/M
3300006108|Ga0007862_1112576All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex502Open in IMG/M
3300006116|Ga0007807_1109251All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex504Open in IMG/M
3300006117|Ga0007818_1042350Not Available874Open in IMG/M
3300006117|Ga0007818_1082796Not Available589Open in IMG/M
3300006118|Ga0007859_1021130All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1433Open in IMG/M
3300006119|Ga0007866_1051987Not Available777Open in IMG/M
3300006125|Ga0007825_1125894All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex509Open in IMG/M
3300006126|Ga0007855_1042730All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex976Open in IMG/M
3300006128|Ga0007828_1136990Not Available503Open in IMG/M
3300008106|Ga0114339_1065057Not Available1603Open in IMG/M
3300008108|Ga0114341_10395732Not Available672Open in IMG/M
3300008109|Ga0114342_1049980All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1178Open in IMG/M
3300008109|Ga0114342_1079050Not Available864Open in IMG/M
3300008109|Ga0114342_1105511Not Available720Open in IMG/M
3300008112|Ga0114345_1004355Not Available3316Open in IMG/M
3300008112|Ga0114345_1010558All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2308Open in IMG/M
3300008112|Ga0114345_1010992Not Available2268Open in IMG/M
3300008112|Ga0114345_1010994All Organisms → cellular organisms → Eukaryota2268Open in IMG/M
3300008112|Ga0114345_1014356Not Available2032Open in IMG/M
3300008112|Ga0114345_1039571Not Available1361Open in IMG/M
3300008112|Ga0114345_1045465Not Available1287Open in IMG/M
3300008112|Ga0114345_1064044Not Available1123Open in IMG/M
3300008112|Ga0114345_1066956Not Available1102Open in IMG/M
3300008112|Ga0114345_1083423All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1008Open in IMG/M
3300008112|Ga0114345_1193269Not Available691Open in IMG/M
3300008112|Ga0114345_1222950Not Available641Open in IMG/M
3300008112|Ga0114345_1288835All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex550Open in IMG/M
3300008112|Ga0114345_1322361All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex512Open in IMG/M
3300008112|Ga0114345_1331061Not Available503Open in IMG/M
3300008118|Ga0114352_1034520All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1047Open in IMG/M
3300008122|Ga0114359_1311617Not Available543Open in IMG/M
3300008122|Ga0114359_1342640All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex512Open in IMG/M
3300008261|Ga0114336_1105236Not Available1319Open in IMG/M
3300009187|Ga0114972_10584889All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex625Open in IMG/M
3300009419|Ga0114982_1145618Not Available731Open in IMG/M
3300012686|Ga0157560_1012162Not Available743Open in IMG/M
3300012692|Ga0157571_1114976All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex689Open in IMG/M
3300012698|Ga0157570_1039051All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1270Open in IMG/M
3300012721|Ga0157612_1018064All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex690Open in IMG/M
3300012721|Ga0157612_1211438Not Available977Open in IMG/M
3300012724|Ga0157611_1274302All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex741Open in IMG/M
3300012752|Ga0157629_1036659All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1062Open in IMG/M
3300013004|Ga0164293_10443192All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex866Open in IMG/M
3300013004|Ga0164293_10622524Not Available699Open in IMG/M
3300013005|Ga0164292_10112397All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex2038Open in IMG/M
3300013005|Ga0164292_10603621All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex709Open in IMG/M
3300013068|Ga0157563_1071886All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex2008Open in IMG/M
3300013093|Ga0164296_1283821Not Available622Open in IMG/M
3300013094|Ga0164297_10124654All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1057Open in IMG/M
3300013094|Ga0164297_10337651All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex575Open in IMG/M
3300013094|Ga0164297_10395286Not Available529Open in IMG/M
3300016692|Ga0180040_1060489All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex553Open in IMG/M
3300020492|Ga0208483_1016933Not Available842Open in IMG/M
3300020535|Ga0208228_1010568All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1662Open in IMG/M
3300020538|Ga0208595_1032902All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex742Open in IMG/M
3300020560|Ga0208852_1037286Not Available851Open in IMG/M
3300020560|Ga0208852_1052092All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex678Open in IMG/M
3300020571|Ga0208723_1026220All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex878Open in IMG/M
3300020707|Ga0214238_1024667Not Available677Open in IMG/M
3300020721|Ga0214236_1020934All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex894Open in IMG/M
3300020727|Ga0214246_1028454Not Available898Open in IMG/M
3300020731|Ga0214170_1060532All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex537Open in IMG/M
3300020733|Ga0214172_1001228All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex8214Open in IMG/M
3300021110|Ga0214203_10027All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex4754Open in IMG/M
3300021117|Ga0214208_1014618All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex729Open in IMG/M
3300021119|Ga0214204_1005962Not Available1341Open in IMG/M
3300021119|Ga0214204_1023008Not Available553Open in IMG/M
3300021136|Ga0214167_1109741All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex501Open in IMG/M
3300025328|Ga0208384_102979All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex835Open in IMG/M
3300025356|Ga0208870_1040599All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex516Open in IMG/M
3300025357|Ga0208383_1017220All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex874Open in IMG/M
3300025378|Ga0207960_1021625All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex887Open in IMG/M
3300025381|Ga0208871_1059389Not Available500Open in IMG/M
3300025411|Ga0208865_1051111Not Available647Open in IMG/M
3300025415|Ga0208868_1049894Not Available632Open in IMG/M
3300025418|Ga0208253_1052772All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex684Open in IMG/M
3300025449|Ga0208106_1013055Not Available1669Open in IMG/M
3300025470|Ga0208389_1010261Not Available2414Open in IMG/M
3300025591|Ga0208496_1086771Not Available686Open in IMG/M
3300025598|Ga0208379_1047523Not Available1124Open in IMG/M
3300025723|Ga0208741_10035867All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1158Open in IMG/M
3300025773|Ga0208104_1023710Not Available756Open in IMG/M
3300025773|Ga0208104_1027769All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex685Open in IMG/M
3300025782|Ga0208867_1015928All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1175Open in IMG/M
3300025785|Ga0208498_1017434All Organisms → cellular organisms → Eukaryota1264Open in IMG/M
3300025785|Ga0208498_1052274Not Available576Open in IMG/M
3300025788|Ga0208873_1046898Not Available688Open in IMG/M
3300025788|Ga0208873_1048013All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex678Open in IMG/M
3300025838|Ga0208872_1107785All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1027Open in IMG/M
3300025838|Ga0208872_1166088All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex756Open in IMG/M
3300027720|Ga0209617_10277045Not Available631Open in IMG/M
3300027720|Ga0209617_10372707Not Available524Open in IMG/M
3300027793|Ga0209972_10257252Not Available785Open in IMG/M
3300027793|Ga0209972_10398293Not Available585Open in IMG/M
3300027797|Ga0209107_10219411Not Available929Open in IMG/M
3300027806|Ga0209985_10231414All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex864Open in IMG/M
3300027816|Ga0209990_10198558All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex931Open in IMG/M
3300027816|Ga0209990_10228847Not Available853Open in IMG/M
3300032117|Ga0316218_1066352All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1488Open in IMG/M
3300032117|Ga0316218_1092824Not Available1194Open in IMG/M
3300032676|Ga0316229_1199874Not Available779Open in IMG/M
3300032676|Ga0316229_1362209All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex514Open in IMG/M
3300033816|Ga0334980_0344611Not Available572Open in IMG/M
3300033816|Ga0334980_0396258All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex523Open in IMG/M
3300033980|Ga0334981_0205103Not Available915Open in IMG/M
3300033980|Ga0334981_0221800All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex869Open in IMG/M
3300033980|Ga0334981_0395547All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex592Open in IMG/M
3300034082|Ga0335020_0066012All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1876Open in IMG/M
3300034116|Ga0335068_0351271Not Available718Open in IMG/M
3300034118|Ga0335053_0145027Not Available1606Open in IMG/M
3300034118|Ga0335053_0784600Not Available527Open in IMG/M
3300034272|Ga0335049_0723431All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex599Open in IMG/M
3300034279|Ga0335052_0424001Not Available703Open in IMG/M
3300034356|Ga0335048_0307631Not Available820Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater32.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater21.17%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton17.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater9.49%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake7.30%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater5.84%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.46%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater1.46%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.46%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.73%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.73%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000176Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnionEnvironmentalOpen in IMG/M
3300003797Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07EnvironmentalOpen in IMG/M
3300004687Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004770Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07EnvironmentalOpen in IMG/M
3300004777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07EnvironmentalOpen in IMG/M
3300004806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08EnvironmentalOpen in IMG/M
3300004807Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07EnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005419Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005421Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300006100Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09EnvironmentalOpen in IMG/M
3300006101Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09EnvironmentalOpen in IMG/M
3300006107Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07EnvironmentalOpen in IMG/M
3300006108Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07EnvironmentalOpen in IMG/M
3300006116Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09EnvironmentalOpen in IMG/M
3300006117Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09EnvironmentalOpen in IMG/M
3300006118Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07EnvironmentalOpen in IMG/M
3300006119Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07EnvironmentalOpen in IMG/M
3300006125Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE13Jul09EnvironmentalOpen in IMG/M
3300006126Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH01Aug08EnvironmentalOpen in IMG/M
3300006128Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07EnvironmentalOpen in IMG/M
3300008106Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTREnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008109Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-53-LTREnvironmentalOpen in IMG/M
3300008112Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-100-LTREnvironmentalOpen in IMG/M
3300008118Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-100-LTREnvironmentalOpen in IMG/M
3300008122Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTREnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300012686Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES055 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012692Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES073 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012698Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES071 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012721Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012724Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012752Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013068Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES062 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013093Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaGEnvironmentalOpen in IMG/M
3300013094Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaGEnvironmentalOpen in IMG/M
3300016692Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES100 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020492Freshwater microbial communities from Lake Mendota, WI - 01JUN2011 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020535Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020538Freshwater microbial communities from Lake Mendota, WI - 28JUN2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020560Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020571Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020707Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 hypolimnionEnvironmentalOpen in IMG/M
3300020721Freshwater microbial communities from Trout Bog Lake, WI - 28JUL2008 hypolimnionEnvironmentalOpen in IMG/M
3300020727Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnionEnvironmentalOpen in IMG/M
3300020731Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnionEnvironmentalOpen in IMG/M
3300020733Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021110Freshwater microbial communities from Trout Bog Lake, WI - 08JUN2009 epilimnionEnvironmentalOpen in IMG/M
3300021117Freshwater microbial communities from Trout Bog Lake, WI - 21JUL2009 epilimnionEnvironmentalOpen in IMG/M
3300021119Freshwater microbial communities from Trout Bog Lake, WI - 23JUN2009 epilimnionEnvironmentalOpen in IMG/M
3300021136Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnionEnvironmentalOpen in IMG/M
3300025328Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025356Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025357Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025378Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025381Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025411Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025415Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300025418Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (SPAdes)EnvironmentalOpen in IMG/M
3300025449Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025470Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025591Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M (SPAdes)EnvironmentalOpen in IMG/M
3300025598Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025723Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025773Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 (SPAdes)EnvironmentalOpen in IMG/M
3300025782Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 (SPAdes)EnvironmentalOpen in IMG/M
3300025785Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025788Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH01Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300025838Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300027114Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027806Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300032117Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003EnvironmentalOpen in IMG/M
3300032676Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
TB03JUN2009E_01405913300000176FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESFGNARPRLL
Ga0007846_100765223300003797FreshwaterMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKNRPRINVTTGEKTFNWLFDTGAAVTCMNANSFKEA
Ga0065174_103952123300004687FreshwaterMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKIRPRINVTTGEKTFNWLFDTGAAITCMNANSFREAFSGKRPKLLHKGTGCVAAN
Ga0007804_117231513300004770FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGA
Ga0007827_1006879913300004777FreshwaterMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKIRPRINVTTGEKTFNWLFDTGAAITCMNANSFREAFSGKRPKLLHKGTG
Ga0007854_1009421913300004806FreshwaterMSLMEPLRQAPLIIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAITCMNANSF
Ga0007854_1010331313300004806FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNA
Ga0007854_1010366913300004806FreshwaterMEPLLQAPAVIPQLIMSLCAVSIVTYNKLSEIMTPFHGGNKTRPRINVTTGKTSFNWLFDTGAAITCMNADSFRDAFGYQKPRLVKKCTLYRSQRV*
Ga0007809_1003527323300004807FreshwaterMEPLRQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFLGGNKVRPRINVTTGNKTFNWLFDTGAAITCMN
Ga0071350_100550953300005069FreshwaterMEPLLQAPAVIPQLIMSLCAVSIVTYNKLSEIMTPFHAGNKIRPRINVTTGQKTFNWLFNTSAAITCMNADSFRESFGHSKPKLQKKCWLHRSKWF*
Ga0071350_103208523300005069FreshwaterMEPLLQAPAVFPQIIMSLCAVSIVTYNKLSEIMTLFHGGNKVRPRINVTTGKKTFDWLFDTGAAITCMNANSFRESFGHSKPRLLKKVLAA*
Ga0071350_104228523300005069FreshwaterMEPLLQAPAIIPQIIMSLCAVSIVTYNKLLEIMMPFHGGNKVRPRINVTMGKKTFHWLFDTGAAITCMNADSFRESL*
Ga0071350_104488223300005069FreshwaterMEPLLQAPAVILQLIMSLCAVSIVTYNKLSEIMTPFHGGNKIRPRINVTTGKTSFNWFFDTGAAITCMNADSFREAFGHQKPRMVKRVLVALLQTDQKWNQ
Ga0071350_107680413300005069FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTCNKLSEIMMPVHGGNKIRHRINVTTGKKTFNWLFDTGAVSRCDISLYI*
Ga0068883_164664613300005419Freshwater LakeMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKNRPRINVTTGEKTFNWLFDTGAAVTCMNANSFKEAFSGK*
Ga0068882_177654523300005421Freshwater LakeMSLMEPLRQAPQVIPQIILSLCAISIVTFNKLSEVMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAVTCMNANSFKEAFSGKRPKL
Ga0068877_1030155123300005525Freshwater LakeMSLMEPLRQAPLVIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAITCM
Ga0068877_1054215323300005525Freshwater LakeMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKNRPRINVTTGEKTFNWLFDTGAAVTCMNANSFKEAFSGKRPKLLHKGTSCVAANG
Ga0068876_1028613213300005527Freshwater LakeMEPLRQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFLGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDS
Ga0007806_101768713300006100FreshwaterMEPLRQAPAIIPQLIMSLCAVSMITYNKLSEIMTPFLGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDS
Ga0007810_107196623300006101FreshwaterMSLMEPLRQAPQVIPQIILSLCAISIVTFNKLSEVMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAVTCMNANSFKEAFSGKRPKLLH
Ga0007836_105238923300006107FreshwaterMSLMEPLRQAPQVIPQIILSLCAISIVTFNKLSEVMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAVTCMNANSFKEAFSGKR
Ga0007862_111257613300006108FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPLHGGNKVRPRINVTTGKKTFNWLFDTGAAI
Ga0007807_110925113300006116FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESFGHSKPRLLK
Ga0007818_104235013300006117FreshwaterMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKIRPRINVTTGEKTFNWLFDTGAAITCMNANSFREAFSGKRPKL
Ga0007818_108279613300006117FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDSF
Ga0007859_102113013300006118FreshwaterMSLMEPLRQAPLVIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAITCMNANSFR
Ga0007866_105198723300006119FreshwaterMEPLRQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDSF
Ga0007825_112589413300006125FreshwaterMSLMEPLRQAPLVIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAITCMN
Ga0007855_104273013300006126FreshwaterMSLMEPLRQAPLVIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAITCMNTNSF
Ga0007828_113699023300006128FreshwaterMEPLRQAPAVIPQIIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNADSFRDS
Ga0114339_106505723300008106Freshwater, PlanktonMEPLRQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFLGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFR
Ga0114341_1039573223300008108Freshwater, PlanktonMEPLLQAPAVIPQIIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDS
Ga0114342_104998023300008109Freshwater, PlanktonMEPLHQAPAVIPQIIMSLCAVSMITYNKLSEVMMPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNADSFRESFGHQRPRLIKNS
Ga0114342_107905023300008109Freshwater, PlanktonMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKNRPRINVTTGEKTFNWLFDTGAAVTCMNANSFKEAFSGKRPKLLHKGTS
Ga0114342_110551123300008109Freshwater, PlanktonLQAPAVIPQLIMSLCAVSIVTYNKLSEIMTPFHGGNKTRPRINVTTGKTSFNRLFDTGAAITCMNADSFRDAFGHQKPRLVK*
Ga0114345_100435533300008112Freshwater, PlanktonMEPLRQAPAVIPQIIMSLCAVSIVTCNKLSEIMTPFHGGNKVRPRINITTGKKTFNWLFDTGAAITCMNADSFRESFGHSKPRLLKKVLAA*
Ga0114345_101055823300008112Freshwater, PlanktonMSLMEPLRQAPLVIPQLLLSLCAISIVTFNKLSEIMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAITCMNANSFQQAFSGK*
Ga0114345_101099213300008112Freshwater, PlanktonPSPPGPGFSVLSLMEPLIQAPVIIPQLIMSLCAVSIVTDNKLSEIMTPFHWGNKIRPRINVTMGQKTFNWLFDTGAAITCMNADSFWESFGH*
Ga0114345_101099413300008112Freshwater, PlanktonLSLIEPLLQAPAIIPQIIMSLCAVSIVTYNKLSEIMMPFHGGNKIRPRINVTTGKNTFNWLLDTGAAITCMNADSFRECFGHSRPTLLKKVLAASQLMVLK*
Ga0114345_101435643300008112Freshwater, PlanktonLQAPAIISQLIMILCAVSIVTYNKLSEIMMPFHGGNKIRPRINVTTGKTSFNWLLDTGAAITCMNADSFREAFGHQKPRMVKEYGLHCSKWV*
Ga0114345_103957113300008112Freshwater, PlanktonMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEIMMPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESFGHSKPR
Ga0114345_104546513300008112Freshwater, PlanktonMEPLLQAPAVIPQIIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNADSFR
Ga0114345_106404413300008112Freshwater, PlanktonAGFSVLSLMEPLLQAPAIIPQIIMSLCAVSIVTYNKLSEIMMPFHGGNKVRPRINVTMGKKTFHWLFDTGAAITCMNADSFRESL*
Ga0114345_106695623300008112Freshwater, PlanktonLMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEIMTPYHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFWESFGHSKPRLLKKVLAA*
Ga0114345_108342323300008112Freshwater, PlanktonMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEIMIPFHGGNKVRPRINVTTGKKTFNWLFDMGAAITCMNADSF*
Ga0114345_119326923300008112Freshwater, PlanktonMSLMEPLRQAPLIIPQLILSLCAVSMVTFNKLSEIMRPFYGGNKNRPRINVTTGDKTFHWLFDTGAAVTCMNANSFRQAFPGNRPRLL
Ga0114345_122295023300008112Freshwater, PlanktonAPQVIPQIILSLCAISIVTFNKLSEVMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAVTCMNANSFKEAFSGK*
Ga0114345_128883523300008112Freshwater, PlanktonMEPLLQAPAVIPQVIMSLCAVSIVTYNKLSQIMMPFHGGNKVRPRINFTTGKKIFNWLFDTGAAITCMNADSFRESFGHSKPRLLKK
Ga0114345_132236113300008112Freshwater, PlanktonMEPLLQAPAVIPQLIMSLCAVSIVTYNKLSEIMTPFHGGNKTRPRINVTTGKTSFNWLFDTGAAITC
Ga0114345_133106123300008112Freshwater, PlanktonMSMMEPLRQAPLIIPQLILNLCAVSMVTFNKLSEIMTPFFGGNKNRPRINVTTGDKTFNWLFDTGTAVTCMNANSF*
Ga0114352_103452023300008118Freshwater, PlanktonMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESFGH
Ga0114359_131161713300008122Freshwater, PlanktonQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGRNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFREC*
Ga0114359_134264013300008122Freshwater, PlanktonMEPLLQAPAVIPQLIMSLCAVSIVTYNKLSEIMTPFHGGNKTRPRINVTTGKLSCNWLFDTGAAITCMNADSFRDAFGHQKP
Ga0114336_110523623300008261Freshwater, PlanktonMEPLRQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFLGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDSFGHNRPRLLKDSAGCI
Ga0114972_1058488913300009187Freshwater LakeMEPLLQAPAVIPQIIMSLCAVSIMTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRES
Ga0114982_114561813300009419Deep SubsurfaceMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFR
Ga0157560_101216213300012686FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMMPFHGGNKVRPRINVTTGNKTFSWLFDTGAAITCMNA
Ga0157571_111497623300012692FreshwaterMSLMEPLRQAPLVIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNRPRINVTSGNNTFNWLFDTGASITCMNADSFRESFGHQRPRLIKKVLVA*
Ga0157570_103905123300012698FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGA
Ga0157612_101806413300012721FreshwaterMSLMEPLRQAPQVIPQIILSLCAISIVTFNKLSEVMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAVTCMNANSFKEAFSGKRPKLLHKGTSC
Ga0157612_121143823300012721FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDMGAAITCMNANSFRD
Ga0157611_127430223300012724FreshwaterMEPLLQAPAIIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAI
Ga0157629_103665913300012752FreshwaterMEPLRQAPLVIPQLIMSLCTISIATCNKLCEIMTPFHGDKKRLRINVTTGNTTFNWLFDT
Ga0164293_1044319213300013004FreshwaterMSLMEPLRQAPLVIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNCPRINVTTGDKTFNWLFD
Ga0164293_1062252423300013004FreshwaterMEPLRQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDS
Ga0164292_1011239713300013005FreshwaterMEPLRQAPLVIPQLIMSLCAISIATCNKLCEIMTPFHGDKKRPRINVTTNQTTFSWLFDTGAAITCMNANSFRQAFKNSRPKKINNGNGCVAANG
Ga0164292_1060362113300013005FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESFGHSRPRLLKKSAGC
Ga0157563_107188623300013068FreshwaterMSLMEPLRQAPQVIPQIILSLCAISIVTFNKLSEVMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAVTCMNANSFKEAFSGKRPKLLHK
Ga0164296_128382123300013093FreshwaterLSLMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFR
Ga0164297_1012465423300013094FreshwaterMEPLPQAPAIIPQIIMSLCAVSIVTYNKLSEIMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAI
Ga0164297_1033765123300013094FreshwaterMEPLLQAPAIIPQIIMSLCAVSFVTYNKLSEIMTPFHGENKIRPRINVTTGKKTFNWLFDTGAAITCMNTDSFRECFGHSKPAL*
Ga0164297_1039528613300013094FreshwaterMEPLHQAPAIIPQLIMSLWAVSIMTYNKLSEIMMPFHGGNEIRPRINVTTGKTSFNWLFDTGAPITCINADSFWEAFGHQKPRMVKKS
Ga0180040_106048913300016692FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVSPRINVTTGKKTFNWLFDTGAAIKCMNADSFRESFGHSKPRLLKKSA
Ga0208483_101693323300020492FreshwaterVKSLMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKNRPRINVTTGEKTFNWLFDTGAAVTCMNANSFKEAFSGKRPKLLHKG
Ga0208228_101056813300020535FreshwaterMEPLRQAPQVIPQIILSLCAISIVTFNKLSEVMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAVTCM
Ga0208595_103290223300020538FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESFANARP
Ga0208852_103728623300020560FreshwaterSLMEPLRQAPAVIPQIIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNADSFRDSFGQN
Ga0208852_105209223300020560FreshwaterMSLMEPLRQAPLVIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAITCMNANSFRQAFSGKRPK
Ga0208723_102622023300020571FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESFGNARPRLLK
Ga0214238_102466723300020707FreshwaterVKSLMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKNRPRINVTTGEKTFNWLFDTGAAVTCMNANSFKEAFSGKRPKLLHKGTSCVAA
Ga0214236_102093413300020721FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITC
Ga0214246_102845423300020727FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDSFGHNRPRLLKNSAGCIAA
Ga0214170_106053223300020731FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRES
Ga0214172_100122853300020733FreshwaterMSLMEPLRQAPQVIPQIILSLCAISIVTFNKLSEVMTPFYGGNKNRPRINVTTGHKTFNWLFDTGAAVTCMNANSFKEAFSGKRPK
Ga0214203_1002713300021110FreshwaterMSLMEPLRQAPQVIPQIILSLCAISIVTFNKLSEVMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAVTCMNANSFKEAFSGK
Ga0214208_101461813300021117FreshwaterMEPLRQAPLVIPQLIMSLCAISIATCNKLCEIMTPFHGDKKRPRINVTTNQTTFSWLFD
Ga0214204_100596223300021119FreshwaterMEPLRQAPAVIPQIIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNADSFRDSFGQNRP
Ga0214204_102300823300021119FreshwaterMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKIRPRINVTTGEKTFNWLFDTGAAITCMNANSF
Ga0214167_110974123300021136FreshwaterMSLMEPLRQAPQVIPQIILSLCAISIVTFNKLSEVMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAVTCMNANSFKEAFSGKRPKLLHKGTSCVAA
Ga0208384_10297923300025328FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRE
Ga0208870_104059913300025356FreshwaterMSLMEPLRQAPQVIPQIILSLCAISIVTFNKLSEVMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAVTCMNANSFKEAFSGKRPKLL
Ga0208383_101722013300025357FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADR
Ga0207960_102162523300025378FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESFGNA
Ga0208871_105938923300025381FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAIT
Ga0208865_105111123300025411FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDSFGHNRPRLLKDSAGC
Ga0208868_104989413300025415FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKIRPRINVTTGKKTFNWLFDTGDAITCMNADSFRESFGHSKPR
Ga0208253_105277213300025418FreshwaterMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESFGHSKPRLLKNSAGCIAANGSRME
Ga0208106_101305513300025449FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMN
Ga0208389_101026133300025470FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMMPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMN
Ga0208496_108677113300025591FreshwaterMEPLLQAPAVIPQIIMSLCAVSMITYNKLSERMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAA
Ga0208379_104752313300025598FreshwaterPQIIMSLCTISIATCNKLCKIMTPFHGDKKRPRINVTTGDTTFNWLFDTGAAITCMNANSFRQAFKNSRPKKNH
Ga0208741_1003586723300025723FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCM
Ga0208104_102371013300025773FreshwaterMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKIRPRINVTTGEKTFNWLFDTGAAITCMNANSFREAFSGK
Ga0208104_102776913300025773FreshwaterMSLMEPLRQAPLVIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNRPRINVTTGDKTFNWLFDT
Ga0208867_101592823300025782FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESFGNARPRLLKN
Ga0208498_101743413300025785FreshwaterMEPLHQAPAVIPQLIMSLCTISIATCNKICEFMTPFYGGNKMRPRINVTTGEKTFNWLFDTGAAITCMSASSFREAFRTNKPK
Ga0208498_105227423300025785FreshwaterLSLMEPLLQAPAVIPQIIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRMNVTTSNKTFNWLFDTGAAITCMNANSFRDSFGHN
Ga0208873_104689813300025788FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANS
Ga0208873_104801323300025788FreshwaterMSLMEPLRQAPLVIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAITCMNTNS
Ga0208872_110778513300025838FreshwaterMSLMEPLRQAPLVIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAITCMNANSFRQAFS
Ga0208872_116608833300025838FreshwaterMEPLHQAPAVIPQLIMSLCTISIATCNKICEFMTPFYGGNKMRPRINVTTGEKTFNWLFDTGAAITCMSASSF
Ga0208009_107653413300027114Deep SubsurfaceMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESFGNARPRLLKNSAGCIAANGSRM
Ga0209617_1027704523300027720Freshwater And SedimentVKSLMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKNRPRINVTTGEKTFNWLFDTGAAV
Ga0209617_1037270723300027720Freshwater And SedimentMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKNRPRINVTTGEKTFNWLFDTGAAV
Ga0209972_1025725213300027793Freshwater LakeMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDSFGHNRPRLLKNSAGCIA
Ga0209972_1039829313300027793Freshwater LakeMEPLRQAPAVIPQIIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNADSFR
Ga0209107_1021941113300027797Freshwater And SedimentMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKIRPRINVTTGEKTFNWLFDTGAAITVV
Ga0209985_1023141423300027806Freshwater LakeMSLMEPLRQAPLVIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAITCMNANSFRQAFSGKRPKL
Ga0209990_1019855823300027816Freshwater LakeMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESYGHSKPRLIKNSAG
Ga0209990_1022884713300027816Freshwater LakeMEPLRQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFLGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANS
Ga0316218_106635213300032117FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADS
Ga0316218_109282413300032117FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKIRPRINVTTGNKTFNWLFDTGAAITCMNANSF
Ga0316229_119987423300032676FreshwaterMEPLLQAPAIIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDS
Ga0316229_136220913300032676FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESFGNARPR
Ga0334980_0344611_339_5723300033816FreshwaterMEPLRQAPQVIPQLILSLCAISVVTFNKLSEVMTPFYGGNKIQPRINVTTGEKTFNWLFDTGAAITCMNANSFREAFL
Ga0334980_0396258_1_2643300033816FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESYGHSKPKLIKHS
Ga0334981_0205103_710_9133300033980FreshwaterMEPLRQAPAVIPQLIMSLCAVSMITYNKLSEVMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCM
Ga0334981_0221800_2_2563300033980FreshwaterMEPLLQAPAIIPQIIMSLCAVSIVTYNKLSEVMTPFHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESYGHSKPKLI
Ga0334981_0395547_3_2093300033980FreshwaterMSLMEPLRQAPLVIPQLILSLCAVSMVTFNKLSEIMTPFYGGNKNRPRINVTTGDKTFNWLFDTGAAIT
Ga0335020_0066012_1644_18743300034082FreshwaterMEPLLQAPAVIPQIIMSLCAVSIVTYNKLSEVMTPLHGGNKVRPRINVTTGKKTFNWLFDTGAAITCMNADSFRESF
Ga0335068_0351271_1_2673300034116FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDSFGHNRPRLLKDSA
Ga0335053_0145027_1374_16043300034118FreshwaterMEPLRQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFLGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDSF
Ga0335053_0784600_3_1973300034118FreshwaterMEPLLQAPAVIPQIIMSLCAVSMITYNKLSEIMTPFHGGNKVRPRINVTTGNKTFNWLFDTGAAI
Ga0335049_0723431_311_5983300034272FreshwaterMEPLLQAPAVIPQLIMSLCAVSIVTYNKLSEIMTPFHGGNKTRPRINVTTGKTSFNWLFDTGAAITCMNADSFRDTFGHQKPRLVKKSAGCIAANG
Ga0335052_0424001_1_1773300034279FreshwaterMEPLRQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFIGGNKVRPRINVTTGNKTFNWLF
Ga0335048_0307631_538_8193300034356FreshwaterMEPLLQAPAVIPQLIMSLCAVSMITYNKLSEIMTPFLGGNKVRPRINVTTGNKTFNWLFDTGAAITCMNANSFRDSFGHNRPRLLKDSAGCIAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.